F320603

General Info

Members Datasets Scaffolds Average Seq Length
210 152 420 162

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0094626|Ga0316582_0094626_1247_1879
Length 191
Sequence VILKFPVNFTNPKAGSFGEKEVARIESKGGIMEIKTVKIEKSDELNLILGHSHFIKTVEDIYETMVNTVPGAKFGLAFCESSGPCLVRYSGTDDDLVELAKKNAYALSAGHSFILLMKDMFPINVLNAIKNVPEVCRIFCATANPVEVLIAETEQGRGIIGVVDGFKTKGIETEADIKERKEFLRLIGYKQ

Samples

Sample ID Description Type Environment
1 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
59 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
60 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
64 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
67 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
68 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
72 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
73 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
74 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
86 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
87 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
88 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
92 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
93 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
94 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
95 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
96 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
97 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
98 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
99 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
100 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
101 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
111 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
114 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 2511231014 Pseudomonas sp. GM48 Isolate Nodule
151 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
152 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 1.9
Isolates 1.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.48
Rhizoplane 0
Rhizosphere 94.76
Stem 0
Stem Tuber 0
Unclassified 9.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316582_0094626 3300036647 Bacteria 1971
2 Ga0065707_10083242 3300005295 Bacteria 9849
3 Ga0070680_100368556 3300005336 Bacteria 1222
4 Ga0070673_100837676 3300005364 Bacteria 851
5 Ga0070688_100639451 3300005365 Bacteria 818
6 Ga0070667_100372270 3300005367 Bacteria 1296
7 Ga0070703_10002406 3300005406 Bacteria 5391
8 Ga0070705_100002293 3300005440 Bacteria 9665
9 Ga0070705_100499976 3300005440 Bacteria 923
10 Ga0070700_100238437 3300005441 Bacteria 1298
11 Ga0070694_100454021 3300005444 Bacteria 1012
12 Ga0070706_100003988 3300005467 Bacteria 14369
13 Ga0070706_100697383 3300005467 Bacteria 942
14 Ga0070698_100023666 3300005471 Bacteria 6417
15 Ga0070698_100051247 3300005471 Bacteria 4205
16 Ga0070699_100002113 3300005518 Bacteria 18024
17 Ga0070697_100037388 3300005536 Bacteria 3922
18 Ga0070697_100129747 3300005536 Unclassified 2114
19 Ga0070697_101681309 3300005536 Unclassified 568
20 Ga0070695_100037199 3300005545 Bacteria 3067
21 Ga0070696_100009564 3300005546 Bacteria 6487
22 Ga0070696_100054004 3300005546 Bacteria 2798
23 Ga0070696_100108774 3300005546 Bacteria 1994
24 Ga0070693_100331951 3300005547 Bacteria 1035
25 Ga0070704_100008495 3300005549 Bacteria 6160
26 Ga0068855_100072824 3300005563 Unclassified 3993
27 Ga0068852_100899627 3300005616 Archaea 902
28 Ga0068859_100017568 3300005617 Bacteria 7192
29 Ga0068870_10065066 3300005840 Bacteria 1971
30 Ga0068870_10720348 3300005840 Bacteria 690
31 Ga0068863_100136589 3300005841 Bacteria 2343
32 Ga0075432_10006463 3300006058 Bacteria 3988
33 Ga0075428_101185264 3300006844 Bacteria 805
34 Ga0075430_100059732 3300006846 Bacteria 3205
35 Ga0075430_100128132 3300006846 Bacteria 2116
36 Ga0075430_100193683 3300006846 Bacteria 1689
37 Ga0075430_101242819 3300006846 Bacteria 613
38 Ga0075431_100075564 3300006847 Bacteria 3477
39 Ga0075431_100419256 3300006847 Bacteria 1338
40 Ga0075433_10333035 3300006852 Bacteria 1342
41 Ga0075434_100000795 3300006871 Bacteria 24924
42 Ga0075429_100511788 3300006880 Bacteria 1052
43 Ga0097620_100017568 3300006931 Bacteria 7192
44 Ga0075435_100344531 3300007076 Unclassified 1277
45 Ga0105244_10103095 3300009036 Bacteria 1394
46 Ga0105240_10004139 3300009093 Bacteria 22222
47 Ga0105240_10259158 3300009093 Bacteria 2007
48 Ga0111539_10076267 3300009094 Unclassified 3947
49 Ga0111539_10119053 3300009094 Bacteria 3095
50 Ga0105245_11723999 3300009098 Unclassified 679
51 Ga0105238_10598965 3300009551 Bacteria 1110
52 Ga0105249_10100225 3300009553 Bacteria 2723
53 Ga0105239_10449025 3300010375 Bacteria 1462
54 Ga0157373_11048553 3300013100 Unclassified 610
55 Ga0157370_10600431 3300013104 Archaea 1008
56 Ga0157378_10851007 3300013297 Bacteria 940
57 Ga0157379_11176859 3300014968 Bacteria 737
58 Ga0213875_10033666 3300021388 Bacteria 2421
59 Ga0207655_1081642 3300025728 Bacteria 1164
60 Ga0207653_10006255 3300025885 Bacteria 3714
61 Ga0207680_10619015 3300025903 Bacteria 775
62 Ga0207684_10024665 3300025910 Bacteria 5128
63 Ga0207695_10022122 3300025913 Bacteria 7230
64 Ga0207695_10279472 3300025913 Bacteria 1563
65 Ga0207660_10348859 3300025917 Bacteria 1186
66 Ga0207646_10309638 3300025922 Bacteria 1427
67 Ga0207712_10089712 3300025961 Bacteria 2260
68 Ga0207658_10385823 3300025986 Bacteria 1228
69 Ga0207641_10050286 3300026088 Bacteria 3526
70 Ga0207675_100765218 3300026118 Bacteria 977
71 Ga0207698_10256394 3300026142 Bacteria 1604
72 Ga0268265_10437522 3300028380 Bacteria 1218
73 Ga0268265_10612549 3300028380 Unclassified 1042
74 Ga0265323_10124926 3300028653 Bacteria 836
75 Ga0265323_10132491 3300028653 Bacteria 806
76 Ga0265330_10108060 3300031235 Bacteria 1189
77 Ga0265332_10002170 3300031238 Bacteria 10110
78 Ga0265339_10046685 3300031249 Bacteria 2379
79 Ga0265316_10001055 3300031344 Bacteria 29875
80 Ga0265316_10001867 3300031344 Bacteria 22134
81 Ga0265316_10005264 3300031344 Bacteria 12631
82 Ga0265316_10006321 3300031344 Bacteria 11335
83 Ga0316575_10034366 3300031665 Bacteria 1991
84 Ga0316575_10039886 3300031665 Bacteria 1854
85 Ga0316579_10199995 3300031691 Bacteria 966
86 Ga0265342_10000106 3300031712 Bacteria 93147
87 Ga0265342_10161506 3300031712 Bacteria 1238
88 Ga0316576_10002034 3300031727 Bacteria 11339
89 Ga0316576_10083310 3300031727 Bacteria 2376
90 Ga0316576_10292181 3300031727 Bacteria 1219
91 Ga0316576_10408045 3300031727 Bacteria 1006
92 Ga0316576_10431679 3300031727 Bacteria 974
93 Ga0316578_10022399 3300031728 Bacteria 3522
94 Ga0316578_10063194 3300031728 Bacteria 2183
95 Ga0316578_10087693 3300031728 Bacteria 1856
96 Ga0316578_10117704 3300031728 Unclassified 1596
97 Ga0316578_10316854 3300031728 Bacteria 931
98 Ga0316577_10002389 3300031733 Bacteria 9286
99 Ga0316577_10042610 3300031733 Bacteria 2539
100 Ga0316577_10108484 3300031733 Bacteria 1557
101 Ga0307410_10504661 3300031852 Bacteria 996
102 Ga0307416_101205196 3300032002 Bacteria 863
103 Ga0316583_10037886 3300032133 Bacteria 1710
104 Ga0316585_10003147 3300032137 Bacteria 4505
105 Ga0316585_10030637 3300032137 Bacteria 1689
106 Ga0316580_10014989 3300032139 Unclassified 2369
107 Ga0316580_10021887 3300032139 Bacteria 1973
108 Ga0316593_10091578 3300032168 Unclassified 1071
109 Ga0316593_10147696 3300032168 Bacteria 854
110 Ga0316592_1048378 3300033524 Bacteria 948
111 Ga0316588_1097512 3300033528 Bacteria 735
112 Ga0373943_0380334 3300035170 Bacteria 813
113 Ga0316574_0000449 3300035398 Bacteria 16485
114 Ga0316574_0027015 3300035398 Bacteria 3455
115 Ga0316574_0063136 3300035398 Bacteria 2329
116 Ga0373935_0011631 3300035692 Bacteria 5287
117 Ga0373927_0174422 3300035695 Bacteria 1410
118 Ga0316582_0006850 3300036647 Bacteria 6022
119 Ga0316582_0009709 3300036647 Bacteria 5235
120 Ga0316582_0015469 3300036647 Bacteria 4366
121 Ga0316582_0039283 3300036647 Bacteria 2946
122 Ga0316582_0195443 3300036647 Bacteria 1379
123 Ga0316582_0242074 3300036647 Bacteria 1236
124 Ga0316582_0282149 3300036647 Bacteria 1140
125 Ga0316582_0498906 3300036647 Bacteria 839
126 Ga0316584_0000544 3300036712 Bacteria 20221
127 Ga0316584_0018943 3300036712 Bacteria 4971
128 Ga0316584_0020197 3300036712 Unclassified 4825
129 Ga0316584_0147228 3300036712 Bacteria 1754
130 Ga0316584_0414079 3300036712 Bacteria 958
131 Ga0316584_0923062 3300036712 Unclassified 587
132 Ga0373925_0279678 3300037068 Bacteria 1344
133 Ga0316581_0036237 3300037588 Bacteria 1497
134 Ga0316581_0153671 3300037588 Unclassified 709
135 Ga0436364_0048700 3300037853 Unclassified 913
136 Ga0436364_0348834 3300037853 Bacteria 5477
137 Ga0436364_1564128 3300037853 Bacteria 5615
138 Ga0400484_34109 3300038725 Bacteria 2161
139 Ga0400490_16505 3300038726 Unclassified 3797
140 Ga0400483_014592 3300039062 Bacteria 2982
141 Ga0400483_054592 3300039062 Bacteria 3943
142 Ga0400489_54635 3300039093 Unclassified 2043
143 Ga0436365_1328082 3300039437 Bacteria 2571
144 Ga0436360_0768113 3300039438 Bacteria 9132
145 Ga0439438_000335 3300041405 Bacteria 21036
146 Ga0439447_000058 3300041407 Bacteria 38446
147 Ga0439466_0085295 3300041411 Bacteria 993
148 Ga0450919_014340 3300042121 Bacteria 895
149 Ga0450920_000914 3300042122 Bacteria 4787
150 Ga0450922_000017 3300042124 Bacteria 15319
151 Ga0450923_004833 3300042125 Bacteria 2138
152 Ga0450906_004073 3300042145 Bacteria 3092
153 Ga0450907_000374 3300042146 Bacteria 13731
154 Ga0450910_003403 3300042147 Bacteria 2111
155 Ga0450908_000720 3300042184 Bacteria 6347
156 Ga0453683_0171768 3300044673 Bacteria 1373
157 Ga0451576_0871745 3300045051 Bacteria 945
158 Ga0466967_0298008 3300045976 Bacteria 1551
159 Ga0495590_0000236 3300046457 Bacteria 30399
160 Ga0495580_0256481 3300046472 Bacteria 1196
161 Ga0495582_0001440 3300046473 Bacteria 13429
162 Ga0495605_0000501 3300046474 Bacteria 33539
163 Ga0495610_0005700 3300046512 Bacteria 8777
164 Ga0495620_0001212 3300046515 Bacteria 15775
165 Ga0495632_0287156 3300046519 Bacteria 731
166 Ga0495648_0010204 3300046524 Bacteria 7175
167 Ga0495642_0000037 3300046528 Bacteria 79709
168 Ga0495654_0017925 3300046530 Bacteria 3715
169 Ga0495668_0006821 3300046616 Bacteria 7410
170 Ga0495588_0069411 3300046674 Bacteria 1831
171 Ga0495647_0119354 3300046681 Bacteria 1108
172 Ga0495658_0000484 3300046683 Bacteria 21818
173 Ga0495669_0016024 3300046684 Bacteria 3209
174 Ga0495649_0001629 3300046694 Bacteria 16706
175 Ga0495589_0017551 3300046794 Bacteria 3672
176 Ga0495683_0063953 3300047323 Bacteria 1817
177 Ga0495673_0010058 3300047469 Bacteria 5176
178 Ga0501031_0003052 3300049568 Bacteria 10709
179 Ga0501031_0007180 3300049568 Bacteria 7270
180 Ga0501032_0033425 3300049569 Bacteria 3524
181 Ga0501034_0004117 3300049571 Bacteria 16304
182 Ga0501037_0053007 3300049573 Archaea 2966
183 Ga0501038_0025080 3300049574 Bacteria 5315
184 Ga0501039_0007239 3300049575 Bacteria 8454
185 Ga0501040_0126701 3300049576 Bacteria 1794
186 Ga0501041_0049143 3300049577 Archaea 2569
187 Ga0501042_0006977 3300049578 Bacteria 7372
188 Ga0501043_0000174 3300049579 Bacteria 57374
189 Ga0501046_0025637 3300049580 Bacteria 4824
190 Ga0501048_0103184 3300049582 Bacteria 2012
191 Ga0501071_0142829 3300049587 Bacteria 1783
192 Ga0501072_0000291 3300049588 Bacteria 35610
193 Ga0501076_0102018 3300049592 Bacteria 2313
194 Ga0501077_0002337 3300049593 Bacteria 11425
195 Ga0501229_010188 3300049706 Bacteria 1185
196 Ga0501079_0241319 3300049741 Bacteria 1412
197 Ga0501035_0013375 3300049822 Bacteria 7577
198 nmdc:mga09592_1292137_c1 3300050508 Bacteria 600
199 nmdc:mga0qj67_110177_c1 3300050509 Bacteria 2222
200 nmdc:mga0qj67_185697_c1 3300050509 Bacteria 1689
201 nmdc:mga0qj67_56356_c1 3300050509 Bacteria 3115
202 nmdc:mga06r32_98301_c1 3300050510 Bacteria 2869
203 nmdc:mga08y16_201003_c1 3300050511 Unclassified 2065
204 nmdc:mga0n895_1544050_c1 3300050512 Bacteria 629
205 nmdc:mga0n895_20036_c1 3300050512 Bacteria 6229
206 nmdc:mga0rr50_310251_c1 3300050513 Unclassified 1321
207 nmdc:mga0a205_38425_c1 3300050515 Bacteria 4605
208 2511311562 2511231014 Bacteria 6462302
209 2904552126 2904550169 Bacteria 6221258
210 2939641525 2939636861 Bacteria 6297853
211 Ga0316582_0094626
212 Ga0065707_10083242
213 Ga0070680_100368556
214 Ga0070673_100837676
215 Ga0070688_100639451
216 Ga0070667_100372270
217 Ga0070703_10002406
218 Ga0070705_100002293
219 Ga0070705_100499976
220 Ga0070700_100238437
221 Ga0070694_100454021
222 Ga0070706_100003988
223 Ga0070706_100697383
224 Ga0070698_100023666
225 Ga0070698_100051247
226 Ga0070699_100002113
227 Ga0070697_100037388
228 Ga0070697_100129747
229 Ga0070697_101681309
230 Ga0070695_100037199
231 Ga0070696_100009564
232 Ga0070696_100054004
233 Ga0070696_100108774
234 Ga0070693_100331951
235 Ga0070704_100008495
236 Ga0068855_100072824
237 Ga0068852_100899627
238 Ga0068859_100017568
239 Ga0068870_10065066
240 Ga0068870_10720348
241 Ga0068863_100136589
242 Ga0075432_10006463
243 Ga0075428_101185264
244 Ga0075430_100059732
245 Ga0075430_100128132
246 Ga0075430_100193683
247 Ga0075430_101242819
248 Ga0075431_100075564
249 Ga0075431_100419256
250 Ga0075433_10333035
251 Ga0075434_100000795
252 Ga0075429_100511788
253 Ga0097620_100017568
254 Ga0075435_100344531
255 Ga0105244_10103095
256 Ga0105240_10004139
257 Ga0105240_10259158
258 Ga0111539_10076267
259 Ga0111539_10119053
260 Ga0105245_11723999
261 Ga0105238_10598965
262 Ga0105249_10100225
263 Ga0105239_10449025
264 Ga0157373_11048553
265 Ga0157370_10600431
266 Ga0157378_10851007
267 Ga0157379_11176859
268 Ga0213875_10033666
269 Ga0207655_1081642
270 Ga0207653_10006255
271 Ga0207680_10619015
272 Ga0207684_10024665
273 Ga0207695_10022122
274 Ga0207695_10279472
275 Ga0207660_10348859
276 Ga0207646_10309638
277 Ga0207712_10089712
278 Ga0207658_10385823
279 Ga0207641_10050286
280 Ga0207675_100765218
281 Ga0207698_10256394
282 Ga0268265_10437522
283 Ga0268265_10612549
284 Ga0265323_10124926
285 Ga0265323_10132491
286 Ga0265330_10108060
287 Ga0265332_10002170
288 Ga0265339_10046685
289 Ga0265316_10001055
290 Ga0265316_10001867
291 Ga0265316_10005264
292 Ga0265316_10006321
293 Ga0316575_10034366
294 Ga0316575_10039886
295 Ga0316579_10199995
296 Ga0265342_10000106
297 Ga0265342_10161506
298 Ga0316576_10002034
299 Ga0316576_10083310
300 Ga0316576_10292181
301 Ga0316576_10408045
302 Ga0316576_10431679
303 Ga0316578_10022399
304 Ga0316578_10063194
305 Ga0316578_10087693
306 Ga0316578_10117704
307 Ga0316578_10316854
308 Ga0316577_10002389
309 Ga0316577_10042610
310 Ga0316577_10108484
311 Ga0307410_10504661
312 Ga0307416_101205196
313 Ga0316583_10037886
314 Ga0316585_10003147
315 Ga0316585_10030637
316 Ga0316580_10014989
317 Ga0316580_10021887
318 Ga0316593_10091578
319 Ga0316593_10147696
320 Ga0316592_1048378
321 Ga0316588_1097512
322 Ga0373943_0380334
323 Ga0316574_0000449
324 Ga0316574_0027015
325 Ga0316574_0063136
326 Ga0373935_0011631
327 Ga0373927_0174422
328 Ga0316582_0006850
329 Ga0316582_0009709
330 Ga0316582_0015469
331 Ga0316582_0039283
332 Ga0316582_0195443
333 Ga0316582_0242074
334 Ga0316582_0282149
335 Ga0316582_0498906
336 Ga0316584_0000544
337 Ga0316584_0018943
338 Ga0316584_0020197
339 Ga0316584_0147228
340 Ga0316584_0414079
341 Ga0316584_0923062
342 Ga0373925_0279678
343 Ga0316581_0036237
344 Ga0316581_0153671
345 Ga0436364_0048700
346 Ga0436364_0348834
347 Ga0436364_1564128
348 Ga0400484_34109
349 Ga0400490_16505
350 Ga0400483_014592
351 Ga0400483_054592
352 Ga0400489_54635
353 Ga0436365_1328082
354 Ga0436360_0768113
355 Ga0439438_000335
356 Ga0439447_000058
357 Ga0439466_0085295
358 Ga0450919_014340
359 Ga0450920_000914
360 Ga0450922_000017
361 Ga0450923_004833
362 Ga0450906_004073
363 Ga0450907_000374
364 Ga0450910_003403
365 Ga0450908_000720
366 Ga0453683_0171768
367 Ga0451576_0871745
368 Ga0466967_0298008
369 Ga0495590_0000236
370 Ga0495580_0256481
371 Ga0495582_0001440
372 Ga0495605_0000501
373 Ga0495610_0005700
374 Ga0495620_0001212
375 Ga0495632_0287156
376 Ga0495648_0010204
377 Ga0495642_0000037
378 Ga0495654_0017925
379 Ga0495668_0006821
380 Ga0495588_0069411
381 Ga0495647_0119354
382 Ga0495658_0000484
383 Ga0495669_0016024
384 Ga0495649_0001629
385 Ga0495589_0017551
386 Ga0495683_0063953
387 Ga0495673_0010058
388 Ga0501031_0003052
389 Ga0501031_0007180
390 Ga0501032_0033425
391 Ga0501034_0004117
392 Ga0501037_0053007
393 Ga0501038_0025080
394 Ga0501039_0007239
395 Ga0501040_0126701
396 Ga0501041_0049143
397 Ga0501042_0006977
398 Ga0501043_0000174
399 Ga0501046_0025637
400 Ga0501048_0103184
401 Ga0501071_0142829
402 Ga0501072_0000291
403 Ga0501076_0102018
404 Ga0501077_0002337
405 Ga0501229_010188
406 Ga0501079_0241319
407 Ga0501035_0013375
408 nmdc:mga09592_1292137_c1
409 nmdc:mga0qj67_110177_c1
410 nmdc:mga0qj67_185697_c1
411 nmdc:mga0qj67_56356_c1
412 nmdc:mga06r32_98301_c1
413 nmdc:mga08y16_201003_c1
414 nmdc:mga0n895_1544050_c1
415 nmdc:mga0n895_20036_c1
416 nmdc:mga0rr50_310251_c1
417 nmdc:mga0a205_38425_c1
418 2511311562
419 2904552126
420 2939641525

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04008

Adenosine_kin

Adenosine specific kinase

37

190

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jb7-assembly1.cif.gz_A pae2307 with amp 0.9676 2 162
1vgg-assembly1.cif.gz_F crystal structure of the conserved hypothetical protein ttha1091 from thermus thermophilus hb8 0.9655 3 162
2ekm-assembly1.cif.gz_C structure of st1219 protein from sulfolobus tokodaii 0.9616 3 162
1wvq-assembly1.cif.gz_A structure of conserved hypothetical protein pae2307 from pyrobaculum aerophilum 0.9601 2 162
2ekm-assembly1.cif.gz_C structure of st1219 protein from sulfolobus tokodaii 0.9557 3 162
ID Description Score Start End Superfamily
2gl0B00 Alpha Beta;3-Layer(aba) Sandwich;hypothetical protein tt1634;Ta1353-like 0.9663 2 162 3.40.1520.10
1rlhA02 Alpha Beta;3-Layer(aba) Sandwich;hypothetical protein tt1634;Ta1353-like 0.8774 15 115 3.40.1520.10
1rlhA02 Alpha Beta;3-Layer(aba) Sandwich;hypothetical protein tt1634;Ta1353-like 0.8694 15 115 3.40.1520.10
af_B6UDC2_408_608_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7178 113 137 2.130.10.10
af_Q9QY40_36_462_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6971 117 139 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A7X7WVN0-F1-model_v4 Adenosine monophosphate-protein transferase 0.9954 3 121 GO:0016740
AF-A0A7V3KX06-F1-model_v4 Adenosine monophosphate-protein transferase 0.995 8 108
AF-A0A2H9MLK8-F1-model_v4 Adenosine monophosphate-protein transferase 0.9899 3 120
AF-X0YLP2-F1-model_v4 Adenosine monophosphate-protein transferase 0.9897 16 113
AF-X1L8C9-F1-model_v4 Adenosine monophosphate-protein transferase 0.9887 11 145

Map