F320840

General Info

Members Datasets Scaffolds Average Seq Length
210 162 420 295

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0359763|Ga0496114_0359763_163_972
Length 269
Sequence MLELTGITKSYAGRRVLDDVSFTVRPGRLTGFIGGNGAGKTTTMRIILGVLAKDAGTVTLDGVEVTAPDRRRFGYMPEERGLYPKMKVLEQIVYLARLHGFSKTDAETRARELLDRLDLGQRLDDKVETLSLGNQQRAQIDVVAAVLQARAAQGAAVLFSSHQLDVVERLCDDLVIIAAGEIRAAGSRKELRAQHSRRRFELISATSADWLRGEPGIQLVSLEGGYAVFDADSEQTAQRVLRQAVAHGDVASFAPRHPTLAEIFKEVIQ

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
7 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
8 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
9 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
10 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
11 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
16 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
17 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
18 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
19 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
20 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
21 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
22 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
23 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
24 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
25 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
36 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
37 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
38 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
39 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
40 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
41 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
42 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
45 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
46 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
47 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
48 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
49 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
50 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
51 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
52 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
53 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
54 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
55 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
56 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
57 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
58 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
59 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
60 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
61 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
62 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
63 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
64 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
65 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
66 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
67 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
68 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
72 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
73 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
74 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
75 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
76 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
77 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
78 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
79 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
80 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
81 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
82 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
83 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
84 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
85 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
86 2501939600 Micromonospora sp. L5 Isolate Unclassified
87 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
88 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
89 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
90 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
91 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
92 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
93 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
94 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
95 2643221546 Microbacterium sp. Root53 Isolate Unclassified
96 2643221549 Agromyces sp. Root1464 Isolate Unclassified
97 2643221553 Microbacterium sp. Root553 Isolate Unclassified
98 2643221566 Microbacterium sp. Root166 Isolate Unclassified
99 2643221572 Leifsonia sp. Root60 Isolate Unclassified
100 2643221575 Microbacterium sp. Root61 Isolate Unclassified
101 2643221597 Microbacterium sp. Root180 Isolate Unclassified
102 2643221616 Leifsonia sp. Root227 Isolate Unclassified
103 2643221619 Agromyces sp. Root81 Isolate Unclassified
104 2643221630 Microbacterium sp. Root322 Isolate Unclassified
105 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
106 2643221649 Leifsonia sp. Root4 Isolate Unclassified
107 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
108 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
109 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
110 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
111 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
112 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
113 2773857759 Microbacterium sp. 1294 Isolate Unclassified
114 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
115 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
116 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
117 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
118 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
119 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
120 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
121 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
122 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
123 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
124 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
125 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
126 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
127 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
128 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
129 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
130 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
131 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
132 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
133 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
134 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
135 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
136 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
137 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
138 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
139 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
140 2919395869 Microbacterium resistens 2980 Isolate Unclassified
141 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
142 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
143 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
144 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
145 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
146 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
147 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
148 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
149 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
150 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
151 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
152 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
153 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
154 649633069 Micromonospora sp. L5 Isolate Unclassified
155 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
156 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
157 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
158 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
159 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
160 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
161 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
162 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 62.38
Metatranscriptomes 0.95
Isolates 36.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 13.81
Nodule 0
Rhizoplane 5.24
Rhizosphere 40.95
Stem 0
Stem Tuber 0.48
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0359763 3300048917 Bacteria 1287
2 JGI25164J39214_1000505 3300002772 Bacteria 18861
3 JGI25165J46597_1000055 3300003214 Bacteria 224187
4 Ga0006562J51391_1035822 3300003578 Bacteria 35489
5 Ga0006562J51391_1035824 3300003578 Bacteria 14270
6 Ga0070675_100551326 3300005354 Bacteria 1043
7 Ga0070672_100500558 3300005543 Bacteria 1051
8 Ga0068870_10042075 3300005840 Bacteria 2377
9 Ga0075365_10021209 3300006038 Bacteria 4048
10 Ga0075365_10037781 3300006038 Bacteria 3136
11 Ga0075364_10016108 3300006051 Bacteria 4646
12 Ga0075364_10021069 3300006051 Bacteria 4106
13 Ga0075364_10088689 3300006051 Bacteria 2051
14 Ga0075364_10121807 3300006051 Bacteria 1746
15 Ga0075369_10004335 3300006186 Bacteria 5231
16 Ga0075369_10011367 3300006186 Bacteria 3502
17 Ga0075370_10019181 3300006353 Bacteria 3721
18 Ga0105244_10010966 3300009036 Bacteria 5465
19 Ga0105244_10051566 3300009036 Bacteria 2096
20 Ga0111539_10581425 3300009094 Bacteria 1304
21 Ga0105243_10005120 3300009148 Bacteria 10280
22 Ga0105237_10026303 3300009545 Bacteria 5947
23 Ga0157369_10009018 3300013105 Bacteria 11425
24 Ga0157369_10102278 3300013105 Bacteria 3053
25 Ga0157369_10716873 3300013105 Bacteria 1030
26 Ga0171462_1002 3300013250 Bacteria 1052134
27 Ga0163162_10061075 3300013306 Bacteria 3806
28 Ga0157372_10090966 3300013307 Bacteria 3470
29 Ga0157380_10010564 3300014326 Bacteria 6640
30 Ga0207427_100028 3300025231 Bacteria 388949
31 Ga0209437_100619 3300025233 Bacteria 21553
32 Ga0209646_1000014 3300025246 Bacteria 550484
33 Ga0209233_1000001 3300025261 Bacteria 2992747
34 Ga0207655_1016629 3300025728 Bacteria 4013
35 Ga0207655_1070996 3300025728 Bacteria 1294
36 Ga0207643_10023248 3300025908 Bacteria 3418
37 Ga0207657_10089590 3300025919 Bacteria 2569
38 Ga0207709_10055197 3300025935 Bacteria 2453
39 Ga0207689_10160230 3300025942 Bacteria 1854
40 Ga0207678_10159583 3300026067 Bacteria 1926
41 Ga0207675_100074820 3300026118 Bacteria 3169
42 Ga0268266_10157463 3300028379 Bacteria 2053
43 Ga0307515_10093355 3300028794 Bacteria 3732
44 Ga0307515_10209141 3300028794 Bacteria 1800
45 Ga0307408_100299877 3300031548 Bacteria 1346
46 Ga0307405_10037300 3300031731 Bacteria 2920
47 Ga0307405_10180555 3300031731 Bacteria 1515
48 Ga0307413_10254139 3300031824 Bacteria 1306
49 Ga0307406_10000107 3300031901 Bacteria 48696
50 Ga0307406_10013006 3300031901 Bacteria 4758
51 Ga0307406_10068260 3300031901 Bacteria 2320
52 Ga0307406_10075460 3300031901 Bacteria 2224
53 Ga0307406_10191845 3300031901 Bacteria 1496
54 Ga0307412_10323024 3300031911 Bacteria 1229
55 Ga0307409_100015648 3300031995 Bacteria 4986
56 Ga0307416_100059069 3300032002 Bacteria 3114
57 Ga0307414_10678118 3300032004 Bacteria 931
58 Ga0307411_10067231 3300032005 Bacteria 2411
59 Ga0395898_0095710 3300037466 Bacteria 2853
60 Ga0439465_0013490 3300041413 Bacteria 2547
61 Ga0439465_0050710 3300041413 Bacteria 1358
62 Ga0466972_0034165 3300044658 Bacteria 2493
63 Ga0466965_0073193 3300044683 Bacteria 1725
64 Ga0466965_0077267 3300044683 Bacteria 1681
65 Ga0495627_002967 3300046453 Bacteria 7776
66 Ga0495638_0062335 3300046460 Bacteria 2302
67 Ga0495620_0057359 3300046515 Bacteria 1635
68 Ga0496100_0463515 3300048903 Bacteria 973
69 Ga0496102_0163956 3300048905 Bacteria 2091
70 Ga0496105_0076548 3300048908 Bacteria 2763
71 Ga0496105_0111870 3300048908 Bacteria 2253
72 Ga0496108_0223514 3300048911 Bacteria 1636
73 Ga0496109_0115637 3300048912 Bacteria 2496
74 Ga0496111_0108044 3300048914 Bacteria 2049
75 Ga0496112_0123959 3300048915 Bacteria 2555
76 Ga0496114_0290936 3300048917 Bacteria 1441
77 Ga0496115_0226427 3300048918 Bacteria 1542
78 Ga0496116_0012265 3300048919 Bacteria 7009
79 Ga0496117_0000014 3300048920 Bacteria 584427
80 Ga0496117_0000174 3300048920 Bacteria 132648
81 Ga0496117_0000808 3300048920 Bacteria 48592
82 Ga0496117_0161687 3300048920 Bacteria 1311
83 Ga0496118_0009776 3300048921 Bacteria 9616
84 Ga0496118_0027777 3300048921 Bacteria 4780
85 Ga0496119_0003579 3300048922 Bacteria 16046
86 Ga0496119_0006947 3300048922 Bacteria 10326
87 Ga0496119_0051740 3300048922 Bacteria 2521
88 Ga0496119_0062006 3300048922 Bacteria 2229
89 Ga0496120_0002722 3300048923 Bacteria 17275
90 Ga0496120_0007627 3300048923 Bacteria 8019
91 Ga0496120_0023480 3300048923 Bacteria 3860
92 Ga0496122_0000071 3300048925 Bacteria 222537
93 Ga0496122_0003161 3300048925 Bacteria 22016
94 Ga0496122_0016960 3300048925 Bacteria 6843
95 Ga0496122_0108159 3300048925 Bacteria 1835
96 Ga0496122_0152709 3300048925 Bacteria 1422
97 Ga0496123_0000006 3300048926 Bacteria 647258
98 Ga0496123_0000172 3300048926 Bacteria 130598
99 Ga0496123_0019066 3300048926 Bacteria 5417
100 Ga0496124_0002091 3300048927 Bacteria 26947
101 Ga0496124_0014015 3300048927 Bacteria 7778
102 Ga0496124_0038523 3300048927 Bacteria 4150
103 Ga0496125_0000015 3300048928 Bacteria 516648
104 Ga0496125_0001828 3300048928 Bacteria 29377
105 Ga0496125_0013506 3300048928 Bacteria 8023
106 Ga0496125_0037159 3300048928 Bacteria 4237
107 Ga0496125_0054799 3300048928 Bacteria 3255
108 Ga0496125_0069432 3300048928 Bacteria 2765
109 Ga0496125_0113175 3300048928 Bacteria 1958
110 Ga0496126_0014599 3300048929 Bacteria 7933
111 Ga0501034_0004781 3300049571 Bacteria 14986
112 Ga0501039_0105347 3300049575 Bacteria 2202
113 Ga0501043_0271629 3300049579 Bacteria 1301
114 Ga0501069_0106732 3300049585 Bacteria 1592
115 Ga0501070_0011773 3300049586 Bacteria 7387
116 Ga0501073_0000046 3300049589 Bacteria 78180
117 Ga0501083_0028323 3300049744 Bacteria 3861
118 nmdc:mga00v17_114212_c1 3300050491 Bacteria 1715
119 nmdc:mga00v17_4642_c1 3300050491 Bacteria 7165
120 nmdc:mga00v17_4681_c1 3300050491 Bacteria 7146
121 nmdc:mga0yw44_14237_c1 3300050492 Bacteria 4216
122 nmdc:mga0yw44_144133_c1 3300050492 Bacteria 1550
123 nmdc:mga07m45_16182_c2 3300050496 Bacteria 3328
124 nmdc:mga0sz30_124818_c1 3300050516 Bacteria 1132
125 nmdc:mga0sz30_34476_c1 3300050516 Bacteria 2107
126 nmdc:mga0sz30_43938_c1 3300050516 Bacteria 1881
127 Ga0500556_0000133 3300053104 Bacteria 63387
128 Ga0500593_000381 3300053117 Bacteria 17618
129 Ga0500655_000840 3300053133 Bacteria 5997
130 Ga0500559_0000474 3300053136 Bacteria 28589
131 Ga0500616_0028800 3300053153 Bacteria 3059
132 Ga0500645_004611 3300053730 Bacteria 5248
133 Ga0501084_0250274 3300054114 Bacteria 1496
134 2501945934 2501939600 Bacteria 6907073
135 2515494809 2515154088 Bacteria 5526283
136 2515718814 2515154129 Bacteria 5584369
137 2515755470 2515154137 Bacteria 5711575
138 2516083021 2515154202 Bacteria 5471270
139 2516090106 2515154203 Bacteria 5458536
140 2587861732 2585428094 Bacteria 3604039
141 2588107381 2585428157 Bacteria 3018951
142 2643732976 2643221542 Bacteria 3563959
143 2643752612 2643221546 Bacteria 2910897
144 2643769261 2643221549 Bacteria 4042819
145 2643784707 2643221553 Bacteria 3544260
146 2643847190 2643221566 Bacteria 3460379
147 2643877000 2643221572 Bacteria 3614809
148 2643887785 2643221575 Bacteria 4022601
149 2643997173 2643221597 Bacteria 3347721
150 2644098003 2643221616 Bacteria 4066575
151 2644112719 2643221619 Bacteria 4158469
152 2644171768 2643221630 Bacteria 3601215
153 2644197502 2643221635 Bacteria 2632343
154 2644278317 2643221649 Bacteria 3867359
155 2644384055 2643221669 Bacteria 3611286
156 2644681486 2643221724 Bacteria 3593515
157 2723643842 2721755702 Bacteria 4373124
158 2730231111 2728369380 Bacteria 3620317
159 2747953379 2747842429 Bacteria 3914386
160 2758225520 2757320536 Bacteria 3629334
161 2774382223 2773857759 Bacteria 2963774
162 2774397671 2773857763 Bacteria 4180068
163 2808884067 2808606368 Bacteria 3174172
164 2809225994 2808606447 Bacteria 3572005
165 2812325053 2811994872 Bacteria 4121241
166 2821271568 2821268502 Bacteria 3750023
167 2831936716 2831935698 Bacteria 5963223
168 2832010331 2832004796 Bacteria 6538017
169 2833712710 2833709550 Bacteria 4008291
170 2844853531 2844852863 Bacteria 3849151
171 2852635117 2852632344 Bacteria 3463163
172 2852663632 2852663356 Bacteria 4090475
173 2852678253 2852677369 Bacteria 3768884
174 2856861934 2856858025 Bacteria 7255264
175 2857721863 2857720070 Bacteria 3189373
176 2857726448 2857723135 Bacteria 4217853
177 2857733122 2857729791 Bacteria 4040535
178 2857739024 2857737099 Bacteria 3104305
179 2862994319 2862993130 Bacteria 3860849
180 2866067337 2866065130 Bacteria 6518152
181 2867317825 2867312974 Bacteria 7058875
182 2867320222 2867319477 Bacteria 7069771
183 2867508080 2867507094 Bacteria 6506033
184 2870628840 2870628048 Bacteria 3696012
185 2884766719 2884763398 Bacteria 4091164
186 2895662218 2895660088 Bacteria 3782833
187 2906802491 2906799679 Bacteria 4031749
188 2919397519 2919395869 Bacteria 3704152
189 2919444855 2919443155 Bacteria 4072969
190 2928093087 2928090899 Bacteria 3158267
191 2928121825 2928121344 Bacteria 3972376
192 2935413495 2935409751 Bacteria 4179611
193 2939661523 2939660829 Bacteria 3784848
194 2946041718 2946041624 Bacteria 4191385
195 2946083602 2946080515 Bacteria 4310960
196 2974295789 2974294766 Bacteria 3767688
197 2974324412 2974324384 Bacteria 3750535
198 2977252379 2977251589 Bacteria 2952848
199 2977264746 2977264416 Bacteria 3750737
200 2984583312 2984580707 Bacteria 3351387
201 2995729168 2995726249 Bacteria 3470435
202 649812534 649633069 Bacteria 6962533
203 8004184037 8004182704 Bacteria 3391155
204 8004215199 8004212874 Bacteria 2861420
205 8016256002 8016254467 Bacteria 3797036
206 8045832955 8045830549 Bacteria 4444727
207 8046354403 8046352972 Bacteria 3613806
208 8055040301 8055037949 Bacteria 3337834
209 8056040334 8056037122 Bacteria 3854319
210 8057346495 8057345674 Bacteria 4160394
211 Ga0496114_0359763
212 JGI25164J39214_1000505
213 JGI25165J46597_1000055
214 Ga0006562J51391_1035822
215 Ga0006562J51391_1035824
216 Ga0070675_100551326
217 Ga0070672_100500558
218 Ga0068870_10042075
219 Ga0075365_10021209
220 Ga0075365_10037781
221 Ga0075364_10016108
222 Ga0075364_10021069
223 Ga0075364_10088689
224 Ga0075364_10121807
225 Ga0075369_10004335
226 Ga0075369_10011367
227 Ga0075370_10019181
228 Ga0105244_10010966
229 Ga0105244_10051566
230 Ga0111539_10581425
231 Ga0105243_10005120
232 Ga0105237_10026303
233 Ga0157369_10009018
234 Ga0157369_10102278
235 Ga0157369_10716873
236 Ga0171462_1002
237 Ga0163162_10061075
238 Ga0157372_10090966
239 Ga0157380_10010564
240 Ga0207427_100028
241 Ga0209437_100619
242 Ga0209646_1000014
243 Ga0209233_1000001
244 Ga0207655_1016629
245 Ga0207655_1070996
246 Ga0207643_10023248
247 Ga0207657_10089590
248 Ga0207709_10055197
249 Ga0207689_10160230
250 Ga0207678_10159583
251 Ga0207675_100074820
252 Ga0268266_10157463
253 Ga0307515_10093355
254 Ga0307515_10209141
255 Ga0307408_100299877
256 Ga0307405_10037300
257 Ga0307405_10180555
258 Ga0307413_10254139
259 Ga0307406_10000107
260 Ga0307406_10013006
261 Ga0307406_10068260
262 Ga0307406_10075460
263 Ga0307406_10191845
264 Ga0307412_10323024
265 Ga0307409_100015648
266 Ga0307416_100059069
267 Ga0307414_10678118
268 Ga0307411_10067231
269 Ga0395898_0095710
270 Ga0439465_0013490
271 Ga0439465_0050710
272 Ga0466972_0034165
273 Ga0466965_0073193
274 Ga0466965_0077267
275 Ga0495627_002967
276 Ga0495638_0062335
277 Ga0495620_0057359
278 Ga0496100_0463515
279 Ga0496102_0163956
280 Ga0496105_0076548
281 Ga0496105_0111870
282 Ga0496108_0223514
283 Ga0496109_0115637
284 Ga0496111_0108044
285 Ga0496112_0123959
286 Ga0496114_0290936
287 Ga0496115_0226427
288 Ga0496116_0012265
289 Ga0496117_0000014
290 Ga0496117_0000174
291 Ga0496117_0000808
292 Ga0496117_0161687
293 Ga0496118_0009776
294 Ga0496118_0027777
295 Ga0496119_0003579
296 Ga0496119_0006947
297 Ga0496119_0051740
298 Ga0496119_0062006
299 Ga0496120_0002722
300 Ga0496120_0007627
301 Ga0496120_0023480
302 Ga0496122_0000071
303 Ga0496122_0003161
304 Ga0496122_0016960
305 Ga0496122_0108159
306 Ga0496122_0152709
307 Ga0496123_0000006
308 Ga0496123_0000172
309 Ga0496123_0019066
310 Ga0496124_0002091
311 Ga0496124_0014015
312 Ga0496124_0038523
313 Ga0496125_0000015
314 Ga0496125_0001828
315 Ga0496125_0013506
316 Ga0496125_0037159
317 Ga0496125_0054799
318 Ga0496125_0069432
319 Ga0496125_0113175
320 Ga0496126_0014599
321 Ga0501034_0004781
322 Ga0501039_0105347
323 Ga0501043_0271629
324 Ga0501069_0106732
325 Ga0501070_0011773
326 Ga0501073_0000046
327 Ga0501083_0028323
328 nmdc:mga00v17_114212_c1
329 nmdc:mga00v17_4642_c1
330 nmdc:mga00v17_4681_c1
331 nmdc:mga0yw44_14237_c1
332 nmdc:mga0yw44_144133_c1
333 nmdc:mga07m45_16182_c2
334 nmdc:mga0sz30_124818_c1
335 nmdc:mga0sz30_34476_c1
336 nmdc:mga0sz30_43938_c1
337 Ga0500556_0000133
338 Ga0500593_000381
339 Ga0500655_000840
340 Ga0500559_0000474
341 Ga0500616_0028800
342 Ga0500645_004611
343 Ga0501084_0250274
344 2501945934
345 2515494809
346 2515718814
347 2515755470
348 2516083021
349 2516090106
350 2587861732
351 2588107381
352 2643732976
353 2643752612
354 2643769261
355 2643784707
356 2643847190
357 2643877000
358 2643887785
359 2643997173
360 2644098003
361 2644112719
362 2644171768
363 2644197502
364 2644278317
365 2644384055
366 2644681486
367 2723643842
368 2730231111
369 2747953379
370 2758225520
371 2774382223
372 2774397671
373 2808884067
374 2809225994
375 2812325053
376 2821271568
377 2831936716
378 2832010331
379 2833712710
380 2844853531
381 2852635117
382 2852663632
383 2852678253
384 2856861934
385 2857721863
386 2857726448
387 2857733122
388 2857739024
389 2862994319
390 2866067337
391 2867317825
392 2867320222
393 2867508080
394 2870628840
395 2884766719
396 2895662218
397 2906802491
398 2919397519
399 2919444855
400 2928093087
401 2928121825
402 2935413495
403 2939661523
404 2946041718
405 2946083602
406 2974295789
407 2974324412
408 2977252379
409 2977264746
410 2984583312
411 2995729168
412 649812534
413 8004184037
414 8004215199
415 8016256002
416 8045832955
417 8046354403
418 8055040301
419 8056040334
420 8057346495

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13732

DUF4162

Domain of unknown function (DUF4162)

186

268

0.96

PF00005

ABC_tran

ABC transporter

17

150

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.935 2 216
5x40-assembly1.cif.gz_B structure of a cbio dimer bound with amppcp 0.9289 2 216
5lj7-assembly1.cif.gz_B structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) 0.9217 2 212
5lil-assembly1.cif.gz_B structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) 0.921 2 212
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.92 2 220
ID Description Score Start End Superfamily
af_Q2FVS3_1_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9633 2 218 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9589 2 215 3.40.50.300
af_Q2FXB7_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9575 2 212 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9543 2 216 3.40.50.300
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.95 2 218 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4Q7PN08-F1-model_v4 deleted 0.9558 2 219
AF-A0A7Y0HPE4-F1-model_v4 ABC transporter ATP-binding protein 0.9543 1 212 GO:0005524
GO:0016887
AF-A0A316B4T8-F1-model_v4 deleted 0.9527 2 217
AF-A0A1Q6RQW5-F1-model_v4 ABC transporter domain-containing protein 0.952 2 220 GO:0005524
GO:0016887
AF-A0A7C6CAI4-F1-model_v4 ABC transporter ATP-binding protein 0.9519 2 220 GO:0005524
GO:0016887

Map