F320665

General Info

Members Datasets Scaffolds Average Seq Length
210 149 204 157

Family's Representative Sequence

Representative Sequence 3300042012|Ga0439455_0103019|Ga0439455_0103019_58_579
Length 173
Sequence MSSIIMRQSVDNVNHKDIASDDAAVLELVHTVMHRFRALQYRALDPQPRDDGEAGLTHMEGKVLGYFAHHPDATQRDLAHHSGRDKAQLARLIKSLRERGLLEGVADEADRRNVRLRVTAAGQAGTRTLRQQGRKLEARAVAGLSTEQRRELVALLQQVLHNLDSELDRDAGD

Samples

Sample ID Description Type Environment
1 2643221645 Massilia sp. Root351 Isolate Unclassified
2 2643221664 Massilia sp. Root418 Isolate Unclassified
3 2738541280 Massilia sp. GV090 Isolate Unclassified
4 2831864461 Roseateles noduli HZ7 Isolate Nodule
5 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
6 2904424332 Duganella sp. 1411 Isolate Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
45 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
47 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
48 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
70 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
73 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
74 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
87 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
88 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
89 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
90 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
91 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
100 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
111 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
112 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
122 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
123 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
124 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
125 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
126 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
127 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
133 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
134 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
135 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
136 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
137 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
138 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
141 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
142 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
143 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
144 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
145 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
146 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
147 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
148 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
149 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0
Isolates 2.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.29
Nodule 0.48
Rhizoplane 1.43
Rhizosphere 61.43
Stem 0
Stem Tuber 0
Unclassified 12.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1010139 3300002705 Bacteria 2234
2 JGI25156J39149_1028781 3300002705 Bacteria 854
3 rootH1_10027587 3300003316 Bacteria 8080
4 rootH2_10005404 3300003320 Bacteria 3249
5 rootH2_10209024 3300003320 Bacteria 1108
6 rootL2_10005248 3300003322 Bacteria 26533
7 rootL2_10279644 3300003322 Bacteria 2751
8 rootH1_10052659 3300003323 Bacteria 2422
9 rootH1_10156450 3300003323 Bacteria 2530
10 rootH1_10288509 3300003323 Bacteria 1244
11 Ga0055535_1000322 3300003761 Bacteria 48378
12 Ga0055529_1000397 3300003763 Bacteria 46314
13 Ga0055526_1000709 3300003771 Bacteria 25255
14 Ga0055526_1003503 3300003771 Bacteria 9928
15 Ga0055524_1001527 3300003775 Bacteria 13079
16 Ga0055534_1000653 3300003784 Bacteria 17589
17 Ga0055531_10020778 3300003794 Bacteria 2580
18 Ga0055543_1002831 3300004625 Bacteria 5482
19 Ga0065165_1000153 3300005262 Bacteria 120209
20 Ga0065165_1000569 3300005262 Bacteria 54781
21 Ga0070658_10185578 3300005327 Bacteria 1751
22 Ga0070660_100157720 3300005339 Bacteria 1827
23 Ga0070673_100393168 3300005364 Bacteria 1238
24 Ga0070708_100208907 3300005445 Bacteria 1829
25 Ga0070678_101278593 3300005456 Unclassified 682
26 Ga0070707_100251840 3300005468 Bacteria 1719
27 Ga0068853_101257032 3300005539 Bacteria 715
28 Ga0068855_101215375 3300005563 Bacteria 783
29 Ga0068862_100693318 3300005844 Bacteria 986
30 Ga0075362_10089003 3300006177 Bacteria 1431
31 Ga0075362_10206652 3300006177 Bacteria 957
32 Ga0075367_10015504 3300006178 Bacteria 4145
33 Ga0075366_10003532 3300006195 Bacteria 8258
34 Ga0075366_10038150 3300006195 Bacteria 2837
35 Ga0075366_10118277 3300006195 Bacteria 1596
36 Ga0075370_10165590 3300006353 Bacteria 1298
37 Ga0105244_10013171 3300009036 Bacteria 4845
38 Ga0105250_10238397 3300009092 Bacteria 775
39 Ga0105240_10303149 3300009093 Bacteria 1827
40 Ga0114129_10096785 3300009147 Bacteria 4086
41 Ga0105242_10209914 3300009176 Bacteria 1735
42 Ga0105239_12082670 3300010375 Bacteria 659
43 Ga0157319_1000016 3300012497 Bacteria 127256
44 Ga0157374_10455258 3300013296 Bacteria 1281
45 Ga0182007_10006749 3300015262 Bacteria 4897
46 Ga0209672_107152 3300025228 Bacteria 1746
47 Ga0209563_115120 3300025230 Bacteria 974
48 Ga0209437_103739 3300025233 Bacteria 2721
49 Ga0209258_100025 3300025242 Bacteria 534777
50 Ga0209646_1000036 3300025246 Bacteria 358864
51 Ga0209759_1000383 3300025256 Bacteria 55232
52 Ga0209759_1002053 3300025256 Bacteria 9456
53 Ga0209455_1000112 3300025272 Bacteria 186237
54 Ga0209673_1013603 3300025273 Bacteria 3201
55 Ga0209673_1041482 3300025273 Bacteria 1305
56 Ga0209673_1060879 3300025273 Bacteria 943
57 Ga0209130_1008299 3300025284 Bacteria 3080
58 Ga0209675_1008616 3300025291 Bacteria 3718
59 Ga0209676_1002705 3300025292 Bacteria 11959
60 Ga0209025_1064470 3300025294 Bacteria 1345
61 Ga0209564_1000008 3300025295 Bacteria 953227
62 Ga0209564_1000032 3300025295 Bacteria 464041
63 Ga0209050_1017681 3300025298 Bacteria 2822
64 Ga0209256_1000496 3300025299 Bacteria 57666
65 Ga0209257_1003592 3300025304 Bacteria 13108
66 Ga0209257_1010491 3300025304 Bacteria 4675
67 Ga0207655_1008811 3300025728 Bacteria 6347
68 Ga0207705_10027476 3300025909 Bacteria 4058
69 Ga0207684_10038079 3300025910 Bacteria 4081
70 Ga0207657_10085213 3300025919 Bacteria 2647
71 Ga0207646_10285878 3300025922 Bacteria 1490
72 Ga0207690_10231832 3300025932 Unclassified 1418
73 Ga0207686_10452317 3300025934 Bacteria 988
74 Ga0207651_10538541 3300025960 Bacteria 1014
75 Ga0207703_11199750 3300026035 Unclassified 729
76 Ga0207676_10654393 3300026095 Bacteria 1014
77 Ga0207675_100159428 3300026118 Bacteria 2151
78 Ga0265336_10000029 3300028666 Bacteria 178897
79 Ga0307517_10159835 3300028786 Bacteria 1516
80 Ga0307515_10000030 3300028794 Bacteria 364482
81 Ga0265324_10001270 3300029957 Bacteria 14847
82 Ga0307511_10127542 3300030521 Bacteria 1546
83 Ga0316181_1133334 3300030744 Bacteria 623
84 Ga0307513_10008879 3300031456 Bacteria 12781
85 Ga0307509_10069100 3300031507 Bacteria 3694
86 Ga0307408_100523835 3300031548 Bacteria 1041
87 Ga0307516_10001904 3300031730 Bacteria 28571
88 Ga0307516_10119074 3300031730 Bacteria 2434
89 Ga0307416_101994352 3300032002 Bacteria 683
90 Ga0373927_0194960 3300035695 Bacteria 1329
91 Ga0373925_0696398 3300037068 Bacteria 838
92 Ga0395900_0078508 3300037418 Bacteria 3391
93 Ga0395900_0389754 3300037418 Bacteria 1359
94 Ga0395900_1783273 3300037418 Unclassified 526
95 Ga0395898_0670054 3300037466 Bacteria 979
96 Ga0395905_0002702 3300037471 Bacteria 19436
97 Ga0395905_0326110 3300037471 Bacteria 1425
98 Ga0395901_0085453 3300038443 Bacteria 3298
99 Ga0395901_0353863 3300038443 Bacteria 1515
100 Ga0395901_0529624 3300038443 Bacteria 1196
101 Ga0451802_1100877 3300041460 Bacteria 2042
102 Ga0451855_0049648 3300041511 Bacteria 759
103 Ga0439431_0018011 3300041997 Bacteria 1667
104 Ga0439455_0103019 3300042012 Bacteria 790
105 Ga0450888_003961 3300042126 Bacteria 1528
106 Ga0450890_026389 3300042127 Bacteria 809
107 Ga0466969_0004457 3300044656 Bacteria 7450
108 Ga0466982_0235737 3300044672 Bacteria 1078
109 Ga0466966_0002420 3300044684 Bacteria 12193
110 Ga0466961_0018529 3300044693 Bacteria 4479
111 Ga0466970_0029497 3300044765 Bacteria 2888
112 Ga0466970_0072848 3300044765 Bacteria 1848
113 Ga0466959_0016998 3300045049 Bacteria 5324
114 Ga0495651_0404980 3300046462 Bacteria 890
115 Ga0495650_0000077 3300046471 Bacteria 245511
116 Ga0495650_0002745 3300046471 Bacteria 13585
117 Ga0495639_0006546 3300046475 Bacteria 5010
118 Ga0495583_0000071 3300046506 Bacteria 183691
119 Ga0495583_0313314 3300046506 Bacteria 622
120 Ga0495606_0023434 3300046507 Bacteria 4472
121 Ga0495606_0023910 3300046507 Bacteria 4415
122 Ga0495610_0003277 3300046512 Bacteria 12757
123 Ga0495610_0018724 3300046512 Bacteria 3897
124 Ga0495610_0030447 3300046512 Bacteria 2829
125 Ga0495610_0137945 3300046512 Bacteria 1052
126 Ga0495631_0475968 3300046518 Bacteria 532
127 Ga0495632_0047195 3300046519 Bacteria 2137
128 Ga0495637_0040877 3300046520 Bacteria 1993
129 Ga0495637_0136416 3300046520 Unclassified 934
130 Ga0495643_0000334 3300046522 Bacteria 64400
131 Ga0495643_0000974 3300046522 Bacteria 29347
132 Ga0495644_0006302 3300046523 Bacteria 4609
133 Ga0495648_0200900 3300046524 Bacteria 998
134 Ga0495663_0212193 3300046525 Bacteria 678
135 Ga0495654_0105552 3300046530 Bacteria 1291
136 Ga0495597_0002367 3300046542 Bacteria 12099
137 Ga0495597_0006902 3300046542 Bacteria 5827
138 Ga0495597_0097430 3300046542 Bacteria 1242
139 Ga0495633_0023401 3300046558 Bacteria 3062
140 Ga0495633_0031848 3300046558 Bacteria 2551
141 Ga0495668_0042480 3300046616 Bacteria 2531
142 Ga0495668_0281188 3300046616 Bacteria 912
143 Ga0495625_0012084 3300046660 Bacteria 7006
144 Ga0495625_0129771 3300046660 Bacteria 1708
145 Ga0495625_0312975 3300046660 Bacteria 1001
146 Ga0495659_0000525 3300046664 Bacteria 14123
147 Ga0495661_0101214 3300046665 Bacteria 1621
148 Ga0495661_0296029 3300046665 Bacteria 811
149 Ga0495669_0020261 3300046684 Bacteria 2876
150 Ga0495671_0000243 3300046692 Bacteria 47019
151 Ga0495671_0107633 3300046692 Bacteria 1361
152 Ga0495649_0001467 3300046694 Bacteria 17724
153 Ga0495649_0009947 3300046694 Bacteria 5625
154 Ga0495649_0144034 3300046694 Bacteria 1253
155 Ga0495589_0014946 3300046794 Bacteria 3994
156 Ga0495660_0000906 3300046810 Bacteria 21875
157 Ga0495660_0015158 3300046810 Bacteria 4456
158 Ga0495660_0094129 3300046810 Bacteria 1552
159 Ga0495672_0000019 3300047320 Bacteria 448153
160 Ga0495672_0007970 3300047320 Bacteria 7896
161 Ga0495672_0019441 3300047320 Bacteria 4478
162 Ga0495683_0020042 3300047323 Bacteria 3450
163 Ga0495683_0086841 3300047323 Bacteria 1520
164 Ga0495687_005482 3300047443 Bacteria 8065
165 Ga0495673_0000096 3300047469 Bacteria 182792
166 Ga0495673_0067826 3300047469 Bacteria 1509
167 Ga0495681_0213911 3300047470 Bacteria 776
168 Ga0495686_0003977 3300047472 Bacteria 12385
169 Ga0495686_0020035 3300047472 Bacteria 4463
170 Ga0495686_0210489 3300047472 Bacteria 1111
171 Ga0495686_0252576 3300047472 Bacteria 990
172 Ga0495626_0000984 3300048091 Bacteria 24536
173 Ga0495626_0023410 3300048091 Bacteria 3042
174 Ga0495626_0027207 3300048091 Bacteria 2782
175 Ga0495626_0092540 3300048091 Bacteria 1328
176 Ga0495626_0097410 3300048091 Bacteria 1286
177 Ga0495626_0102178 3300048091 Bacteria 1248
178 Ga0496103_0000659 3300048906 Bacteria 26109
179 Ga0496114_1662535 3300048917 Bacteria 527
180 Ga0496125_0071532 3300048928 Bacteria 2708
181 Ga0495678_000820 3300049459 Bacteria 27851
182 Ga0495678_003160 3300049459 Bacteria 10393
183 Ga0495678_013458 3300049459 Bacteria 3840
184 Ga0495678_129721 3300049459 Bacteria 837
185 Ga0501248_040175 3300049678 Bacteria 570
186 Ga0501249_002674 3300049679 Bacteria 3590
187 Ga0501269_000044 3300049766 Bacteria 38688
188 nmdc:mga0k408_1950_c1 3300050493 Bacteria 11059
189 nmdc:mga0k408_27326_c1 3300050493 Bacteria 3241
190 nmdc:mga0k408_282479_c1 3300050493 Bacteria 991
191 nmdc:mga0k408_403251_c1 3300050493 Bacteria 814
192 nmdc:mga0k408_48626_c1 3300050493 Bacteria 2454
193 nmdc:mga07m45_20647_c1 3300050496 Bacteria 3579
194 nmdc:mga05p37_161442_c1 3300050507 Bacteria 2737
195 Ga0500635_0095029 3300053080 Bacteria 1089
196 Ga0500594_0001279 3300053118 Bacteria 5461
197 Ga0500597_178659 3300053120 Bacteria 901
198 Ga0500608_027311 3300053122 Bacteria 2690
199 Ga0500618_000353 3300053125 Bacteria 31985
200 Ga0500559_0189585 3300053136 Bacteria 969
201 Ga0500564_059449 3300053138 Bacteria 1736
202 Ga0500589_181600 3300053147 Bacteria 826
203 Ga0500636_0056139 3300053177 Bacteria 2307
204 Ga0500661_006132 3300055283 Bacteria 2242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003771 Ga0055526_1003503 Ga0055526_10035038 137
2 3300004625 Ga0055543_1002831 Ga0055543_10028313 137
3 3300005262 Ga0065165_1000153 Ga0065165_100015341 137
4 3300046810 Ga0495660_0000906 Ga0495660_0000906_13181_13699 137
5 3300031730 Ga0307516_10001904 Ga0307516_100019047 138
6 3300031456 Ga0307513_10008879 Ga0307513_100088791 141
7 3300009176 Ga0105242_10209914 Ga0105242_102099142 142
8 3300030521 Ga0307511_10127542 Ga0307511_101275421 142
9 3300035695 Ga0373927_0194960 Ga0373927_0194960_710_1138 142
10 3300037068 Ga0373925_0696398 Ga0373925_0696398_14_442 142
11 3300044656 Ga0466969_0004457 Ga0466969_0004457_3419_3862 142
12 3300044684 Ga0466966_0002420 Ga0466966_0002420_5293_5724 142
13 3300044693 Ga0466961_0018529 Ga0466961_0018529_3831_4274 142
14 3300044765 Ga0466970_0072848 Ga0466970_0072848_797_1240 142
15 3300045049 Ga0466959_0016998 Ga0466959_0016998_1774_2217 142
16 3300046506 Ga0495583_0000071 Ga0495583_0000071_90949_91377 142
17 3300046507 Ga0495606_0023910 Ga0495606_0023910_2192_2620 142
18 3300046524 Ga0495648_0200900 Ga0495648_0200900_347_775 142
19 3300046684 Ga0495669_0020261 Ga0495669_0020261_1442_1870 142
20 3300046694 Ga0495649_0001467 Ga0495649_0001467_3106_3534 142
21 3300046794 Ga0495589_0014946 Ga0495589_0014946_1824_2252 142
22 3300047323 Ga0495683_0086841 Ga0495683_0086841_103_531 142
23 3300048917 Ga0496114_1662535 Ga0496114_1662535_13_441 142
24 3300053122 Ga0500608_027311 Ga0500608_027311_1360_1788 142
25 3300053138 Ga0500564_059449 Ga0500564_059449_366_794 142
26 3300053147 Ga0500589_181600 Ga0500589_181600_341_769 142
27 3300055283 Ga0500661_006132 Ga0500661_006132_367_795 142
28 3300041997 Ga0439431_0018011 Ga0439431_0018011_788_1279 143
29 3300006177 Ga0075362_10089003 Ga0075362_100890032 144
30 3300041511 Ga0451855_0049648 Ga0451855_0049648_71_577 145
31 3300037418 Ga0395900_1783273 Ga0395900_1783273_55_498 146
32 3300037471 Ga0395905_0002702 Ga0395905_0002702_11117_11569 146
33 3300037471 Ga0395905_0326110 Ga0395905_0326110_546_989 146
34 3300038443 Ga0395901_0529624 Ga0395901_0529624_221_676 146
35 3300048906 Ga0496103_0000659 Ga0496103_0000659_12183_12689 146
36 3300009092 Ga0105250_10238397 Ga0105250_102383972 147
37 iso_pu_bacteria 2831864461 2831865552 147
38 iso_pu_bacteria 2886848708 2886850162 147
39 3300032002 Ga0307416_101994352 Ga0307416_1019943521 148
40 3300003320 rootH2_10005404 rootH2_100054042 151
41 3300003322 rootL2_10005248 rootL2_1000524825 151
42 3300003323 rootH1_10052659 rootH1_100526593 151
43 3300003775 Ga0055524_1001527 Ga0055524_10015275 151
44 3300003794 Ga0055531_10020778 Ga0055531_100207782 151
45 3300006353 Ga0075370_10165590 Ga0075370_101655902 151
46 3300012497 Ga0157319_1000016 Ga0157319_100001669 151
47 3300025273 Ga0209673_1013603 Ga0209673_10136032 151
48 3300025273 Ga0209673_1060879 Ga0209673_10608793 151
49 3300025295 Ga0209564_1000008 Ga0209564_1000008784 151
50 3300025299 Ga0209256_1000496 Ga0209256_10004966 151
51 3300025304 Ga0209257_1003592 Ga0209257_10035929 151
52 3300031548 Ga0307408_100523835 Ga0307408_1005238351 151
53 3300050493 nmdc:mga0k408_403251_c1 nmdc:mga0k408_403251_c1_281_736 151
54 3300050496 nmdc:mga07m45_20647_c1 nmdc:mga07m45_20647_c1_139_594 151
55 3300044672 Ga0466982_0235737 Ga0466982_0235737_286_744 152
56 3300044765 Ga0466970_0029497 Ga0466970_0029497_2048_2506 152
57 3300003316 rootH1_10027587 rootH1_100275875 153
58 3300025960 Ga0207651_10538541 Ga0207651_105385411 153
59 3300028794 Ga0307515_10000030 Ga0307515_10000030231 153
60 3300046507 Ga0495606_0023434 Ga0495606_0023434_989_1462 153
61 3300046512 Ga0495610_0018724 Ga0495610_0018724_249_722 153
62 3300046512 Ga0495610_0030447 Ga0495610_0030447_1999_2472 153
63 3300046522 Ga0495643_0000974 Ga0495643_0000974_6564_7037 153
64 3300046558 Ga0495633_0031848 Ga0495633_0031848_2042_2515 153
65 3300046660 Ga0495625_0129771 Ga0495625_0129771_348_821 153
66 3300046692 Ga0495671_0107633 Ga0495671_0107633_303_776 153
67 3300046694 Ga0495649_0009947 Ga0495649_0009947_4364_4837 153
68 3300046694 Ga0495649_0144034 Ga0495649_0144034_172_645 153
69 3300047320 Ga0495672_0007970 Ga0495672_0007970_6583_7056 153
70 3300047469 Ga0495673_0000096 Ga0495673_0000096_20762_21235 153
71 3300047469 Ga0495673_0067826 Ga0495673_0067826_1004_1477 153
72 3300049459 Ga0495678_003160 Ga0495678_003160_6550_7023 153
73 3300049459 Ga0495678_129721 Ga0495678_129721_59_532 153
74 3300053118 Ga0500594_0001279 Ga0500594_0001279_1095_1568 153
75 3300053136 Ga0500559_0189585 Ga0500559_0189585_342_815 153
76 3300006195 Ga0075366_10038150 Ga0075366_100381502 154
77 3300015262 Ga0182007_10006749 Ga0182007_100067492 154
78 3300025233 Ga0209437_103739 Ga0209437_1037394 154
79 3300025246 Ga0209646_1000036 Ga0209646_1000036300 154
80 3300042126 Ga0450888_003961 Ga0450888_003961_864_1355 154
81 3300046471 Ga0495650_0002745 Ga0495650_0002745_308_772 154
82 3300046475 Ga0495639_0006546 Ga0495639_0006546_1713_2177 154
83 3300046616 Ga0495668_0042480 Ga0495668_0042480_507_971 154
84 3300005364 Ga0070673_100393168 Ga0070673_1003931682 155
85 3300049678 Ga0501248_040175 Ga0501248_040175_39_518 155
86 iso_pu_bacteria 2643221645 2644250923 155
87 3300003771 Ga0055526_1000709 Ga0055526_10007096 156
88 3300003784 Ga0055534_1000653 Ga0055534_10006536 156
89 3300005445 Ga0070708_100208907 Ga0070708_1002089072 156
90 3300005844 Ga0068862_100693318 Ga0068862_1006933182 156
91 3300006195 Ga0075366_10118277 Ga0075366_101182772 156
92 3300009147 Ga0114129_10096785 Ga0114129_100967851 156
93 3300025273 Ga0209673_1041482 Ga0209673_10414822 156
94 3300025284 Ga0209130_1008299 Ga0209130_10082992 156
95 3300025291 Ga0209675_1008616 Ga0209675_10086162 156
96 3300025292 Ga0209676_1002705 Ga0209676_100270511 156
97 3300025294 Ga0209025_1064470 Ga0209025_10644702 156
98 3300025295 Ga0209564_1000032 Ga0209564_100003238 156
99 3300025298 Ga0209050_1017681 Ga0209050_10176813 156
100 3300025304 Ga0209257_1010491 Ga0209257_10104913 156
101 3300026035 Ga0207703_11199750 Ga0207703_111997502 156
102 3300026095 Ga0207676_10654393 Ga0207676_106543932 156
103 3300026118 Ga0207675_100159428 Ga0207675_1001594283 156
104 3300028786 Ga0307517_10159835 Ga0307517_101598352 156
105 3300046530 Ga0495654_0105552 Ga0495654_0105552_692_1189 156
106 3300046542 Ga0495597_0097430 Ga0495597_0097430_256_753 156
107 3300046664 Ga0495659_0000525 Ga0495659_0000525_1293_1790 156
108 3300046692 Ga0495671_0000243 Ga0495671_0000243_14120_14617 156
109 3300047320 Ga0495672_0019441 Ga0495672_0019441_3862_4359 156
110 3300047472 Ga0495686_0020035 Ga0495686_0020035_3495_3977 156
111 3300047472 Ga0495686_0252576 Ga0495686_0252576_296_778 156
112 3300048928 Ga0496125_0071532 Ga0496125_0071532_1798_2268 156
113 3300050493 nmdc:mga0k408_48626_c1 nmdc:mga0k408_48626_c1_1000_1473 156
114 3300050507 nmdc:mga05p37_161442_c1 nmdc:mga05p37_161442_c1_47_517 156
115 3300053125 Ga0500618_000353 Ga0500618_000353_13313_13786 156
116 iso_pu_bacteria 2643221664 2644356340 156
117 iso_pu_bacteria 2738541280 2738739016 156
118 3300002705 JGI25156J39149_1028781 JGI25156J39149_10287812 157
119 3300005262 Ga0065165_1000569 Ga0065165_10005696 157
120 3300005327 Ga0070658_10185578 Ga0070658_101855783 157
121 3300005339 Ga0070660_100157720 Ga0070660_1001577201 157
122 3300005539 Ga0068853_101257032 Ga0068853_1012570322 157
123 3300005563 Ga0068855_101215375 Ga0068855_1012153751 157
124 3300009093 Ga0105240_10303149 Ga0105240_103031491 157
125 3300025230 Ga0209563_115120 Ga0209563_1151201 157
126 3300025256 Ga0209759_1000383 Ga0209759_100038339 157
127 3300025909 Ga0207705_10027476 Ga0207705_100274764 157
128 3300025919 Ga0207657_10085213 Ga0207657_100852134 157
129 3300025932 Ga0207690_10231832 Ga0207690_102318322 157
130 3300031507 Ga0307509_10069100 Ga0307509_100691003 157
131 3300037418 Ga0395900_0078508 Ga0395900_0078508_203_676 157
132 3300037418 Ga0395900_0389754 Ga0395900_0389754_814_1287 157
133 3300037466 Ga0395898_0670054 Ga0395898_0670054_237_710 157
134 3300038443 Ga0395901_0085453 Ga0395901_0085453_860_1333 157
135 3300038443 Ga0395901_0353863 Ga0395901_0353863_729_1202 157
136 3300046519 Ga0495632_0047195 Ga0495632_0047195_169_642 157
137 3300046542 Ga0495597_0002367 Ga0495597_0002367_2675_3160 157
138 3300046810 Ga0495660_0015158 Ga0495660_0015158_1594_2067 157
139 3300047320 Ga0495672_0000019 Ga0495672_0000019_353190_353663 157
140 3300047443 Ga0495687_005482 Ga0495687_005482_1235_1711 157
141 3300047472 Ga0495686_0210489 Ga0495686_0210489_384_857 157
142 3300048091 Ga0495626_0023410 Ga0495626_0023410_1266_1754 157
143 3300048091 Ga0495626_0097410 Ga0495626_0097410_256_729 157
144 3300049459 Ga0495678_000820 Ga0495678_000820_10140_10625 157
145 3300053120 Ga0500597_178659 Ga0500597_178659_123_596 157
146 3300003322 rootL2_10279644 rootL2_102796442 158
147 3300003323 rootH1_10288509 rootH1_102885092 158
148 3300005456 Ga0070678_101278593 Ga0070678_1012785931 158
149 3300005468 Ga0070707_100251840 Ga0070707_1002518402 158
150 3300006177 Ga0075362_10206652 Ga0075362_102066522 158
151 3300006178 Ga0075367_10015504 Ga0075367_100155043 158
152 3300009036 Ga0105244_10013171 Ga0105244_100131716 158
153 3300025728 Ga0207655_1008811 Ga0207655_10088116 158
154 3300025910 Ga0207684_10038079 Ga0207684_100380793 158
155 3300025922 Ga0207646_10285878 Ga0207646_102858781 158
156 3300028666 Ga0265336_10000029 Ga0265336_10000029150 158
157 3300029957 Ga0265324_10001270 Ga0265324_1000127011 158
158 3300030744 Ga0316181_1133334 Ga0316181_11333342 158
159 3300031730 Ga0307516_10119074 Ga0307516_101190742 158
160 3300046471 Ga0495650_0000077 Ga0495650_0000077_63943_64443 158
161 3300046506 Ga0495583_0313314 Ga0495583_0313314_109_585 158
162 3300046512 Ga0495610_0003277 Ga0495610_0003277_5086_5592 158
163 3300046512 Ga0495610_0137945 Ga0495610_0137945_26_532 158
164 3300046518 Ga0495631_0475968 Ga0495631_0475968_43_519 158
165 3300046520 Ga0495637_0040877 Ga0495637_0040877_954_1430 158
166 3300046520 Ga0495637_0136416 Ga0495637_0136416_140_616 158
167 3300046522 Ga0495643_0000334 Ga0495643_0000334_8925_9401 158
168 3300046523 Ga0495644_0006302 Ga0495644_0006302_583_1059 158
169 3300046525 Ga0495663_0212193 Ga0495663_0212193_85_573 158
170 3300046542 Ga0495597_0006902 Ga0495597_0006902_4622_5098 158
171 3300046558 Ga0495633_0023401 Ga0495633_0023401_953_1459 158
172 3300046616 Ga0495668_0281188 Ga0495668_0281188_312_788 158
173 3300046660 Ga0495625_0012084 Ga0495625_0012084_3961_4467 158
174 3300046665 Ga0495661_0101214 Ga0495661_0101214_239_715 158
175 3300046665 Ga0495661_0296029 Ga0495661_0296029_56_532 158
176 3300046810 Ga0495660_0094129 Ga0495660_0094129_444_920 158
177 3300047323 Ga0495683_0020042 Ga0495683_0020042_832_1311 158
178 3300047470 Ga0495681_0213911 Ga0495681_0213911_105_593 158
179 3300048091 Ga0495626_0000984 Ga0495626_0000984_21720_22196 158
180 3300048091 Ga0495626_0027207 Ga0495626_0027207_2233_2709 158
181 3300048091 Ga0495626_0092540 Ga0495626_0092540_200_676 158
182 3300048091 Ga0495626_0102178 Ga0495626_0102178_38_514 158
183 3300049459 Ga0495678_013458 Ga0495678_013458_2965_3447 158
184 3300049679 Ga0501249_002674 Ga0501249_002674_1741_2247 158
185 3300049766 Ga0501269_000044 Ga0501269_000044_17952_18458 158
186 3300050493 nmdc:mga0k408_27326_c1 nmdc:mga0k408_27326_c1_2306_2797 158
187 3300050493 nmdc:mga0k408_282479_c1 nmdc:mga0k408_282479_c1_351_872 158
188 iso_pu_bacteria 2904424332 2904425873 158
189 3300003323 rootH1_10156450 rootH1_101564502 159
190 3300013296 Ga0157374_10455258 Ga0157374_104552582 159
191 3300041460 Ga0451802_1100877 Ga0451802_1100877_502_981 159
192 3300042012 Ga0439455_0103019 Ga0439455_0103019_58_579 159
193 3300003320 rootH2_10209024 rootH2_102090242 160
194 3300006195 Ga0075366_10003532 Ga0075366_100035325 161
195 3300050493 nmdc:mga0k408_1950_c1 nmdc:mga0k408_1950_c1_3827_4324 161
196 3300010375 Ga0105239_12082670 Ga0105239_120826701 163
197 3300025934 Ga0207686_10452317 Ga0207686_104523171 164
198 3300046462 Ga0495651_0404980 Ga0495651_0404980_39_545 164
199 3300046660 Ga0495625_0312975 Ga0495625_0312975_288_782 164
200 3300047472 Ga0495686_0003977 Ga0495686_0003977_10654_11160 164
201 3300053080 Ga0500635_0095029 Ga0500635_0095029_234_728 164
202 3300053177 Ga0500636_0056139 Ga0500636_0056139_871_1365 164
203 3300002705 JGI25156J39149_1010139 JGI25156J39149_10101393 166
204 3300003761 Ga0055535_1000322 Ga0055535_100032251 166
205 3300003763 Ga0055529_1000397 Ga0055529_10003976 166
206 3300025228 Ga0209672_107152 Ga0209672_1071521 166
207 3300025242 Ga0209258_100025 Ga0209258_100025343 166
208 3300025256 Ga0209759_1002053 Ga0209759_100205312 166
209 3300025272 Ga0209455_1000112 Ga0209455_100011219 166
210 3300042127 Ga0450890_026389 Ga0450890_026389_215_730 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

54

113

0.98

PF09339

HTH_IclR

IclR helix-turn-helix domain

61

106

0.96

PF01047

MarR

MarR family

56

114

0.91

PF13463

HTH_27

Winged helix DNA-binding domain

66

122

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wqu-assembly1.cif.gz_B feoc from klebsiella pneumoniae 0.9641 57 101
5duk-assembly1.cif.gz_A n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9497 56 106
5duk-assembly1.cif.gz_B n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.936 56 106
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9274 56 116
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9257 57 115
ID Description Score Start End Superfamily
5dukB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9408 56 97 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9357 54 117 1.10.10.10
5dukA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9341 56 106 1.10.10.10
af_B4FTK6_47_112_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9288 54 117 1.10.10.10
af_Q58948_3_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9281 53 128 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4R6LMU0-F1-model_v4 deleted 0.902 20 159
AF-A0A848MQJ8-F1-model_v4 MarR family transcriptional regulator 0.8866 21 162 GO:0003677
GO:0003700
AF-A0A1B6YYG3-F1-model_v4 deleted 0.865 31 163
AF-A0A848MQJ8-F1-model_v4 MarR family transcriptional regulator 0.8641 21 162 GO:0003677
GO:0003700
AF-A0A1H6NKA0-F1-model_v4 deleted 0.8625 20 163

Feature Viewer

pLDDT pTM Quality
84.68 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map