F321268

General Info

Members Datasets Scaffolds Average Seq Length
211 150 422 201

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100016305|Ga0070671_1000163058
Length 237
Sequence MSGCTAYAGTVLEAAPRQVNCGKSIDRPLNGRRRTLYNRPMSDAAFDALLAEIRVCTRCAAALPLGPRPVLRGRPSARLLIVSQAPGTRVHETGLSFNDRSGDRLRDWLGIGRDEFYDESRVALMPIGFCYPGRHPRGGDLPPRPECAPLWHPRLRPLFPLVALTLLVGSYAVRHYLPRSRCEPLGATVAGWRDFLPEFLVLPHPSWRTTAWERQNPWFGTELLPELRARVAALLES

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
74 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
75 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
79 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
80 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
81 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
90 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
91 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
92 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
95 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
96 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
97 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
98 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
99 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
102 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
103 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
104 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
111 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
112 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
113 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
114 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
115 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
116 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
117 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
118 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
143 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
146 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
147 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
148 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
149 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
150 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 0
Isolates 2.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.32
Nodule 0.47
Rhizoplane 2.84
Rhizosphere 77.73
Stem 0
Stem Tuber 0
Unclassified 3.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100016305 3300005355 Bacteria 6009
2 SwRhRL2b_contig_2866031 2162886007 Bacteria 47061
3 Ga0055530_10011979 3300003791 Bacteria 3060
4 Ga0065704_10000192 3300005289 Bacteria 216848
5 Ga0065707_10124248 3300005295 Bacteria 2048
6 Ga0070690_100416308 3300005330 Bacteria 990
7 Ga0070670_101122269 3300005331 Bacteria 717
8 Ga0070666_10017411 3300005335 Bacteria 4607
9 Ga0068868_100563546 3300005338 Unclassified 1005
10 Ga0070669_100002117 3300005353 Bacteria 14350
11 Ga0070671_100035669 3300005355 Bacteria 4120
12 Ga0070667_100001100 3300005367 Bacteria 24778
13 Ga0070667_100072494 3300005367 Bacteria 2935
14 Ga0070714_100086268 3300005435 Bacteria 2743
15 Ga0070714_100126938 3300005435 Bacteria 2276
16 Ga0070713_100022152 3300005436 Bacteria 4905
17 Ga0070713_100122124 3300005436 Bacteria 2286
18 Ga0070713_100293322 3300005436 Bacteria 1495
19 Ga0070708_101011184 3300005445 Bacteria 779
20 Ga0070681_10063067 3300005458 Bacteria 3679
21 Ga0070681_10165683 3300005458 Bacteria 2133
22 Ga0070681_10532841 3300005458 Bacteria 1088
23 Ga0070706_100007697 3300005467 Bacteria 10071
24 Ga0070698_100135037 3300005471 Bacteria 2421
25 Ga0070699_100394322 3300005518 Bacteria 1251
26 Ga0070679_100246057 3300005530 Unclassified 1745
27 Ga0070684_100587872 3300005535 Bacteria 1035
28 Ga0070697_100088569 3300005536 Bacteria 2556
29 Ga0070686_100539671 3300005544 Bacteria 911
30 Ga0070665_100000152 3300005548 Bacteria 126430
31 Ga0070665_100283097 3300005548 Bacteria 1660
32 Ga0068854_100660893 3300005578 Bacteria 898
33 Ga0068856_100054742 3300005614 Bacteria 3936
34 Ga0068856_100287354 3300005614 Bacteria 1661
35 Ga0068859_100625644 3300005617 Bacteria 1169
36 Ga0068864_100401328 3300005618 Bacteria 1303
37 Ga0068863_100011104 3300005841 Bacteria 8735
38 Ga0068863_100052085 3300005841 Bacteria 3880
39 Ga0068860_100069827 3300005843 Bacteria 3339
40 Ga0068860_100103373 3300005843 Bacteria 2719
41 Ga0068860_100398904 3300005843 Bacteria 1360
42 Ga0068862_100229804 3300005844 Bacteria 1682
43 Ga0070717_10047381 3300006028 Bacteria 3521
44 Ga0070717_10077719 3300006028 Bacteria 2780
45 Ga0070717_10212165 3300006028 Bacteria 1699
46 Ga0070712_100386703 3300006175 Unclassified 1153
47 Ga0075369_10068281 3300006186 Bacteria 1562
48 Ga0075436_100078613 3300006914 Bacteria 2285
49 Ga0097620_100625696 3300006931 Bacteria 1169
50 Ga0105251_10006099 3300009011 Bacteria 7763
51 Ga0105240_11159875 3300009093 Bacteria 820
52 Ga0105245_10313530 3300009098 Bacteria 1543
53 Ga0105247_10057720 3300009101 Bacteria 2400
54 Ga0105247_10375106 3300009101 Bacteria 1007
55 Ga0105248_10022579 3300009177 Bacteria 6982
56 Ga0157370_10269432 3300013104 Bacteria 1573
57 Ga0163163_10036457 3300014325 Bacteria 4777
58 Ga0157379_10678355 3300014968 Bacteria 966
59 Ga0157379_10935954 3300014968 Bacteria 823
60 Ga0157376_10600165 3300014969 Bacteria 1096
61 Ga0157376_10740718 3300014969 Bacteria 991
62 Ga0213875_10001480 3300021388 Bacteria 15129
63 Ga0209050_1000127 3300025298 Bacteria 187951
64 Ga0207713_1000489 3300025735 Bacteria 40893
65 Ga0207692_10101289 3300025898 Bacteria 1582
66 Ga0207692_10598348 3300025898 Bacteria 709
67 Ga0207710_10098362 3300025900 Unclassified 1377
68 Ga0207680_10075889 3300025903 Unclassified 2097
69 Ga0207684_10567604 3300025910 Bacteria 970
70 Ga0207707_10219869 3300025912 Bacteria 1653
71 Ga0207693_10136371 3300025915 Bacteria 1929
72 Ga0207652_10239953 3300025921 Unclassified 1634
73 Ga0207646_10022389 3300025922 Bacteria 5823
74 Ga0207681_10000612 3300025923 Bacteria 23992
75 Ga0207700_10060991 3300025928 Bacteria 2859
76 Ga0207700_10118037 3300025928 Bacteria 2146
77 Ga0207664_10219101 3300025929 Bacteria 1649
78 Ga0207644_10023123 3300025931 Bacteria 4253
79 Ga0207665_10273209 3300025939 Bacteria 1256
80 Ga0207711_10002673 3300025941 Bacteria 15761
81 Ga0207679_10153236 3300025945 Bacteria 1879
82 Ga0207640_10264695 3300025981 Bacteria 1342
83 Ga0207658_10000571 3300025986 Bacteria 33340
84 Ga0207658_10036519 3300025986 Bacteria 3523
85 Ga0207703_10414615 3300026035 Bacteria 1252
86 Ga0207702_10522856 3300026078 Bacteria 1158
87 Ga0207702_10628330 3300026078 Bacteria 1055
88 Ga0207641_10025881 3300026088 Bacteria 4839
89 Ga0207641_10039040 3300026088 Bacteria 3970
90 Ga0268266_10000125 3300028379 Bacteria 151647
91 Ga0268266_10214664 3300028379 Bacteria 1766
92 Ga0268265_10005708 3300028380 Bacteria 8500
93 Ga0268265_10062309 3300028380 Bacteria 2865
94 Ga0268264_10083859 3300028381 Bacteria 2731
95 Ga0268264_10388080 3300028381 Bacteria 1339
96 Ga0268264_10641240 3300028381 Bacteria 1050
97 Ga0265338_10141819 3300028800 Bacteria 1881
98 Ga0265327_10037536 3300031251 Bacteria 2651
99 Ga0373945_0073243 3300035116 Bacteria 1300
100 Ga0373960_0018983 3300035121 Bacteria 1801
101 Ga0373931_0091299 3300035691 Bacteria 1697
102 Ga0373947_0297473 3300035725 Bacteria 1075
103 Ga0436364_0408328 3300037853 Bacteria 1576
104 Ga0436364_1149423 3300037853 Bacteria 148108
105 Ga0436361_0593310 3300039447 Bacteria 1337
106 Ga0436363_0043311 3300039450 Bacteria 1510
107 Ga0436362_0312507 3300039453 Bacteria 1820
108 Ga0451837_0284190 3300041494 Bacteria 2013
109 Ga0451853_1798900 3300041512 Bacteria 1738
110 Ga0451577_0460016 3300042876 Bacteria 1155
111 Ga0451577_1078989 3300042876 Bacteria 719
112 Ga0453683_0049874 3300044673 Bacteria 2623
113 Ga0466961_0051774 3300044693 Bacteria 2622
114 Ga0451576_0000056 3300045051 Bacteria 303398
115 Ga0451576_0002761 3300045051 Bacteria 25387
116 Ga0451576_0041179 3300045051 Bacteria 4885
117 Ga0451576_0787575 3300045051 Bacteria 998
118 Ga0495627_001122 3300046453 Bacteria 17400
119 Ga0495650_0007856 3300046471 Bacteria 6335
120 Ga0495605_0069177 3300046474 Bacteria 1672
121 Ga0495596_0000196 3300046500 Bacteria 41923
122 Ga0495607_0009560 3300046501 Bacteria 6552
123 Ga0495583_0126249 3300046506 Bacteria 1073
124 Ga0495606_0007235 3300046507 Bacteria 10003
125 Ga0495606_0030956 3300046507 Bacteria 3728
126 Ga0495610_0000031 3300046512 Bacteria 254606
127 Ga0495610_0000258 3300046512 Bacteria 55824
128 Ga0495610_0001138 3300046512 Bacteria 24178
129 Ga0495620_0003344 3300046515 Bacteria 9196
130 Ga0495632_0002600 3300046519 Bacteria 13614
131 Ga0495632_0026802 3300046519 Bacteria 3028
132 Ga0495643_0000048 3300046522 Bacteria 212788
133 Ga0495643_0009242 3300046522 Bacteria 6143
134 Ga0495643_0015397 3300046522 Bacteria 4520
135 Ga0495654_0006671 3300046530 Bacteria 6534
136 Ga0495609_0043624 3300046538 Bacteria 2013
137 Ga0495625_0112113 3300046660 Bacteria 1863
138 Ga0495681_0000472 3300047470 Bacteria 30863
139 Ga0495615_0000089 3300048090 Bacteria 27064
140 Ga0495626_0001213 3300048091 Bacteria 21258
141 Ga0496103_0007352 3300048906 Bacteria 6567
142 Ga0496104_0808582 3300048907 Bacteria 843
143 Ga0496106_0673053 3300048909 Bacteria 826
144 Ga0496111_0221794 3300048914 Bacteria 1405
145 Ga0496112_0042977 3300048915 Bacteria 4423
146 Ga0496115_0082721 3300048918 Bacteria 2616
147 Ga0496116_0000035 3300048919 Bacteria 402424
148 Ga0496116_0098601 3300048919 Bacteria 1753
149 Ga0496117_0082673 3300048920 Bacteria 2102
150 Ga0496118_0049974 3300048921 Unclassified 3214
151 Ga0496118_0105128 3300048921 Bacteria 1893
152 Ga0496118_0113670 3300048921 Bacteria 1788
153 Ga0496121_0000579 3300048924 Bacteria 68757
154 Ga0496121_0035972 3300048924 Bacteria 4423
155 Ga0496122_0003554 3300048925 Bacteria 20385
156 Ga0496123_0000159 3300048926 Bacteria 136014
157 Ga0496123_0002947 3300048926 Bacteria 19879
158 Ga0496123_0433757 3300048926 Unclassified 589
159 Ga0496124_0002527 3300048927 Bacteria 23742
160 Ga0496124_0005911 3300048927 Bacteria 13541
161 Ga0496124_0047438 3300048927 Bacteria 3675
162 Ga0496124_0144255 3300048927 Bacteria 1875
163 Ga0496124_0331776 3300048927 Bacteria 1084
164 Ga0496124_0388122 3300048927 Bacteria 974
165 Ga0496124_0446998 3300048927 Bacteria 882
166 Ga0496125_0017339 3300048928 Bacteria 6873
167 Ga0496125_0069894 3300048928 Bacteria 2751
168 Ga0496125_0155676 3300048928 Bacteria 1562
169 Ga0496125_0176180 3300048928 Bacteria 1430
170 Ga0496126_0000077 3300048929 Bacteria 231592
171 Ga0496126_0215935 3300048929 Bacteria 1613
172 Ga0501031_0010761 3300049568 Bacteria 5958
173 Ga0501032_0006529 3300049569 Bacteria 8565
174 Ga0501034_0058530 3300049571 Bacteria 3873
175 Ga0501034_0353173 3300049571 Bacteria 1398
176 Ga0501034_0457033 3300049571 Bacteria 1194
177 Ga0501037_0010976 3300049573 Bacteria 6660
178 Ga0501042_0039864 3300049578 Bacteria 3339
179 Ga0501043_0051341 3300049579 Bacteria 3239
180 Ga0501043_0124341 3300049579 Bacteria 2023
181 Ga0501043_0256740 3300049579 Bacteria 1345
182 Ga0501046_0010026 3300049580 Bacteria 8159
183 Ga0501046_0085807 3300049580 Bacteria 2427
184 Ga0501047_0108599 3300049581 Bacteria 2657
185 Ga0501048_0020066 3300049582 Bacteria 4902
186 Ga0501069_0001299 3300049585 Bacteria 12257
187 Ga0501070_0025854 3300049586 Bacteria 4925
188 Ga0501071_0002170 3300049587 Bacteria 11793
189 Ga0501072_0025103 3300049588 Bacteria 4640
190 Ga0501073_0127397 3300049589 Bacteria 1764
191 Ga0501073_0676799 3300049589 Bacteria 712
192 Ga0501079_0629567 3300049741 Bacteria 844
193 Ga0501080_0012086 3300049742 Bacteria 7908
194 Ga0501080_0227696 3300049742 Bacteria 1704
195 Ga0501081_0149477 3300049743 Bacteria 1677
196 Ga0501035_0028218 3300049822 Bacteria 5122
197 Ga0501035_0079271 3300049822 Bacteria 2901
198 Ga0501044_0009720 3300049823 Bacteria 10463
199 Ga0501045_0004317 3300049824 Bacteria 9805
200 nmdc:mga03683_87609_c1 3300050489 Bacteria 1353
201 nmdc:mga00v17_276_c1 3300050491 Bacteria 30288
202 nmdc:mga08x19_83202_c1 3300050514 Bacteria 2104
203 nmdc:mga0sz30_9118_c2 3300050516 Bacteria 1963
204 Ga0500555_004924 3300053103 Bacteria 3788
205 Ga0501082_0006195 3300060353 Bacteria 10380
206 2511129598 2510917021 Bacteria 5705459
207 2512034641 2511231221 Bacteria 6846400
208 2819552197 2818991438 Bacteria 5793701
209 2842335570 2842333319 Bacteria 8899485
210 8054003874 8054002106 Bacteria 7987183
211 8054303542 8054302542 Bacteria 5698134
212 Ga0070671_100016305
213 SwRhRL2b_contig_2866031
214 Ga0055530_10011979
215 Ga0065704_10000192
216 Ga0065707_10124248
217 Ga0070690_100416308
218 Ga0070670_101122269
219 Ga0070666_10017411
220 Ga0068868_100563546
221 Ga0070669_100002117
222 Ga0070671_100035669
223 Ga0070667_100001100
224 Ga0070667_100072494
225 Ga0070714_100086268
226 Ga0070714_100126938
227 Ga0070713_100022152
228 Ga0070713_100122124
229 Ga0070713_100293322
230 Ga0070708_101011184
231 Ga0070681_10063067
232 Ga0070681_10165683
233 Ga0070681_10532841
234 Ga0070706_100007697
235 Ga0070698_100135037
236 Ga0070699_100394322
237 Ga0070679_100246057
238 Ga0070684_100587872
239 Ga0070697_100088569
240 Ga0070686_100539671
241 Ga0070665_100000152
242 Ga0070665_100283097
243 Ga0068854_100660893
244 Ga0068856_100054742
245 Ga0068856_100287354
246 Ga0068859_100625644
247 Ga0068864_100401328
248 Ga0068863_100011104
249 Ga0068863_100052085
250 Ga0068860_100069827
251 Ga0068860_100103373
252 Ga0068860_100398904
253 Ga0068862_100229804
254 Ga0070717_10047381
255 Ga0070717_10077719
256 Ga0070717_10212165
257 Ga0070712_100386703
258 Ga0075369_10068281
259 Ga0075436_100078613
260 Ga0097620_100625696
261 Ga0105251_10006099
262 Ga0105240_11159875
263 Ga0105245_10313530
264 Ga0105247_10057720
265 Ga0105247_10375106
266 Ga0105248_10022579
267 Ga0157370_10269432
268 Ga0163163_10036457
269 Ga0157379_10678355
270 Ga0157379_10935954
271 Ga0157376_10600165
272 Ga0157376_10740718
273 Ga0213875_10001480
274 Ga0209050_1000127
275 Ga0207713_1000489
276 Ga0207692_10101289
277 Ga0207692_10598348
278 Ga0207710_10098362
279 Ga0207680_10075889
280 Ga0207684_10567604
281 Ga0207707_10219869
282 Ga0207693_10136371
283 Ga0207652_10239953
284 Ga0207646_10022389
285 Ga0207681_10000612
286 Ga0207700_10060991
287 Ga0207700_10118037
288 Ga0207664_10219101
289 Ga0207644_10023123
290 Ga0207665_10273209
291 Ga0207711_10002673
292 Ga0207679_10153236
293 Ga0207640_10264695
294 Ga0207658_10000571
295 Ga0207658_10036519
296 Ga0207703_10414615
297 Ga0207702_10522856
298 Ga0207702_10628330
299 Ga0207641_10025881
300 Ga0207641_10039040
301 Ga0268266_10000125
302 Ga0268266_10214664
303 Ga0268265_10005708
304 Ga0268265_10062309
305 Ga0268264_10083859
306 Ga0268264_10388080
307 Ga0268264_10641240
308 Ga0265338_10141819
309 Ga0265327_10037536
310 Ga0373945_0073243
311 Ga0373960_0018983
312 Ga0373931_0091299
313 Ga0373947_0297473
314 Ga0436364_0408328
315 Ga0436364_1149423
316 Ga0436361_0593310
317 Ga0436363_0043311
318 Ga0436362_0312507
319 Ga0451837_0284190
320 Ga0451853_1798900
321 Ga0451577_0460016
322 Ga0451577_1078989
323 Ga0453683_0049874
324 Ga0466961_0051774
325 Ga0451576_0000056
326 Ga0451576_0002761
327 Ga0451576_0041179
328 Ga0451576_0787575
329 Ga0495627_001122
330 Ga0495650_0007856
331 Ga0495605_0069177
332 Ga0495596_0000196
333 Ga0495607_0009560
334 Ga0495583_0126249
335 Ga0495606_0007235
336 Ga0495606_0030956
337 Ga0495610_0000031
338 Ga0495610_0000258
339 Ga0495610_0001138
340 Ga0495620_0003344
341 Ga0495632_0002600
342 Ga0495632_0026802
343 Ga0495643_0000048
344 Ga0495643_0009242
345 Ga0495643_0015397
346 Ga0495654_0006671
347 Ga0495609_0043624
348 Ga0495625_0112113
349 Ga0495681_0000472
350 Ga0495615_0000089
351 Ga0495626_0001213
352 Ga0496103_0007352
353 Ga0496104_0808582
354 Ga0496106_0673053
355 Ga0496111_0221794
356 Ga0496112_0042977
357 Ga0496115_0082721
358 Ga0496116_0000035
359 Ga0496116_0098601
360 Ga0496117_0082673
361 Ga0496118_0049974
362 Ga0496118_0105128
363 Ga0496118_0113670
364 Ga0496121_0000579
365 Ga0496121_0035972
366 Ga0496122_0003554
367 Ga0496123_0000159
368 Ga0496123_0002947
369 Ga0496123_0433757
370 Ga0496124_0002527
371 Ga0496124_0005911
372 Ga0496124_0047438
373 Ga0496124_0144255
374 Ga0496124_0331776
375 Ga0496124_0388122
376 Ga0496124_0446998
377 Ga0496125_0017339
378 Ga0496125_0069894
379 Ga0496125_0155676
380 Ga0496125_0176180
381 Ga0496126_0000077
382 Ga0496126_0215935
383 Ga0501031_0010761
384 Ga0501032_0006529
385 Ga0501034_0058530
386 Ga0501034_0353173
387 Ga0501034_0457033
388 Ga0501037_0010976
389 Ga0501042_0039864
390 Ga0501043_0051341
391 Ga0501043_0124341
392 Ga0501043_0256740
393 Ga0501046_0010026
394 Ga0501046_0085807
395 Ga0501047_0108599
396 Ga0501048_0020066
397 Ga0501069_0001299
398 Ga0501070_0025854
399 Ga0501071_0002170
400 Ga0501072_0025103
401 Ga0501073_0127397
402 Ga0501073_0676799
403 Ga0501079_0629567
404 Ga0501080_0012086
405 Ga0501080_0227696
406 Ga0501081_0149477
407 Ga0501035_0028218
408 Ga0501035_0079271
409 Ga0501044_0009720
410 Ga0501045_0004317
411 nmdc:mga03683_87609_c1
412 nmdc:mga00v17_276_c1
413 nmdc:mga08x19_83202_c1
414 nmdc:mga0sz30_9118_c2
415 Ga0500555_004924
416 Ga0501082_0006195
417 2511129598
418 2512034641
419 2819552197
420 2842335570
421 8054003874
422 8054303542

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

71

228

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ikb-assembly2.cif.gz_B the structure of a conserved protein from streptococcus mutans ua159. 0.9058 9 200
3ikb-assembly2.cif.gz_B the structure of a conserved protein from streptococcus mutans ua159. 0.884 9 200
1ui1-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 0.7255 9 195
1ui1-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 0.703 9 195
8iin-assembly1.cif.gz_A complex form of msmudgx h109k mutant and uracil- obtained from uracil dna (ttutt) post its cleavage by msmudgx h109k 0.6964 8 195
ID Description Score Start End Superfamily
3ikbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9025 9 200 3.40.470.10
3ikbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8847 9 200 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7269 9 195 3.40.470.10
af_O59825_127_324_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.6931 32 144 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.6912 9 196 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A561HQU9-F1-model_v4 deleted 0.9961 9 197
AF-A0A7W0X675-F1-model_v4 Uracil-DNA glycosylase family protein 0.9888 9 155
AF-A0A1B1NSQ3-F1-model_v4 deleted 0.9886 9 116
AF-A0A7C3TKT2-F1-model_v4 Uracil-DNA glycosylase family protein 0.9878 10 131
AF-F9RMP3-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9862 9 120

Map