F320888

General Info

Members Datasets Scaffolds Average Seq Length
210 137 420 217

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0107324|Ga0501047_0107324_1684_2406
Length 240
Sequence LARHDERAPSTGVHIGMTTYIALLGHPVGHSLSPRMQNAAFDARGLDWRYSAFDVEDPLAAVAALRTLGFAGANVTIPHKEAVVAACDEAEGDAVNTLLFDADGRVRGFNTDKEILAGVRATRACVIGAGGAARALVPALPEQTTFYSRRRAWPPDATGCDLIVNATPVRDELLVEPRAGQTVVELAYGDGDTALAAAARAAGCEVIDGLEALVRQGAASFRLWTGLEPPVDVMRRAVRG

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
54 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
55 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
60 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
67 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
78 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
79 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
80 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
81 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
86 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
111 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.52
Rhizosphere 89.05
Stem 0
Stem Tuber 0
Unclassified 10.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0107324 3300049581 Bacteria 2674
2 Ga0070683_100154372 3300005329 Bacteria 2177
3 Ga0070680_100008895 3300005336 Bacteria 7697
4 Ga0070682_100345204 3300005337 Bacteria 1108
5 Ga0070660_100005657 3300005339 Bacteria 8662
6 Ga0070660_100006666 3300005339 Bacteria 8014
7 Ga0070660_100160747 3300005339 Bacteria 1810
8 Ga0070660_100361384 3300005339 Bacteria 1197
9 Ga0070661_100034943 3300005344 Bacteria 3648
10 Ga0070661_100159716 3300005344 Bacteria 1707
11 Ga0070659_100136722 3300005366 Unclassified 1993
12 Ga0070714_100095193 3300005435 Bacteria 2615
13 Ga0070708_100351931 3300005445 Bacteria 1388
14 Ga0070681_10001216 3300005458 Bacteria 22405
15 Ga0070681_10002459 3300005458 Bacteria 16970
16 Ga0070681_10054735 3300005458 Bacteria 3976
17 Ga0070681_10116770 3300005458 Bacteria 2605
18 Ga0070698_100667875 3300005471 Bacteria 981
19 Ga0070679_100004090 3300005530 Bacteria 13450
20 Ga0070679_100028350 3300005530 Bacteria 5520
21 Ga0070679_100093518 3300005530 Bacteria 2994
22 Ga0070684_100192869 3300005535 Unclassified 1854
23 Ga0068853_100261912 3300005539 Bacteria 1590
24 Ga0070686_100307880 3300005544 Unclassified 1177
25 Ga0070665_100607275 3300005548 Unclassified 1107
26 Ga0070665_100663464 3300005548 Bacteria 1056
27 Ga0068855_100144889 3300005563 Bacteria 2705
28 Ga0068855_100174549 3300005563 Bacteria 2433
29 Ga0068857_100079307 3300005577 Bacteria 2931
30 Ga0068854_100410049 3300005578 Bacteria 1123
31 Ga0070702_100227006 3300005615 Unclassified 1252
32 Ga0068852_100267221 3300005616 Bacteria 1645
33 Ga0070717_10027548 3300006028 Unclassified 4543
34 Ga0070712_100176844 3300006175 Bacteria 1660
35 Ga0075433_10138757 3300006852 Bacteria 2161
36 Ga0075436_100254198 3300006914 Bacteria 1252
37 Ga0105240_10667021 3300009093 Bacteria 1138
38 Ga0105245_10157821 3300009098 Bacteria 2150
39 Ga0105242_10071510 3300009176 Bacteria 2879
40 Ga0105239_11544581 3300010375 Bacteria 767
41 Ga0157370_10005484 3300013104 Bacteria 14227
42 Ga0157370_10048324 3300013104 Bacteria 4076
43 Ga0157370_10052574 3300013104 Bacteria 3889
44 Ga0157369_10002867 3300013105 Bacteria 20583
45 Ga0157369_10265158 3300013105 Bacteria 1791
46 Ga0157374_10149381 3300013296 Bacteria 2271
47 Ga0157372_10102988 3300013307 Bacteria 3261
48 Ga0163163_10648442 3300014325 Bacteria 1119
49 Ga0182008_10167985 3300014497 Bacteria 1106
50 Ga0206356_10925515 3300020070 Bacteria 1248
51 Ga0213873_10034008 3300021358 Bacteria 1282
52 Ga0207699_10714287 3300025906 Bacteria 734
53 Ga0207707_10048520 3300025912 Bacteria 3698
54 Ga0207707_10058752 3300025912 Bacteria 3346
55 Ga0207707_10076563 3300025912 Unclassified 2920
56 Ga0207660_10144031 3300025917 Bacteria 1824
57 Ga0207660_10409584 3300025917 Unclassified 1092
58 Ga0207657_10001526 3300025919 Bacteria 24794
59 Ga0207657_10005853 3300025919 Bacteria 12806
60 Ga0207657_10130432 3300025919 Bacteria 2060
61 Ga0207657_10180388 3300025919 Bacteria 1707
62 Ga0207649_10023982 3300025920 Bacteria 3540
63 Ga0207649_10261474 3300025920 Bacteria 1251
64 Ga0207652_10024937 3300025921 Bacteria 4966
65 Ga0207652_10029540 3300025921 Bacteria 4585
66 Ga0207652_10119391 3300025921 Bacteria 2345
67 Ga0207652_10315647 3300025921 Bacteria 1411
68 Ga0207687_10174490 3300025927 Bacteria 1660
69 Ga0207700_10096278 3300025928 Archaea 2350
70 Ga0207664_10046166 3300025929 Bacteria 3419
71 Ga0207644_10356820 3300025931 Unclassified 1188
72 Ga0207690_10082422 3300025932 Unclassified 2250
73 Ga0207661_10039972 3300025944 Bacteria 3685
74 Ga0207661_10469440 3300025944 Bacteria 1148
75 Ga0207667_10054629 3300025949 Bacteria 4200
76 Ga0207678_10117134 3300026067 Bacteria 2273
77 Ga0207678_10280501 3300026067 Bacteria 1430
78 Ga0207674_10020175 3300026116 Bacteria 7207
79 Ga0265334_10027853 3300028573 Bacteria 2274
80 Ga0265318_10042515 3300028577 Bacteria 1724
81 Ga0265322_10032417 3300028654 Bacteria 1490
82 Ga0265338_10051410 3300028800 Bacteria 3710
83 Ga0265338_10060618 3300028800 Bacteria 3323
84 Ga0265328_10091511 3300031239 Unclassified 1124
85 Ga0265325_10112342 3300031241 Bacteria 1322
86 Ga0265329_10021657 3300031242 Bacteria 2157
87 Ga0265340_10017430 3300031247 Bacteria 3717
88 Ga0265339_10044893 3300031249 Bacteria 2435
89 Ga0265327_10112298 3300031251 Unclassified 1300
90 Ga0265316_10072037 3300031344 Bacteria 2662
91 Ga0265313_10011477 3300031595 Bacteria 5504
92 Ga0265314_10085319 3300031711 Unclassified 2070
93 Ga0373945_0105780 3300035116 Bacteria 1106
94 Ga0373953_0099038 3300035117 Bacteria 1226
95 Ga0373927_0189203 3300035695 Bacteria 1350
96 Ga0373947_0015406 3300035725 Bacteria 4388
97 Ga0373937_0824987 3300036401 Archaea 875
98 Ga0373925_0048598 3300037068 Bacteria 3161
99 Ga0395900_0226392 3300037418 Bacteria 1883
100 Ga0395898_0169358 3300037466 Bacteria 2088
101 Ga0395905_0664824 3300037471 Bacteria 944
102 Ga0395901_0017746 3300038443 Bacteria 7264
103 Ga0395901_0133157 3300038443 Bacteria 2612
104 Ga0436365_1396902 3300039437 Bacteria 893
105 Ga0436360_1069148 3300039438 Bacteria 1177
106 Ga0436363_1301454 3300039450 Bacteria 2029
107 Ga0436362_1006066 3300039453 Bacteria 1711
108 Ga0451853_0595329 3300041512 Bacteria 1018
109 Ga0466961_0002911 3300044693 Bacteria 10626
110 Ga0466961_0017800 3300044693 Bacteria 4566
111 Ga0466961_0181448 3300044693 Bacteria 1307
112 Ga0466963_0003081 3300044694 Bacteria 9445
113 Ga0466963_0037248 3300044694 Bacteria 3175
114 Ga0466963_0237350 3300044694 Bacteria 1278
115 Ga0466964_0003877 3300044706 Bacteria 5493
116 Ga0466964_0023427 3300044706 Bacteria 2400
117 Ga0466971_0005875 3300044719 Bacteria 5341
118 Ga0466968_0040478 3300044735 Bacteria 1965
119 Ga0466970_0270598 3300044765 Unclassified 954
120 Ga0466957_0001323 3300044842 Bacteria 12938
121 Ga0466957_0094766 3300044842 Bacteria 1875
122 Ga0466959_0005421 3300045049 Bacteria 8729
123 Ga0466958_0001250 3300045836 Bacteria 11901
124 Ga0466958_0108674 3300045836 Bacteria 1730
125 Ga0466967_0006391 3300045976 Bacteria 8329
126 Ga0466967_0009368 3300045976 Bacteria 7260
127 Ga0466967_0028001 3300045976 Bacteria 4696
128 Ga0466967_0033067 3300045976 Bacteria 4375
129 Ga0466967_0035702 3300045976 Bacteria 4235
130 Ga0466967_0038575 3300045976 Bacteria 4098
131 Ga0466967_0077980 3300045976 Bacteria 2983
132 Ga0466967_0135298 3300045976 Bacteria 2291
133 Ga0466967_0157598 3300045976 Bacteria 2128
134 Ga0466967_0184603 3300045976 Bacteria 1969
135 Ga0466967_0435170 3300045976 Bacteria 1280
136 Ga0466967_0723596 3300045976 Bacteria 986
137 Ga0495592_0418362 3300046454 Archaea 846
138 Ga0495603_0265991 3300046455 Bacteria 987
139 Ga0495651_0017797 3300046462 Bacteria 5503
140 Ga0495651_0100321 3300046462 Bacteria 2157
141 Ga0495653_0085330 3300046463 Unclassified 2323
142 Ga0495580_0105770 3300046472 Bacteria 1955
143 Ga0495582_0072677 3300046473 Bacteria 1904
144 Ga0495582_0558439 3300046473 Unclassified 662
145 Ga0495664_0036605 3300046477 Bacteria 2893
146 Ga0495608_0051753 3300046511 Bacteria 2721
147 Ga0495618_0150689 3300046514 Unclassified 1486
148 Ga0495628_0047458 3300046516 Bacteria 3407
149 Ga0495630_0002900 3300046517 Bacteria 11912
150 Ga0495630_0017199 3300046517 Bacteria 5294
151 Ga0495630_0049618 3300046517 Bacteria 3141
152 Ga0495630_0181687 3300046517 Bacteria 1604
153 Ga0495640_0152019 3300046533 Bacteria 1487
154 Ga0495586_0002631 3300046535 Bacteria 9713
155 Ga0495587_0151029 3300046536 Bacteria 1324
156 Ga0495587_0287023 3300046536 Bacteria 922
157 Ga0495667_0010761 3300046559 Bacteria 6184
158 Ga0495667_0090371 3300046559 Bacteria 1984
159 Ga0495667_0091863 3300046559 Bacteria 1966
160 Ga0495634_0027271 3300046642 Bacteria 3975
161 Ga0495657_0034682 3300046675 Bacteria 3502
162 Ga0495657_0084124 3300046675 Bacteria 2053
163 Ga0495599_0161162 3300046678 Unclassified 1386
164 Ga0495613_0023985 3300046689 Bacteria 4545
165 Ga0495613_0060207 3300046689 Bacteria 2782
166 Ga0495600_0111738 3300046809 Unclassified 1779
167 Ga0495604_0128045 3300047317 Bacteria 1828
168 Ga0495674_0005291 3300047319 Bacteria 12377
169 Ga0495676_0090920 3300047321 Bacteria 2283
170 Ga0495680_0001468 3300047322 Bacteria 25451
171 Ga0495680_0100333 3300047322 Bacteria 2157
172 Ga0495675_0003897 3300047444 Bacteria 9039
173 Ga0495675_0226041 3300047444 Bacteria 1131
174 Ga0495684_0015641 3300047471 Bacteria 5840
175 Ga0495602_0396430 3300048088 Bacteria 985
176 Ga0496100_0038160 3300048903 Bacteria 3042
177 Ga0496100_0324348 3300048903 Bacteria 1157
178 Ga0496101_0008191 3300048904 Bacteria 6825
179 Ga0496102_0031913 3300048905 Bacteria 4729
180 Ga0496102_0242271 3300048905 Bacteria 1700
181 Ga0496102_0329720 3300048905 Bacteria 1438
182 Ga0496103_0051201 3300048906 Bacteria 2556
183 Ga0496103_0067786 3300048906 Unclassified 2229
184 Ga0496106_0021116 3300048909 Bacteria 4834
185 Ga0496107_0006004 3300048910 Bacteria 8329
186 Ga0496107_0054403 3300048910 Bacteria 2888
187 Ga0496112_0009803 3300048915 Bacteria 8652
188 Ga0496112_0018870 3300048915 Bacteria 6498
189 Ga0496112_0046810 3300048915 Bacteria 4243
190 Ga0496112_0299838 3300048915 Bacteria 1553
191 Ga0496114_0007326 3300048917 Bacteria 8714
192 Ga0496114_0315163 3300048917 Unclassified 1382
193 Ga0496115_0023104 3300048918 Unclassified 4824
194 Ga0496115_0136541 3300048918 Bacteria 2022
195 Ga0496115_0208032 3300048918 Bacteria 1616
196 Ga0501034_0173250 3300049571 Bacteria 2124
197 Ga0501046_0123640 3300049580 Bacteria 1967
198 Ga0501047_0210425 3300049581 Bacteria 1803
199 Ga0501069_0008897 3300049585 Bacteria 5294
200 Ga0501069_0086214 3300049585 Bacteria 1773
201 Ga0501070_0001183 3300049586 Bacteria 23311
202 Ga0501074_0108792 3300049590 Bacteria 1984
203 Ga0501035_0200275 3300049822 Bacteria 1713
204 nmdc:mga0rr50_11208_c1 3300050513 Bacteria 5723
205 nmdc:mga0a205_124874_c1 3300050515 Bacteria 2473
206 Ga0495619_0020893 3300053085 Bacteria 4175
207 Ga0495619_0103365 3300053085 Bacteria 1941
208 Ga0495619_0216459 3300053085 Bacteria 1327
209 Ga0466962_0001141 3300061719 Bacteria 12262
210 Ga0530510_0023952 3300061734 Bacteria 4354
211 Ga0501047_0107324
212 Ga0070683_100154372
213 Ga0070680_100008895
214 Ga0070682_100345204
215 Ga0070660_100005657
216 Ga0070660_100006666
217 Ga0070660_100160747
218 Ga0070660_100361384
219 Ga0070661_100034943
220 Ga0070661_100159716
221 Ga0070659_100136722
222 Ga0070714_100095193
223 Ga0070708_100351931
224 Ga0070681_10001216
225 Ga0070681_10002459
226 Ga0070681_10054735
227 Ga0070681_10116770
228 Ga0070698_100667875
229 Ga0070679_100004090
230 Ga0070679_100028350
231 Ga0070679_100093518
232 Ga0070684_100192869
233 Ga0068853_100261912
234 Ga0070686_100307880
235 Ga0070665_100607275
236 Ga0070665_100663464
237 Ga0068855_100144889
238 Ga0068855_100174549
239 Ga0068857_100079307
240 Ga0068854_100410049
241 Ga0070702_100227006
242 Ga0068852_100267221
243 Ga0070717_10027548
244 Ga0070712_100176844
245 Ga0075433_10138757
246 Ga0075436_100254198
247 Ga0105240_10667021
248 Ga0105245_10157821
249 Ga0105242_10071510
250 Ga0105239_11544581
251 Ga0157370_10005484
252 Ga0157370_10048324
253 Ga0157370_10052574
254 Ga0157369_10002867
255 Ga0157369_10265158
256 Ga0157374_10149381
257 Ga0157372_10102988
258 Ga0163163_10648442
259 Ga0182008_10167985
260 Ga0206356_10925515
261 Ga0213873_10034008
262 Ga0207699_10714287
263 Ga0207707_10048520
264 Ga0207707_10058752
265 Ga0207707_10076563
266 Ga0207660_10144031
267 Ga0207660_10409584
268 Ga0207657_10001526
269 Ga0207657_10005853
270 Ga0207657_10130432
271 Ga0207657_10180388
272 Ga0207649_10023982
273 Ga0207649_10261474
274 Ga0207652_10024937
275 Ga0207652_10029540
276 Ga0207652_10119391
277 Ga0207652_10315647
278 Ga0207687_10174490
279 Ga0207700_10096278
280 Ga0207664_10046166
281 Ga0207644_10356820
282 Ga0207690_10082422
283 Ga0207661_10039972
284 Ga0207661_10469440
285 Ga0207667_10054629
286 Ga0207678_10117134
287 Ga0207678_10280501
288 Ga0207674_10020175
289 Ga0265334_10027853
290 Ga0265318_10042515
291 Ga0265322_10032417
292 Ga0265338_10051410
293 Ga0265338_10060618
294 Ga0265328_10091511
295 Ga0265325_10112342
296 Ga0265329_10021657
297 Ga0265340_10017430
298 Ga0265339_10044893
299 Ga0265327_10112298
300 Ga0265316_10072037
301 Ga0265313_10011477
302 Ga0265314_10085319
303 Ga0373945_0105780
304 Ga0373953_0099038
305 Ga0373927_0189203
306 Ga0373947_0015406
307 Ga0373937_0824987
308 Ga0373925_0048598
309 Ga0395900_0226392
310 Ga0395898_0169358
311 Ga0395905_0664824
312 Ga0395901_0017746
313 Ga0395901_0133157
314 Ga0436365_1396902
315 Ga0436360_1069148
316 Ga0436363_1301454
317 Ga0436362_1006066
318 Ga0451853_0595329
319 Ga0466961_0002911
320 Ga0466961_0017800
321 Ga0466961_0181448
322 Ga0466963_0003081
323 Ga0466963_0037248
324 Ga0466963_0237350
325 Ga0466964_0003877
326 Ga0466964_0023427
327 Ga0466971_0005875
328 Ga0466968_0040478
329 Ga0466970_0270598
330 Ga0466957_0001323
331 Ga0466957_0094766
332 Ga0466959_0005421
333 Ga0466958_0001250
334 Ga0466958_0108674
335 Ga0466967_0006391
336 Ga0466967_0009368
337 Ga0466967_0028001
338 Ga0466967_0033067
339 Ga0466967_0035702
340 Ga0466967_0038575
341 Ga0466967_0077980
342 Ga0466967_0135298
343 Ga0466967_0157598
344 Ga0466967_0184603
345 Ga0466967_0435170
346 Ga0466967_0723596
347 Ga0495592_0418362
348 Ga0495603_0265991
349 Ga0495651_0017797
350 Ga0495651_0100321
351 Ga0495653_0085330
352 Ga0495580_0105770
353 Ga0495582_0072677
354 Ga0495582_0558439
355 Ga0495664_0036605
356 Ga0495608_0051753
357 Ga0495618_0150689
358 Ga0495628_0047458
359 Ga0495630_0002900
360 Ga0495630_0017199
361 Ga0495630_0049618
362 Ga0495630_0181687
363 Ga0495640_0152019
364 Ga0495586_0002631
365 Ga0495587_0151029
366 Ga0495587_0287023
367 Ga0495667_0010761
368 Ga0495667_0090371
369 Ga0495667_0091863
370 Ga0495634_0027271
371 Ga0495657_0034682
372 Ga0495657_0084124
373 Ga0495599_0161162
374 Ga0495613_0023985
375 Ga0495613_0060207
376 Ga0495600_0111738
377 Ga0495604_0128045
378 Ga0495674_0005291
379 Ga0495676_0090920
380 Ga0495680_0001468
381 Ga0495680_0100333
382 Ga0495675_0003897
383 Ga0495675_0226041
384 Ga0495684_0015641
385 Ga0495602_0396430
386 Ga0496100_0038160
387 Ga0496100_0324348
388 Ga0496101_0008191
389 Ga0496102_0031913
390 Ga0496102_0242271
391 Ga0496102_0329720
392 Ga0496103_0051201
393 Ga0496103_0067786
394 Ga0496106_0021116
395 Ga0496107_0006004
396 Ga0496107_0054403
397 Ga0496112_0009803
398 Ga0496112_0018870
399 Ga0496112_0046810
400 Ga0496112_0299838
401 Ga0496114_0007326
402 Ga0496114_0315163
403 Ga0496115_0023104
404 Ga0496115_0136541
405 Ga0496115_0208032
406 Ga0501034_0173250
407 Ga0501046_0123640
408 Ga0501047_0210425
409 Ga0501069_0008897
410 Ga0501069_0086214
411 Ga0501070_0001183
412 Ga0501074_0108792
413 Ga0501035_0200275
414 nmdc:mga0rr50_11208_c1
415 nmdc:mga0a205_124874_c1
416 Ga0495619_0020893
417 Ga0495619_0103365
418 Ga0495619_0216459
419 Ga0466962_0001141
420 Ga0530510_0023952

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18317

SDH_C

Shikimate 5'-dehydrogenase C-terminal domain

209

239

0.98

PF08501

Shikimate_dh_N

Shikimate dehydrogenase substrate binding domain

23

98

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4etn-assembly1.cif.gz_A crystal structure of ywle mutant from bacillus subtilis 0.8537 1 38
4egs-assembly3.cif.gz_B crystal structure analysis of low molecular weight protein tyrosine phosphatase from t. tengcongensis 0.8528 1 38
7cok-assembly1.cif.gz_B crystal structure of ligand-free form of 5-ketofructose reductase of gluconobacter sp. strain chm43 0.8365 2 206
1nvt-assembly1.cif.gz_B crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with nadp+ 0.8353 1 206
1o9b-assembly2.cif.gz_B quinate/shikimate dehydrogenase ydib complexed with nadh 0.8325 1 205
ID Description Score Start End Superfamily
4egsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8528 1 38 3.40.50.2300
af_P0A6D5_3_112_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.8379 2 81 3.40.50.10860
af_Q0IMW8_4_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8319 131 205 3.40.50.720
af_P0A6D5_8_104_1.10.560.10 Mainly Alpha;Orthogonal Bundle;GROEL; domain 1;GroEL-like equatorial domain 0.8274 2 77 1.10.560.10
1wxdA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.8228 1 78 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A538ML45-F1-model_v4 Shikimate dehydrogenase 0.9515 1 208 GO:0004764
GO:0009423
GO:0019632
AF-A0A7W0UDL9-F1-model_v4 Shikimate dehydrogenase 0.944 80 207
AF-A0A538ML45-F1-model_v4 Shikimate dehydrogenase 0.9426 1 208 GO:0004764
GO:0009423
GO:0019632
AF-A0A537WEB6-F1-model_v4 Shikimate dehydrogenase 0.9312 20 209 GO:0004764
GO:0009423
GO:0019632
AF-A0A538IED1-F1-model_v4 SDH C-terminal domain-containing protein 0.9136 61 207

Map