F321303

General Info

Members Datasets Scaffolds Average Seq Length
211 167 422 243

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100044280|Ga0070714_1000442802
Length 271
Sequence MRRSACPRCWRTSGGRVGGVTEPSPDLKGIRALVTGGTSGLGFAMSQALAEAGARVALTGRAEPRVQDAVTRIARGDQVAGLVMDVRDEQSVTAGVDRVLTRLGGIDVLVNNAGIGMHTVNPHFMTEPIGFWQVSPDGFRDLLTTNIVGYFLVARAVVPHMLEVGHGKIVNISVSETTMRRRGFTPYGPSRAATDALSHIMAADLAGTGIDVNLLLPGGVTRSGMTPDSAPEDVQAAWLDPAIMGPPVVWLASPASDGITDQRIIATEFAA

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
163 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 2643221696 Nocardioides sp. Root140 Isolate Unclassified
166 2858868258 Micromonospora sp. MH33 Isolate Unclassified
167 2902582711 Micromonospora sp. AP08 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 0.95
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 4.27
Rhizosphere 89.1
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100044280 3300005435 Bacteria 3767
2 Ga0070683_100160865 3300005329 Bacteria 2130
3 Ga0070683_100424785 3300005329 Bacteria 1268
4 Ga0068869_100085716 3300005334 Bacteria 2360
5 Ga0070680_100132942 3300005336 Bacteria 2082
6 Ga0070682_100011809 3300005337 Bacteria 4996
7 Ga0068868_100190063 3300005338 Bacteria 1707
8 Ga0070660_100137431 3300005339 Bacteria 1959
9 Ga0070660_100182960 3300005339 Bacteria 1696
10 Ga0070661_100015122 3300005344 Bacteria 5445
11 Ga0070661_100075869 3300005344 Bacteria 2478
12 Ga0070692_10120646 3300005345 Bacteria 1462
13 Ga0070668_100145237 3300005347 Bacteria 1914
14 Ga0070709_10153691 3300005434 Bacteria 1593
15 Ga0070709_10212596 3300005434 Bacteria 1375
16 Ga0070714_100471433 3300005435 Bacteria 1194
17 Ga0070714_100619997 3300005435 Bacteria 1040
18 Ga0070713_100105950 3300005436 Bacteria 2443
19 Ga0070713_100106207 3300005436 Bacteria 2441
20 Ga0070713_100467654 3300005436 Bacteria 1186
21 Ga0070713_100527277 3300005436 Bacteria 1117
22 Ga0070710_10017120 3300005437 Bacteria 3703
23 Ga0070711_100050191 3300005439 Bacteria 2860
24 Ga0070711_100235000 3300005439 Bacteria 1431
25 Ga0070700_100107762 3300005441 Bacteria 1847
26 Ga0070708_100369803 3300005445 Bacteria 1351
27 Ga0070678_100250568 3300005456 Bacteria 1485
28 Ga0070681_10240636 3300005458 Bacteria 1723
29 Ga0068867_100097853 3300005459 Bacteria 2236
30 Ga0070706_100028706 3300005467 Bacteria 5122
31 Ga0070706_100059188 3300005467 Bacteria 3535
32 Ga0070706_100216566 3300005467 Bacteria 1787
33 Ga0070707_100012032 3300005468 Bacteria 8077
34 Ga0070707_100097510 3300005468 Bacteria 2847
35 Ga0070698_100051392 3300005471 Bacteria 4198
36 Ga0070698_100052718 3300005471 Bacteria 4136
37 Ga0070698_100065384 3300005471 Bacteria 3662
38 Ga0070698_100110103 3300005471 Bacteria 2720
39 Ga0070699_100000662 3300005518 Bacteria 32198
40 Ga0070684_100002782 3300005535 Bacteria 12957
41 Ga0070697_100023817 3300005536 Bacteria 4873
42 Ga0068853_100454158 3300005539 Bacteria 1205
43 Ga0070686_100137912 3300005544 Bacteria 1694
44 Ga0070695_100091830 3300005545 Bacteria 2029
45 Ga0070696_100086990 3300005546 Bacteria 2220
46 Ga0070704_100284426 3300005549 Bacteria 1371
47 Ga0068855_100180025 3300005563 Bacteria 2390
48 Ga0070664_100096587 3300005564 Bacteria 2564
49 Ga0068857_100441401 3300005577 Bacteria 1216
50 Ga0070702_100021264 3300005615 Bacteria 3411
51 Ga0068852_100101656 3300005616 Bacteria 2596
52 Ga0068866_10108256 3300005718 Bacteria 1546
53 Ga0068861_100083091 3300005719 Bacteria 2511
54 Ga0068870_10091834 3300005840 Bacteria 1699
55 Ga0068862_100340682 3300005844 Bacteria 1389
56 Ga0081540_1000763 3300005983 Bacteria 29636
57 Ga0070717_10011381 3300006028 Bacteria 6753
58 Ga0070717_10217217 3300006028 Bacteria 1679
59 Ga0070717_10306329 3300006028 Bacteria 1413
60 Ga0070716_100082451 3300006173 Bacteria 1923
61 Ga0070712_100283828 3300006175 Bacteria 1334
62 Ga0075434_100017565 3300006871 Bacteria 6896
63 Ga0075434_100128133 3300006871 Bacteria 2555
64 Ga0068865_100147012 3300006881 Bacteria 1784
65 Ga0075436_100012945 3300006914 Bacteria 5718
66 Ga0075435_100031639 3300007076 Bacteria 4170
67 Ga0099795_10017021 3300007788 Bacteria 2311
68 Ga0111539_10038794 3300009094 Bacteria 5745
69 Ga0105245_10234117 3300009098 Bacteria 1778
70 Ga0105245_11217022 3300009098 Bacteria 801
71 Ga0114129_10063261 3300009147 Bacteria 5168
72 Ga0105237_10087332 3300009545 Bacteria 3108
73 Ga0105249_10122228 3300009553 Bacteria 2476
74 Ga0105239_10104438 3300010375 Bacteria 3137
75 Ga0105246_10067769 3300011119 Bacteria 2501
76 Ga0157342_1004351 3300012507 Bacteria 1255
77 Ga0157369_10179130 3300013105 Bacteria 2230
78 Ga0157374_10229208 3300013296 Bacteria 1824
79 Ga0163162_10091952 3300013306 Bacteria 3117
80 Ga0163161_10431679 3300017792 Bacteria 1062
81 Ga0206354_11403212 3300020081 Bacteria 1053
82 Ga0206353_10245720 3300020082 Bacteria 1782
83 Ga0213876_10024370 3300021384 Bacteria 3194
84 Ga0209759_1016423 3300025256 Bacteria 1871
85 Ga0207653_10044478 3300025885 Bacteria 1464
86 Ga0207688_10006230 3300025901 Bacteria 6488
87 Ga0207688_10008328 3300025901 Bacteria 5639
88 Ga0207645_10136805 3300025907 Bacteria 1595
89 Ga0207684_10119066 3300025910 Bacteria 2263
90 Ga0207684_10152193 3300025910 Bacteria 1990
91 Ga0207684_10247062 3300025910 Bacteria 1539
92 Ga0207684_10321650 3300025910 Bacteria 1333
93 Ga0207671_10070103 3300025914 Bacteria 2613
94 Ga0207693_10080756 3300025915 Bacteria 2545
95 Ga0207693_10106538 3300025915 Bacteria 2199
96 Ga0207663_10056563 3300025916 Bacteria 2467
97 Ga0207660_10292473 3300025917 Bacteria 1295
98 Ga0207662_10011709 3300025918 Bacteria 4872
99 Ga0207657_10134980 3300025919 Bacteria 2020
100 Ga0207649_10034541 3300025920 Bacteria 3031
101 Ga0207652_10161080 3300025921 Bacteria 2012
102 Ga0207646_10396015 3300025922 Bacteria 1247
103 Ga0207700_10038347 3300025928 Bacteria 3477
104 Ga0207664_10029127 3300025929 Bacteria 4203
105 Ga0207690_10165849 3300025932 Bacteria 1651
106 Ga0207669_10127676 3300025937 Bacteria 1741
107 Ga0207665_10002423 3300025939 Bacteria 12616
108 Ga0207689_10037943 3300025942 Bacteria 3993
109 Ga0207661_10306799 3300025944 Bacteria 1424
110 Ga0207661_10316981 3300025944 Bacteria 1401
111 Ga0207679_10392721 3300025945 Bacteria 1219
112 Ga0207712_10232146 3300025961 Bacteria 1482
113 Ga0207668_10497831 3300025972 Unclassified 1048
114 Ga0207640_10309532 3300025981 Bacteria 1253
115 Ga0207678_10017339 3300026067 Bacteria 6322
116 Ga0207708_10510193 3300026075 Bacteria 1009
117 Ga0207676_10121424 3300026095 Bacteria 2204
118 Ga0207674_10009774 3300026116 Bacteria 10927
119 Ga0207674_10607605 3300026116 Bacteria 1056
120 Ga0207675_100027030 3300026118 Bacteria 5342
121 Ga0207683_10016566 3300026121 Bacteria 6275
122 Ga0207683_10142830 3300026121 Bacteria 2157
123 Ga0268266_10177973 3300028379 Bacteria 1935
124 Ga0268266_10217575 3300028379 Bacteria 1754
125 Ga0268266_10253981 3300028379 Bacteria 1627
126 Ga0268265_10242039 3300028380 Bacteria 1593
127 Ga0265319_1095226 3300028563 Bacteria 938
128 Ga0265327_10080989 3300031251 Bacteria 1604
129 Ga0307508_10212446 3300031616 Bacteria 1535
130 Ga0307405_10016182 3300031731 Bacteria 4060
131 Ga0307406_10012562 3300031901 Bacteria 4827
132 Ga0307407_10007602 3300031903 Bacteria 4917
133 Ga0307409_100002636 3300031995 Bacteria 9439
134 Ga0307416_100003347 3300032002 Bacteria 9383
135 Ga0307411_10054510 3300032005 Bacteria 2626
136 Ga0307415_100002787 3300032126 Bacteria 8752
137 Ga0307415_100030381 3300032126 Bacteria 3467
138 Ga0373929_0012213 3300035085 Bacteria 1629
139 Ga0373934_0014930 3300035086 Bacteria 2944
140 Ga0373953_0035766 3300035117 Bacteria 1953
141 Ga0373953_0098698 3300035117 Bacteria 1227
142 Ga0373954_0017122 3300035118 Bacteria 3251
143 Ga0373954_0034226 3300035118 Bacteria 2352
144 Ga0373924_0000894 3300035410 Bacteria 9405
145 Ga0373937_0026242 3300036401 Bacteria 5264
146 Ga0395898_0141942 3300037466 Bacteria 2299
147 Ga0395905_0247555 3300037471 Bacteria 1665
148 Ga0436364_0126032 3300037853 Bacteria 2412
149 Ga0436364_0442195 3300037853 Bacteria 5447
150 Ga0436364_0842216 3300037853 Bacteria 4638
151 Ga0395901_0007456 3300038443 Bacteria 11043
152 Ga0436365_0053150 3300039437 Bacteria 4509
153 Ga0436365_1174999 3300039437 Bacteria 2821
154 Ga0439448_0104013 3300042005 Bacteria 967
155 Ga0466963_0073310 3300044694 Bacteria 2308
156 Ga0466960_0130268 3300044901 Bacteria 1327
157 Ga0466958_0009122 3300045836 Bacteria 5515
158 Ga0495651_0024940 3300046462 Bacteria 4652
159 Ga0495653_0055679 3300046463 Bacteria 3017
160 Ga0495582_0017407 3300046473 Bacteria 3932
161 Ga0495662_0003351 3300046476 Bacteria 8124
162 Ga0495664_0006884 3300046477 Bacteria 6293
163 Ga0495594_0151514 3300046499 Bacteria 1317
164 Ga0495608_0356392 3300046511 Unclassified 900
165 Ga0495618_0050008 3300046514 Bacteria 2640
166 Ga0495628_0126733 3300046516 Bacteria 1955
167 Ga0495628_0328351 3300046516 Bacteria 1128
168 Ga0495652_0028235 3300046529 Bacteria 4939
169 Ga0495586_0302217 3300046535 Bacteria 917
170 Ga0495587_0004397 3300046536 Bacteria 9291
171 Ga0495645_0152112 3300046543 Bacteria 1606
172 Ga0495645_0170917 3300046543 Bacteria 1496
173 Ga0495667_0095785 3300046559 Bacteria 1921
174 Ga0495635_0126160 3300046663 Bacteria 1745
175 Ga0495657_0075807 3300046675 Bacteria 2186
176 Ga0495623_0056888 3300046679 Bacteria 2461
177 Ga0495623_0093707 3300046679 Bacteria 1838
178 Ga0495646_0097978 3300046680 Bacteria 1684
179 Ga0495613_0012455 3300046689 Bacteria 6320
180 Ga0495581_0011497 3300047315 Bacteria 5123
181 Ga0495680_0050308 3300047322 Bacteria 3259
182 Ga0495680_0089368 3300047322 Bacteria 2312
183 Ga0495684_0030976 3300047471 Bacteria 4106
184 Ga0495684_0196789 3300047471 Bacteria 1487
185 Ga0495602_0024558 3300048088 Bacteria 5847
186 Ga0496100_0135232 3300048903 Bacteria 1741
187 Ga0496101_0011441 3300048904 Bacteria 5888
188 Ga0496103_0245501 3300048906 Bacteria 1152
189 Ga0496104_0049034 3300048907 Bacteria 3982
190 Ga0496105_0109089 3300048908 Bacteria 2285
191 Ga0496106_0428924 3300048909 Bacteria 1062
192 Ga0496111_0062628 3300048914 Bacteria 2697
193 Ga0496112_0285986 3300048915 Bacteria 1595
194 Ga0496112_0445311 3300048915 Bacteria 1233
195 Ga0496119_0027579 3300048922 Bacteria 3899
196 Ga0496126_0216473 3300048929 Bacteria 1611
197 Ga0501036_0022624 3300049572 Bacteria 5289
198 Ga0501035_0208176 3300049822 Bacteria 1674
199 nmdc:mga05p37_62728_c1 3300050507 Bacteria 4574
200 nmdc:mga0n895_266762_c1 3300050512 Bacteria 1737
201 nmdc:mga08x19_29815_c1 3300050514 Bacteria 3424
202 nmdc:mga0a205_21768_c1 3300050515 Bacteria 6062
203 Ga0495601_0038346 3300053077 Bacteria 2997
204 Ga0495601_0111772 3300053077 Bacteria 1770
205 Ga0495612_0033585 3300053078 Bacteria 2076
206 Ga0500635_0009535 3300053080 Bacteria 2696
207 Ga0495619_0008141 3300053085 Bacteria 6634
208 Ga0495619_0096226 3300053085 Bacteria 2010
209 2644533055 2643221696 Bacteria 5431823
210 2858875575 2858868258 Bacteria 7683772
211 2902582792 2902582711 Bacteria 6187705
212 Ga0070714_100044280
213 Ga0070683_100160865
214 Ga0070683_100424785
215 Ga0068869_100085716
216 Ga0070680_100132942
217 Ga0070682_100011809
218 Ga0068868_100190063
219 Ga0070660_100137431
220 Ga0070660_100182960
221 Ga0070661_100015122
222 Ga0070661_100075869
223 Ga0070692_10120646
224 Ga0070668_100145237
225 Ga0070709_10153691
226 Ga0070709_10212596
227 Ga0070714_100471433
228 Ga0070714_100619997
229 Ga0070713_100105950
230 Ga0070713_100106207
231 Ga0070713_100467654
232 Ga0070713_100527277
233 Ga0070710_10017120
234 Ga0070711_100050191
235 Ga0070711_100235000
236 Ga0070700_100107762
237 Ga0070708_100369803
238 Ga0070678_100250568
239 Ga0070681_10240636
240 Ga0068867_100097853
241 Ga0070706_100028706
242 Ga0070706_100059188
243 Ga0070706_100216566
244 Ga0070707_100012032
245 Ga0070707_100097510
246 Ga0070698_100051392
247 Ga0070698_100052718
248 Ga0070698_100065384
249 Ga0070698_100110103
250 Ga0070699_100000662
251 Ga0070684_100002782
252 Ga0070697_100023817
253 Ga0068853_100454158
254 Ga0070686_100137912
255 Ga0070695_100091830
256 Ga0070696_100086990
257 Ga0070704_100284426
258 Ga0068855_100180025
259 Ga0070664_100096587
260 Ga0068857_100441401
261 Ga0070702_100021264
262 Ga0068852_100101656
263 Ga0068866_10108256
264 Ga0068861_100083091
265 Ga0068870_10091834
266 Ga0068862_100340682
267 Ga0081540_1000763
268 Ga0070717_10011381
269 Ga0070717_10217217
270 Ga0070717_10306329
271 Ga0070716_100082451
272 Ga0070712_100283828
273 Ga0075434_100017565
274 Ga0075434_100128133
275 Ga0068865_100147012
276 Ga0075436_100012945
277 Ga0075435_100031639
278 Ga0099795_10017021
279 Ga0111539_10038794
280 Ga0105245_10234117
281 Ga0105245_11217022
282 Ga0114129_10063261
283 Ga0105237_10087332
284 Ga0105249_10122228
285 Ga0105239_10104438
286 Ga0105246_10067769
287 Ga0157342_1004351
288 Ga0157369_10179130
289 Ga0157374_10229208
290 Ga0163162_10091952
291 Ga0163161_10431679
292 Ga0206354_11403212
293 Ga0206353_10245720
294 Ga0213876_10024370
295 Ga0209759_1016423
296 Ga0207653_10044478
297 Ga0207688_10006230
298 Ga0207688_10008328
299 Ga0207645_10136805
300 Ga0207684_10119066
301 Ga0207684_10152193
302 Ga0207684_10247062
303 Ga0207684_10321650
304 Ga0207671_10070103
305 Ga0207693_10080756
306 Ga0207693_10106538
307 Ga0207663_10056563
308 Ga0207660_10292473
309 Ga0207662_10011709
310 Ga0207657_10134980
311 Ga0207649_10034541
312 Ga0207652_10161080
313 Ga0207646_10396015
314 Ga0207700_10038347
315 Ga0207664_10029127
316 Ga0207690_10165849
317 Ga0207669_10127676
318 Ga0207665_10002423
319 Ga0207689_10037943
320 Ga0207661_10306799
321 Ga0207661_10316981
322 Ga0207679_10392721
323 Ga0207712_10232146
324 Ga0207668_10497831
325 Ga0207640_10309532
326 Ga0207678_10017339
327 Ga0207708_10510193
328 Ga0207676_10121424
329 Ga0207674_10009774
330 Ga0207674_10607605
331 Ga0207675_100027030
332 Ga0207683_10016566
333 Ga0207683_10142830
334 Ga0268266_10177973
335 Ga0268266_10217575
336 Ga0268266_10253981
337 Ga0268265_10242039
338 Ga0265319_1095226
339 Ga0265327_10080989
340 Ga0307508_10212446
341 Ga0307405_10016182
342 Ga0307406_10012562
343 Ga0307407_10007602
344 Ga0307409_100002636
345 Ga0307416_100003347
346 Ga0307411_10054510
347 Ga0307415_100002787
348 Ga0307415_100030381
349 Ga0373929_0012213
350 Ga0373934_0014930
351 Ga0373953_0035766
352 Ga0373953_0098698
353 Ga0373954_0017122
354 Ga0373954_0034226
355 Ga0373924_0000894
356 Ga0373937_0026242
357 Ga0395898_0141942
358 Ga0395905_0247555
359 Ga0436364_0126032
360 Ga0436364_0442195
361 Ga0436364_0842216
362 Ga0395901_0007456
363 Ga0436365_0053150
364 Ga0436365_1174999
365 Ga0439448_0104013
366 Ga0466963_0073310
367 Ga0466960_0130268
368 Ga0466958_0009122
369 Ga0495651_0024940
370 Ga0495653_0055679
371 Ga0495582_0017407
372 Ga0495662_0003351
373 Ga0495664_0006884
374 Ga0495594_0151514
375 Ga0495608_0356392
376 Ga0495618_0050008
377 Ga0495628_0126733
378 Ga0495628_0328351
379 Ga0495652_0028235
380 Ga0495586_0302217
381 Ga0495587_0004397
382 Ga0495645_0152112
383 Ga0495645_0170917
384 Ga0495667_0095785
385 Ga0495635_0126160
386 Ga0495657_0075807
387 Ga0495623_0056888
388 Ga0495623_0093707
389 Ga0495646_0097978
390 Ga0495613_0012455
391 Ga0495581_0011497
392 Ga0495680_0050308
393 Ga0495680_0089368
394 Ga0495684_0030976
395 Ga0495684_0196789
396 Ga0495602_0024558
397 Ga0496100_0135232
398 Ga0496101_0011441
399 Ga0496103_0245501
400 Ga0496104_0049034
401 Ga0496105_0109089
402 Ga0496106_0428924
403 Ga0496111_0062628
404 Ga0496112_0285986
405 Ga0496112_0445311
406 Ga0496119_0027579
407 Ga0496126_0216473
408 Ga0501036_0022624
409 Ga0501035_0208176
410 nmdc:mga05p37_62728_c1
411 nmdc:mga0n895_266762_c1
412 nmdc:mga08x19_29815_c1
413 nmdc:mga0a205_21768_c1
414 Ga0495601_0038346
415 Ga0495601_0111772
416 Ga0495612_0033585
417 Ga0500635_0009535
418 Ga0495619_0008141
419 Ga0495619_0096226
420 2644533055
421 2858875575
422 2902582792

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

31

233

0.96

PF08659

KR

KR domain

31

127

0.9

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

36

267

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9219 10 245
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9202 11 246
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9159 7 253
4cqm-assembly2.cif.gz_B crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9143 11 246
2fwm-assembly1.cif.gz_X crystal structure of e. coli enta, a 2,3-dihydrodihydroxy benzoate dehydrogenase 0.9143 7 246
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9388 8 195 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9274 58 192 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.922 5 90 3.40.50.720
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9219 10 245 3.40.50.720
3p19C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9217 11 246 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A177PUX9-F1-model_v4 deleted 0.9903 63 250
AF-A0A7K0JYD3-F1-model_v4 deleted 0.9865 99 252
AF-A0A142GWS3-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9754 93 248 GO:0006633
GO:0016616
GO:0048038
AF-A0A0D8HD43-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase FabG (EC 1.1.1.100) 0.9749 6 252 GO:0004316
AF-A0A6N9T8P0-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9724 10 248 GO:0006633
GO:0016616
GO:0048038

Map