F321387

General Info

Members Datasets Scaffolds Average Seq Length
211 146 205 224

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100029435|Ga0070665_1000294354
Length 263
Sequence MPPERSSVASYPSFDRGANMRLMLSSKQTLTRRGLAVLAGATLAIGALAGCTHKKDTASTDSGPLPAASDLMSQSEQVMSSLSSAHFTIDVKGTLPGVPLQSAQGDLTKEGNAKGTAKITELGSSIEADFVILGQDFYLNAGTGGFQKLPLATASSIFDPSAILDPNRGIVKLMSAATDTKTVAKEQVNGKDAYKVSLTADPASVSGLIPGAGAGTKGDIWIDATTHEVVKGVFTVPGANGAKGATVTVGISNFNVPVTISAP

Samples

Sample ID Description Type Environment
1 2582580736 Prauserella sp. Am3 Isolate Unclassified
2 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
3 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
4 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
5 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
79 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
80 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
81 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
82 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
97 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
141 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
142 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
143 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
144 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
145 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
146 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 0
Isolates 2.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.32
Nodule 0
Rhizoplane 9.48
Rhizosphere 79.62
Stem 0
Stem Tuber 0
Unclassified 7.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10134266 3300003322 Bacteria 8522
2 Ga0070683_100027343 3300005329 Bacteria 5144
3 Ga0070690_100528411 3300005330 Unclassified 886
4 Ga0070680_100059428 3300005336 Bacteria 3128
5 Ga0070682_100163204 3300005337 Bacteria 1541
6 Ga0070668_100000441 3300005347 Bacteria 27436
7 Ga0070668_100016874 3300005347 Bacteria 5461
8 Ga0070674_100343800 3300005356 Bacteria 1203
9 Ga0070667_100033138 3300005367 Bacteria 4315
10 Ga0070709_10145820 3300005434 Bacteria 1631
11 Ga0070714_100636500 3300005435 Bacteria 1026
12 Ga0070713_100075999 3300005436 Bacteria 2851
13 Ga0070713_100461873 3300005436 Bacteria 1194
14 Ga0070678_100219901 3300005456 Bacteria 1578
15 Ga0070684_100528327 3300005535 Bacteria 1094
16 Ga0070665_100029435 3300005548 Bacteria 5528
17 Ga0070665_100042406 3300005548 Bacteria 4574
18 Ga0070664_100522427 3300005564 Bacteria 1096
19 Ga0068857_100093615 3300005577 Bacteria 2691
20 Ga0068859_100120486 3300005617 Bacteria 2691
21 Ga0068864_100011149 3300005618 Bacteria 7430
22 Ga0068864_100114956 3300005618 Bacteria 2400
23 Ga0068864_100331952 3300005618 Bacteria 1431
24 Ga0068864_100438947 3300005618 Bacteria 1247
25 Ga0068861_100344547 3300005719 Bacteria 1305
26 Ga0068863_100033278 3300005841 Bacteria 4910
27 Ga0068863_100129326 3300005841 Bacteria 2410
28 Ga0068858_100039149 3300005842 Bacteria 4396
29 Ga0068858_100089277 3300005842 Bacteria 2868
30 Ga0068860_100019121 3300005843 Bacteria 6652
31 Ga0068862_100015742 3300005844 Bacteria 6287
32 Ga0068862_100065583 3300005844 Bacteria 3128
33 Ga0081455_10150888 3300005937 Bacteria 1792
34 Ga0081540_1004270 3300005983 Bacteria 10958
35 Ga0081539_10156447 3300005985 Bacteria 1091
36 Ga0075428_100021175 3300006844 Bacteria 7200
37 Ga0075428_100150461 3300006844 Bacteria 2528
38 Ga0075428_100498396 3300006844 Bacteria 1303
39 Ga0075430_100001177 3300006846 Bacteria 20975
40 Ga0075430_100071835 3300006846 Bacteria 2903
41 Ga0075430_100083960 3300006846 Bacteria 2668
42 Ga0075431_100310881 3300006847 Bacteria 1591
43 Ga0075431_100436787 3300006847 Bacteria 1306
44 Ga0075429_100002322 3300006880 Bacteria 15975
45 Ga0075429_100013329 3300006880 Bacteria 7127
46 Ga0097620_100120486 3300006931 Bacteria 2691
47 Ga0105245_10264988 3300009098 Bacteria 1673
48 Ga0105245_10278047 3300009098 Bacteria 1635
49 Ga0105247_10240874 3300009101 Bacteria 1232
50 Ga0114129_10002127 3300009147 Bacteria 27301
51 Ga0114129_10005558 3300009147 Bacteria 17830
52 Ga0105243_10137929 3300009148 Bacteria 2078
53 Ga0105248_10023153 3300009177 Bacteria 6899
54 Ga0105248_10081498 3300009177 Bacteria 3637
55 Ga0105248_10346005 3300009177 Bacteria 1674
56 Ga0105249_10961707 3300009553 Bacteria 922
57 Ga0105249_11211756 3300009553 Bacteria 826
58 Ga0157374_10690094 3300013296 Bacteria 1034
59 Ga0163162_10371384 3300013306 Bacteria 1563
60 Ga0163162_10647531 3300013306 Bacteria 1180
61 Ga0157375_10841439 3300013308 Bacteria 1064
62 Ga0157375_11021682 3300013308 Bacteria 966
63 Ga0163163_10004520 3300014325 Bacteria 11868
64 Ga0163163_10047738 3300014325 Bacteria 4209
65 Ga0163163_10091623 3300014325 Bacteria 3054
66 Ga0163163_10230419 3300014325 Bacteria 1901
67 Ga0163163_11258287 3300014325 Unclassified 802
68 Ga0157380_10269532 3300014326 Bacteria 1551
69 Ga0157379_10068342 3300014968 Bacteria 3177
70 Ga0157379_10155242 3300014968 Bacteria 2064
71 Ga0207699_10069572 3300025906 Bacteria 2147
72 Ga0207693_10019415 3300025915 Bacteria 5406
73 Ga0207659_10247291 3300025926 Bacteria 1446
74 Ga0207687_10267794 3300025927 Bacteria 1364
75 Ga0207687_10324480 3300025927 Bacteria 1247
76 Ga0207664_10580405 3300025929 Bacteria 1007
77 Ga0207711_10009684 3300025941 Bacteria 8027
78 Ga0207711_10019526 3300025941 Bacteria 5641
79 Ga0207668_10003260 3300025972 Bacteria 9511
80 Ga0207668_10092148 3300025972 Bacteria 2229
81 Ga0207658_10034806 3300025986 Bacteria 3602
82 Ga0207677_10184625 3300026023 Bacteria 1644
83 Ga0207703_10044044 3300026035 Bacteria 3584
84 Ga0207702_10378081 3300026078 Bacteria 1361
85 Ga0207641_10039475 3300026088 Bacteria 3948
86 Ga0207641_10201437 3300026088 Bacteria 1835
87 Ga0207676_10059642 3300026095 Bacteria 3014
88 Ga0207676_10316208 3300026095 Bacteria 1431
89 Ga0207674_10072240 3300026116 Bacteria 3466
90 Ga0207674_10130149 3300026116 Bacteria 2481
91 Ga0207674_10364410 3300026116 Bacteria 1397
92 Ga0207675_100227830 3300026118 Bacteria 1797
93 Ga0207675_100728939 3300026118 Bacteria 1001
94 Ga0268266_10226083 3300028379 Bacteria 1722
95 Ga0268266_10701202 3300028379 Bacteria 976
96 Ga0268265_10026634 3300028380 Bacteria 4116
97 Ga0268265_10080421 3300028380 Bacteria 2570
98 Ga0268265_10185892 3300028380 Bacteria 1790
99 Ga0268264_10038192 3300028381 Bacteria 3961
100 Ga0307517_10101014 3300028786 Bacteria 2274
101 Ga0307515_10033342 3300028794 Bacteria 8484
102 Ga0307515_10041967 3300028794 Bacteria 7175
103 Ga0307515_10126117 3300028794 Bacteria 2858
104 Ga0307512_10005573 3300030522 Bacteria 13077
105 Ga0307512_10009267 3300030522 Bacteria 9505
106 Ga0307513_10041612 3300031456 Bacteria 5069
107 Ga0307508_10021699 3300031616 Bacteria 5840
108 Ga0307508_10114924 3300031616 Bacteria 2292
109 Ga0307516_10166049 3300031730 Bacteria 1952
110 Ga0307516_10209838 3300031730 Bacteria 1662
111 Ga0307405_10053628 3300031731 Bacteria 2513
112 Ga0307410_10315918 3300031852 Bacteria 1238
113 Ga0307406_10065120 3300031901 Bacteria 2368
114 Ga0307409_100153287 3300031995 Bacteria 2004
115 Ga0307415_100043669 3300032126 Bacteria 2992
116 Ga0307415_100048785 3300032126 Bacteria 2859
117 Ga0307415_100056632 3300032126 Bacteria 2689
118 Ga0307507_10119757 3300033179 Bacteria 2111
119 Ga0307507_10136646 3300033179 Bacteria 1896
120 Ga0373932_0012799 3300035112 Bacteria 2073
121 Ga0373941_0059025 3300035115 Bacteria 1243
122 Ga0373942_0000803 3300035207 Bacteria 8650
123 Ga0373962_0003732 3300035242 Bacteria 3664
124 Ga0373935_0026645 3300035692 Bacteria 3570
125 Ga0373947_0339155 3300035725 Bacteria 1007
126 Ga0395899_0051059 3300037312 Bacteria 3070
127 Ga0395900_0227072 3300037418 Bacteria 1879
128 Ga0395898_0007510 3300037466 Bacteria 11585
129 Ga0395905_0008107 3300037471 Bacteria 10377
130 Ga0395901_0137503 3300038443 Bacteria 2567
131 Ga0439448_0064824 3300042005 Bacteria 1211
132 Ga0495592_0045669 3300046454 Bacteria 3267
133 Ga0495629_0065049 3300046459 Bacteria 2546
134 Ga0495629_0219774 3300046459 Bacteria 1311
135 Ga0495629_0229850 3300046459 Bacteria 1279
136 Ga0495653_0039141 3300046463 Bacteria 3716
137 Ga0495580_0037890 3300046472 Bacteria 3457
138 Ga0495582_0107228 3300046473 Bacteria 1568
139 Ga0495662_0000506 3300046476 Bacteria 17722
140 Ga0495664_0061663 3300046477 Bacteria 2232
141 Ga0495606_0003348 3300046507 Bacteria 17089
142 Ga0495608_0002801 3300046511 Bacteria 12504
143 Ga0495628_0167266 3300046516 Unclassified 1668
144 Ga0495630_0023840 3300046517 Bacteria 4522
145 Ga0495630_0458541 3300046517 Bacteria 977
146 Ga0495630_0699055 3300046517 Bacteria 776
147 Ga0495666_0002008 3300046526 Bacteria 10050
148 Ga0495665_0004838 3300046531 Bacteria 7265
149 Ga0495665_0313753 3300046531 Bacteria 801
150 Ga0495640_0059646 3300046533 Bacteria 2597
151 Ga0495586_0019794 3300046535 Bacteria 3584
152 Ga0495587_0017649 3300046536 Bacteria 4431
153 Ga0495645_0002499 3300046543 Bacteria 12477
154 Ga0495668_0000206 3300046616 Bacteria 85159
155 Ga0495634_0007233 3300046642 Bacteria 8369
156 Ga0495625_0006569 3300046660 Bacteria 10324
157 Ga0495599_0041276 3300046678 Bacteria 2897
158 Ga0495623_0043845 3300046679 Bacteria 2844
159 Ga0495646_0000280 3300046680 Bacteria 26054
160 Ga0495613_0004238 3300046689 Bacteria 10743
161 Ga0495600_0212408 3300046809 Bacteria 1240
162 Ga0495674_0025176 3300047319 Bacteria 5461
163 Ga0495680_0254794 3300047322 Bacteria 1243
164 Ga0495675_0008415 3300047444 Bacteria 6389
165 Ga0495684_0032227 3300047471 Bacteria 4022
166 Ga0495593_0012910 3300047673 Bacteria 4772
167 Ga0495602_0004104 3300048088 Bacteria 15162
168 Ga0495626_0000152 3300048091 Bacteria 85903
169 Ga0496100_0072727 3300048903 Bacteria 2299
170 Ga0496103_0633102 3300048906 Bacteria 680
171 Ga0496104_0008643 3300048907 Bacteria 9060
172 Ga0496105_0028276 3300048908 Bacteria 4586
173 Ga0496105_0065159 3300048908 Bacteria 3007
174 Ga0496108_0003627 3300048911 Bacteria 12372
175 Ga0496108_0005973 3300048911 Bacteria 9865
176 Ga0496109_0006477 3300048912 Bacteria 9858
177 Ga0496109_0102678 3300048912 Bacteria 2653
178 Ga0496109_0178514 3300048912 Bacteria 1994
179 Ga0496109_0215004 3300048912 Bacteria 1808
180 Ga0496110_0003179 3300048913 Bacteria 12497
181 Ga0496110_0025678 3300048913 Bacteria 5037
182 Ga0496111_0014093 3300048914 Bacteria 5453
183 Ga0496111_0082331 3300048914 Bacteria 2351
184 Ga0496112_0013357 3300048915 Bacteria 7580
185 Ga0496113_0168377 3300048916 Bacteria 1734
186 Ga0496114_0026668 3300048917 Bacteria 4733
187 Ga0496114_0124280 3300048917 Bacteria 2222
188 Ga0496114_0745542 3300048917 Bacteria 856
189 nmdc:mga05p37_147016_c1 3300050507 Bacteria 2885
190 nmdc:mga05p37_238729_c1 3300050507 Bacteria 2187
191 nmdc:mga09592_139380_c1 3300050508 Bacteria 2090
192 nmdc:mga09592_26260_c1 3300050508 Bacteria 4824
193 nmdc:mga0qj67_1668_c1 3300050509 Bacteria 15644
194 nmdc:mga0qj67_35806_c1 3300050509 Bacteria 3882
195 nmdc:mga06r32_178643_c1 3300050510 Bacteria 2108
196 Ga0495601_0063458 3300053077 Bacteria 2348
197 Ga0495619_0422473 3300053085 Unclassified 920
198 Ga0495619_0452599 3300053085 Bacteria 885
199 Ga0500644_0026159 3300053088 Bacteria 1803
200 Ga0500646_0000320 3300053090 Bacteria 14742
201 Ga0500583_0022872 3300053092 Bacteria 2626
202 Ga0500583_0113012 3300053092 Bacteria 1339
203 Ga0500617_162180 3300053124 Bacteria 870
204 Ga0500658_0275221 3300053134 Unclassified 774
205 Ga0500588_0006234 3300053146 Bacteria 2689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048906 Ga0496103_0633102 Ga0496103_0633102_111_656 179
2 3300046517 Ga0495630_0699055 Ga0495630_0699055_54_740 183
3 3300053077 Ga0495601_0063458 Ga0495601_0063458_1768_2328 183
4 3300005564 Ga0070664_100522427 Ga0070664_1005224272 184
5 3300026116 Ga0207674_10130149 Ga0207674_101301492 189
6 3300048912 Ga0496109_0178514 Ga0496109_0178514_71_757 190
7 3300005937 Ga0081455_10150888 Ga0081455_101508882 191
8 3300009148 Ga0105243_10137929 Ga0105243_101379292 191
9 3300046459 Ga0495629_0229850 Ga0495629_0229850_400_1089 191
10 3300046473 Ga0495582_0107228 Ga0495582_0107228_259_948 191
11 3300048917 Ga0496114_0026668 Ga0496114_0026668_627_1316 191
12 3300048917 Ga0496114_0745542 Ga0496114_0745542_85_771 191
13 3300053134 Ga0500658_0275221 Ga0500658_0275221_13_702 192
14 3300009098 Ga0105245_10278047 Ga0105245_102780472 193
15 3300026023 Ga0207677_10184625 Ga0207677_101846252 193
16 3300009098 Ga0105245_10264988 Ga0105245_102649881 194
17 3300046531 Ga0495665_0313753 Ga0495665_0313753_35_628 194
18 3300031730 Ga0307516_10166049 Ga0307516_101660492 198
19 3300005434 Ga0070709_10145820 Ga0070709_101458202 200
20 3300005436 Ga0070713_100461873 Ga0070713_1004618732 200
21 3300005577 Ga0068857_100093615 Ga0068857_1000936152 200
22 3300005618 Ga0068864_100011149 Ga0068864_1000111492 200
23 3300005841 Ga0068863_100129326 Ga0068863_1001293262 200
24 3300005842 Ga0068858_100089277 Ga0068858_1000892772 200
25 3300009177 Ga0105248_10081498 Ga0105248_100814984 200
26 3300013306 Ga0163162_10371384 Ga0163162_103713842 200
27 3300014325 Ga0163163_10004520 Ga0163163_100045206 200
28 3300025927 Ga0207687_10267794 Ga0207687_102677942 200
29 3300025906 Ga0207699_10069572 Ga0207699_100695722 201
30 3300025915 Ga0207693_10019415 Ga0207693_100194154 201
31 3300025941 Ga0207711_10019526 Ga0207711_100195263 201
32 3300026088 Ga0207641_10201437 Ga0207641_102014372 201
33 3300026095 Ga0207676_10059642 Ga0207676_100596422 201
34 3300026116 Ga0207674_10072240 Ga0207674_100722403 201
35 3300048908 Ga0496105_0065159 Ga0496105_0065159_2098_2796 201
36 3300048911 Ga0496108_0003627 Ga0496108_0003627_216_914 201
37 3300048912 Ga0496109_0006477 Ga0496109_0006477_3188_3886 201
38 3300048913 Ga0496110_0025678 Ga0496110_0025678_2339_3037 201
39 3300048914 Ga0496111_0014093 Ga0496111_0014093_4560_5258 201
40 3300048915 Ga0496112_0013357 Ga0496112_0013357_5634_6332 201
41 3300048916 Ga0496113_0168377 Ga0496113_0168377_18_716 201
42 3300009553 Ga0105249_11211756 Ga0105249_112117561 203
43 3300035725 Ga0373947_0339155 Ga0373947_0339155_176_874 203
44 3300053085 Ga0495619_0422473 Ga0495619_0422473_67_765 203
45 3300033179 Ga0307507_10136646 Ga0307507_101366462 204
46 3300053092 Ga0500583_0113012 Ga0500583_0113012_607_1302 204
47 3300031730 Ga0307516_10209838 Ga0307516_102098382 205
48 3300035692 Ga0373935_0026645 Ga0373935_0026645_1932_2627 205
49 3300042005 Ga0439448_0064824 Ga0439448_0064824_22_705 205
50 3300032126 Ga0307415_100056632 Ga0307415_1000566322 207
51 3300046459 Ga0495629_0219774 Ga0495629_0219774_337_1023 207
52 3300009177 Ga0105248_10023153 Ga0105248_100231532 208
53 3300014968 Ga0157379_10155242 Ga0157379_101552422 208
54 3300025926 Ga0207659_10247291 Ga0207659_102472912 208
55 3300025941 Ga0207711_10009684 Ga0207711_100096846 208
56 3300053124 Ga0500617_162180 Ga0500617_162180_162_821 208
57 3300013296 Ga0157374_10690094 Ga0157374_106900941 209
58 3300037418 Ga0395900_0227072 Ga0395900_0227072_749_1435 209
59 3300037466 Ga0395898_0007510 Ga0395898_0007510_9460_10146 209
60 3300037471 Ga0395905_0008107 Ga0395905_0008107_8265_8951 209
61 3300038443 Ga0395901_0137503 Ga0395901_0137503_1682_2368 209
62 3300048903 Ga0496100_0072727 Ga0496100_0072727_1449_2135 209
63 3300048907 Ga0496104_0008643 Ga0496104_0008643_8142_8828 209
64 3300048908 Ga0496105_0028276 Ga0496105_0028276_3694_4380 209
65 3300048911 Ga0496108_0005973 Ga0496108_0005973_7924_8610 209
66 3300048912 Ga0496109_0102678 Ga0496109_0102678_219_905 209
67 3300048913 Ga0496110_0003179 Ga0496110_0003179_10359_11045 209
68 3300048914 Ga0496111_0082331 Ga0496111_0082331_209_895 209
69 3300048917 Ga0496114_0124280 Ga0496114_0124280_1350_2036 209
70 3300037312 Ga0395899_0051059 Ga0395899_0051059_828_1514 210
71 3300046517 Ga0495630_0458541 Ga0495630_0458541_241_927 210
72 3300046809 Ga0495600_0212408 Ga0495600_0212408_344_1030 210
73 3300047322 Ga0495680_0254794 Ga0495680_0254794_537_1223 210
74 3300053085 Ga0495619_0452599 Ga0495619_0452599_72_758 210
75 3300009147 Ga0114129_10005558 Ga0114129_100055586 211
76 3300033179 Ga0307507_10119757 Ga0307507_101197572 211
77 3300050507 nmdc:mga05p37_147016_c1 nmdc:mga05p37_147016_c1_1280_1975 211
78 3300050508 nmdc:mga09592_139380_c1 nmdc:mga09592_139380_c1_173_868 211
79 3300050509 nmdc:mga0qj67_35806_c1 nmdc:mga0qj67_35806_c1_1347_2042 211
80 3300050510 nmdc:mga06r32_178643_c1 nmdc:mga06r32_178643_c1_1153_1848 211
81 iso_pu_bacteria 2582580736 2583152414 211
82 3300005844 Ga0068862_100065583 Ga0068862_1000655832 212
83 3300005983 Ga0081540_1004270 Ga0081540_10042705 212
84 3300025972 Ga0207668_10003260 Ga0207668_100032602 212
85 3300028380 Ga0268265_10026634 Ga0268265_100266342 212
86 3300006844 Ga0075428_100021175 Ga0075428_1000211754 214
87 iso_pu_bacteria 2795385470 2795779733 215
88 iso_pu_bacteria 2891326441 2891327199 216
89 3300046526 Ga0495666_0002008 Ga0495666_0002008_8893_9615 217
90 3300046533 Ga0495640_0059646 Ga0495640_0059646_1541_2263 217
91 3300005356 Ga0070674_100343800 Ga0070674_1003438001 218
92 3300031731 Ga0307405_10053628 Ga0307405_100536282 218
93 3300031852 Ga0307410_10315918 Ga0307410_103159182 218
94 3300031901 Ga0307406_10065120 Ga0307406_100651202 218
95 3300031995 Ga0307409_100153287 Ga0307409_1001532872 218
96 3300032126 Ga0307415_100048785 Ga0307415_1000487853 218
97 3300048912 Ga0496109_0215004 Ga0496109_0215004_901_1776 218
98 iso_pu_bacteria 2887478801 2887481851 219
99 3300005456 Ga0070678_100219901 Ga0070678_1002199012 220
100 3300006844 Ga0075428_100498396 Ga0075428_1004983961 220
101 3300006846 Ga0075430_100001177 Ga0075430_1000011777 220
102 3300006846 Ga0075430_100083960 Ga0075430_1000839602 220
103 3300006847 Ga0075431_100310881 Ga0075431_1003108812 220
104 3300006880 Ga0075429_100013329 Ga0075429_1000133296 220
105 3300009147 Ga0114129_10002127 Ga0114129_100021273 220
106 3300014326 Ga0157380_10269532 Ga0157380_102695322 220
107 3300028794 Ga0307515_10126117 Ga0307515_101261172 220
108 3300032126 Ga0307415_100043669 Ga0307415_1000436692 220
109 3300035115 Ga0373941_0059025 Ga0373941_0059025_226_906 220
110 3300035207 Ga0373942_0000803 Ga0373942_0000803_3631_4311 220
111 3300035242 Ga0373962_0003732 Ga0373962_0003732_1202_1882 220
112 3300046454 Ga0495592_0045669 Ga0495592_0045669_277_993 220
113 3300046463 Ga0495653_0039141 Ga0495653_0039141_1108_1824 220
114 3300046472 Ga0495580_0037890 Ga0495580_0037890_1701_2417 220
115 3300046476 Ga0495662_0000506 Ga0495662_0000506_5655_6371 220
116 3300046477 Ga0495664_0061663 Ga0495664_0061663_32_748 220
117 3300046511 Ga0495608_0002801 Ga0495608_0002801_9752_10468 220
118 3300046516 Ga0495628_0167266 Ga0495628_0167266_929_1645 220
119 3300046517 Ga0495630_0023840 Ga0495630_0023840_1765_2481 220
120 3300046531 Ga0495665_0004838 Ga0495665_0004838_5169_5885 220
121 3300046535 Ga0495586_0019794 Ga0495586_0019794_1521_2237 220
122 3300046536 Ga0495587_0017649 Ga0495587_0017649_1823_2539 220
123 3300046543 Ga0495645_0002499 Ga0495645_0002499_9615_10331 220
124 3300046642 Ga0495634_0007233 Ga0495634_0007233_1765_2481 220
125 3300046678 Ga0495599_0041276 Ga0495599_0041276_499_1215 220
126 3300046679 Ga0495623_0043845 Ga0495623_0043845_1765_2481 220
127 3300046680 Ga0495646_0000280 Ga0495646_0000280_24479_25195 220
128 3300046689 Ga0495613_0004238 Ga0495613_0004238_364_1080 220
129 3300047319 Ga0495674_0025176 Ga0495674_0025176_1414_2130 220
130 3300047444 Ga0495675_0008415 Ga0495675_0008415_4942_5658 220
131 3300047471 Ga0495684_0032227 Ga0495684_0032227_1542_2258 220
132 3300047673 Ga0495593_0012910 Ga0495593_0012910_2531_3247 220
133 3300048088 Ga0495602_0004104 Ga0495602_0004104_182_898 220
134 3300050507 nmdc:mga05p37_238729_c1 nmdc:mga05p37_238729_c1_513_1217 220
135 3300050508 nmdc:mga09592_26260_c1 nmdc:mga09592_26260_c1_2332_3036 220
136 3300050509 nmdc:mga0qj67_1668_c1 nmdc:mga0qj67_1668_c1_14936_15625 220
137 3300053090 Ga0500646_0000320 Ga0500646_0000320_3992_4687 220
138 3300053092 Ga0500583_0022872 Ga0500583_0022872_150_845 220
139 3300053146 Ga0500588_0006234 Ga0500588_0006234_93_788 220
140 3300005617 Ga0068859_100120486 Ga0068859_1001204863 221
141 3300005618 Ga0068864_100438947 Ga0068864_1004389472 221
142 3300006931 Ga0097620_100120486 Ga0097620_1001204862 221
143 3300028380 Ga0268265_10080421 Ga0268265_100804213 221
144 3300005330 Ga0070690_100528411 Ga0070690_1005284111 222
145 3300005535 Ga0070684_100528327 Ga0070684_1005283272 222
146 3300005618 Ga0068864_100114956 Ga0068864_1001149562 222
147 3300006844 Ga0075428_100150461 Ga0075428_1001504612 222
148 3300006846 Ga0075430_100071835 Ga0075430_1000718352 222
149 3300006847 Ga0075431_100436787 Ga0075431_1004367872 222
150 3300006880 Ga0075429_100002322 Ga0075429_1000023222 222
151 3300009553 Ga0105249_10961707 Ga0105249_109617071 222
152 3300013308 Ga0157375_10841439 Ga0157375_108414392 222
153 3300014325 Ga0163163_10230419 Ga0163163_102304192 222
154 3300014325 Ga0163163_11258287 Ga0163163_112582871 222
155 3300026118 Ga0207675_100728939 Ga0207675_1007289392 222
156 3300005985 Ga0081539_10156447 Ga0081539_101564472 223
157 3300035112 Ga0373932_0012799 Ga0373932_0012799_1246_1941 223
158 3300046507 Ga0495606_0003348 Ga0495606_0003348_7276_7974 223
159 3300046616 Ga0495668_0000206 Ga0495668_0000206_5911_6609 223
160 3300046660 Ga0495625_0006569 Ga0495625_0006569_5929_6627 223
161 3300048091 Ga0495626_0000152 Ga0495626_0000152_79275_79973 223
162 3300005337 Ga0070682_100163204 Ga0070682_1001632042 224
163 3300005347 Ga0070668_100000441 Ga0070668_10000044123 224
164 3300005347 Ga0070668_100016874 Ga0070668_1000168742 224
165 3300005367 Ga0070667_100033138 Ga0070667_1000331383 224
166 3300005719 Ga0068861_100344547 Ga0068861_1003445472 224
167 3300005842 Ga0068858_100039149 Ga0068858_1000391492 224
168 3300005843 Ga0068860_100019121 Ga0068860_1000191212 224
169 3300005844 Ga0068862_100015742 Ga0068862_1000157426 224
170 3300013306 Ga0163162_10647531 Ga0163162_106475312 224
171 3300013308 Ga0157375_11021682 Ga0157375_110216822 224
172 3300014325 Ga0163163_10047738 Ga0163163_100477383 224
173 3300014968 Ga0157379_10068342 Ga0157379_100683423 224
174 3300025927 Ga0207687_10324480 Ga0207687_103244802 224
175 3300025972 Ga0207668_10092148 Ga0207668_100921482 224
176 3300025986 Ga0207658_10034806 Ga0207658_100348062 224
177 3300026035 Ga0207703_10044044 Ga0207703_100440443 224
178 3300026116 Ga0207674_10364410 Ga0207674_103644102 224
179 3300026118 Ga0207675_100227830 Ga0207675_1002278302 224
180 3300028380 Ga0268265_10185892 Ga0268265_101858922 224
181 3300028381 Ga0268264_10038192 Ga0268264_100381922 224
182 3300028794 Ga0307515_10033342 Ga0307515_100333425 224
183 3300030522 Ga0307512_10009267 Ga0307512_100092675 224
184 3300005329 Ga0070683_100027343 Ga0070683_1000273432 225
185 3300028786 Ga0307517_10101014 Ga0307517_101010142 225
186 3300028794 Ga0307515_10041967 Ga0307515_100419672 225
187 3300030522 Ga0307512_10005573 Ga0307512_100055738 225
188 3300031456 Ga0307513_10041612 Ga0307513_100416122 225
189 3300031616 Ga0307508_10021699 Ga0307508_100216993 225
190 3300031616 Ga0307508_10114924 Ga0307508_101149242 225
191 3300053088 Ga0500644_0026159 Ga0500644_0026159_323_1027 225
192 3300026078 Ga0207702_10378081 Ga0207702_103780811 226
193 3300005336 Ga0070680_100059428 Ga0070680_1000594283 227
194 3300005435 Ga0070714_100636500 Ga0070714_1006365002 227
195 3300005436 Ga0070713_100075999 Ga0070713_1000759991 227
196 3300009101 Ga0105247_10240874 Ga0105247_102408742 227
197 3300009177 Ga0105248_10346005 Ga0105248_103460052 227
198 3300014325 Ga0163163_10091623 Ga0163163_100916232 227
199 3300025929 Ga0207664_10580405 Ga0207664_105804051 227
200 3300028379 Ga0268266_10701202 Ga0268266_107012021 227
201 iso_pu_bacteria 2751185782 2753263938 227
202 iso_pu_bacteria 8001781756 8001788903 227
203 3300046459 Ga0495629_0065049 Ga0495629_0065049_620_1357 228
204 3300005548 Ga0070665_100029435 Ga0070665_1000294354 234
205 3300005548 Ga0070665_100042406 Ga0070665_1000424062 234
206 3300005618 Ga0068864_100331952 Ga0068864_1003319522 234
207 3300005841 Ga0068863_100033278 Ga0068863_1000332785 234
208 3300026088 Ga0207641_10039475 Ga0207641_100394754 234
209 3300026095 Ga0207676_10316208 Ga0207676_103162082 234
210 3300028379 Ga0268266_10226083 Ga0268266_102260832 234
211 3300003322 rootL2_10134266 rootL2_101342667 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07161

LppX_LprAFG

LppX_LprAFG lipoprotein

67

260

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mha-assembly2.cif.gz_B crystal structure of lprg from mycobacterium tuberculosis bound to pim 0.8948 38 231
3mha-assembly2.cif.gz_B crystal structure of lprg from mycobacterium tuberculosis bound to pim 0.8774 38 231
3mh8-assembly2.cif.gz_B crystal structure of lprg from mycobacterium tuberculosis 0.877 38 231
3mh8-assembly2.cif.gz_B crystal structure of lprg from mycobacterium tuberculosis 0.8558 38 231
4qa8-assembly1.cif.gz_A crystal structure of lprf from mycobacterium bovis 0.8526 42 236
ID Description Score Start End Superfamily
3mhaB00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A; 0.8948 38 231 2.50.20.20
3mhaB00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A; 0.8774 38 231 2.50.20.20
af_P9WK55_36_241_2.50.20.20 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A; 0.8583 42 234 2.50.20.20
4qa8A00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A; 0.8526 42 236 2.50.20.20
af_P9WK55_36_241_2.50.20.20 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A; 0.8036 42 234 2.50.20.20
ID Description Score Start End GO Terms
AF-A0A366M2Y5-F1-model_v4 Lipoprotein LprG 0.9482 47 236 GO:0030313
AF-A0A366M2Y5-F1-model_v4 Lipoprotein LprG 0.9339 47 236 GO:0030313
AF-A0A1H0X0P5-F1-model_v4 Lipoprotein LprG 0.9173 54 236 GO:0030313
AF-A0A1H0X0P5-F1-model_v4 Lipoprotein LprG 0.9025 54 236 GO:0030313
AF-A0A535KAR1-F1-model_v4 NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9) 0.89 38 236 GO:0003954
GO:0006116
GO:0030313

Feature Viewer

pLDDT pTM Quality
84.48 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map