F320504

General Info

Members Datasets Scaffolds Average Seq Length
210 146 205 185

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10043005|Ga0307517_100430054
Length 204
Sequence VRISLISMPGGGKSTVGRQLAKRLQIPFHDTDSVIEQRIGQTIREFFEAEGEPAFRDIESEVLAELLTPGLPPAVVSTGGGSVLRPANRVLLRERSCVLYLHNSPRELFRRLRHDTQRPLLQTADPLARLHQMAQQREPLYRETAHFVLEVGRPSVPLLVNTILMQLEVAGYLAKLPVSPPAAHDEPQPTTDAAEPLQISEDAS

Samples

Sample ID Description Type Environment
1 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
2 2643221585 Pelomonas sp. Root662 Isolate Unclassified
3 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
4 2643221656 Pelomonas sp. Root405 Isolate Unclassified
5 2738541337 Pelomonas sp. BT06 Isolate Unclassified
6 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
63 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
64 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
71 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
74 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
75 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
76 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
77 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
78 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
79 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
80 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
81 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
82 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
83 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
84 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
85 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
86 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
87 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
88 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
97 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
98 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
101 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
102 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
103 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
106 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
107 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
108 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
115 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
116 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
117 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
118 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
119 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
120 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
121 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
122 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
125 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
126 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
127 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
128 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
129 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
138 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
139 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
140 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
141 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
142 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
143 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
144 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
145 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
146 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.24
Metatranscriptomes 1.9
Isolates 2.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.33
Nodule 0
Rhizoplane 1.9
Rhizosphere 54.29
Stem 0
Stem Tuber 0
Unclassified 10.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001322 3300002773 Bacteria 11005
2 JGI25150J39212_1006748 3300002774 Bacteria 2346
3 JGI25153J46596_10001181 3300003215 Bacteria 15775
4 rootH1_10008575 3300003316 Bacteria 11244
5 rootH1_10008575 3300003323 Bacteria 2599
6 rootH1_10044567 3300003316 Bacteria 2612
7 rootH1_10108074 3300003316 Bacteria 2156
8 rootL2_10006020 3300003322 Bacteria 4706
9 rootL2_10120293 3300003322 Bacteria 1709
10 rootH1_10014994 3300003323 Bacteria 8653
11 Ga0055526_1001607 3300003771 Bacteria 15868
12 Ga0055531_10000108 3300003794 Bacteria 90059
13 Ga0070682_100011327 3300005337 Bacteria 5094
14 Ga0070671_100229020 3300005355 Bacteria 1577
15 Ga0070708_100336032 3300005445 Bacteria 1423
16 Ga0068867_100000039 3300005459 Bacteria 80301
17 Ga0068867_100645361 3300005459 Bacteria 928
18 Ga0068867_100955999 3300005459 Unclassified 774
19 Ga0070706_100001547 3300005467 Bacteria 24043
20 Ga0070707_100845602 3300005468 Bacteria 879
21 Ga0070698_100303000 3300005471 Bacteria 1529
22 Ga0070699_101227026 3300005518 Bacteria 688
23 Ga0070665_100002946 3300005548 Bacteria 18394
24 Ga0068855_100226307 3300005563 Bacteria 2096
25 Ga0068856_100095750 3300005614 Bacteria 2957
26 Ga0068856_100108649 3300005614 Bacteria 2770
27 Ga0068852_100009141 3300005616 Bacteria 7341
28 Ga0068866_10505485 3300005718 Unclassified 800
29 Ga0068863_100038779 3300005841 Bacteria 4532
30 Ga0068860_100657836 3300005843 Bacteria 1056
31 Ga0075364_10079230 3300006051 Bacteria 2170
32 Ga0075362_10031619 3300006177 Bacteria 2291
33 Ga0075367_10001980 3300006178 Bacteria 9118
34 Ga0075367_10018773 3300006178 Bacteria 3821
35 Ga0075367_10037452 3300006178 Bacteria 2819
36 Ga0075369_10000791 3300006186 Bacteria 10346
37 Ga0075369_10048938 3300006186 Bacteria 1825
38 Ga0075366_10001479 3300006195 Bacteria 11712
39 Ga0075366_10008019 3300006195 Bacteria 5852
40 Ga0075366_10017652 3300006195 Bacteria 4110
41 Ga0075366_10024373 3300006195 Bacteria 3529
42 Ga0075366_10029275 3300006195 Bacteria 3235
43 Ga0075366_10042460 3300006195 Bacteria 2692
44 Ga0075366_10086829 3300006195 Bacteria 1872
45 Ga0075366_10137806 3300006195 Bacteria 1474
46 Ga0075366_10278328 3300006195 Bacteria 1022
47 Ga0075370_10004481 3300006353 Bacteria 6788
48 Ga0075370_10015745 3300006353 Bacteria 4056
49 Ga0075370_10018730 3300006353 Bacteria 3759
50 Ga0075370_10021022 3300006353 Bacteria 3573
51 Ga0075370_10030009 3300006353 Bacteria 3032
52 Ga0075370_10031234 3300006353 Bacteria 2973
53 Ga0075370_10084371 3300006353 Bacteria 1828
54 Ga0075370_10202096 3300006353 Bacteria 1172
55 Ga0105245_10150107 3300009098 Bacteria 2203
56 Ga0105243_10006397 3300009148 Bacteria 9101
57 Ga0105248_10094898 3300009177 Bacteria 3358
58 Ga0105237_10048991 3300009545 Bacteria 4247
59 Ga0105238_10010770 3300009551 Bacteria 9186
60 Ga0105239_10161337 3300010375 Bacteria 2504
61 Ga0157372_10208624 3300013307 Bacteria 2264
62 Ga0157377_10000044 3300014745 Bacteria 100420
63 Ga0157379_10109860 3300014968 Bacteria 2476
64 Ga0209050_1016239 3300025298 Bacteria 3061
65 Ga0209051_1090502 3300025303 Bacteria 853
66 Ga0209257_1000033 3300025304 Bacteria 671006
67 Ga0207684_10003302 3300025910 Bacteria 15830
68 Ga0207671_10035289 3300025914 Bacteria 3712
69 Ga0207694_10392737 3300025924 Bacteria 1153
70 Ga0207709_10004230 3300025935 Bacteria 8321
71 Ga0207709_10008440 3300025935 Bacteria 5697
72 Ga0207711_10814268 3300025941 Bacteria 870
73 Ga0207667_10186401 3300025949 Bacteria 2130
74 Ga0207702_10082524 3300026078 Bacteria 2795
75 Ga0207702_10095375 3300026078 Bacteria 2614
76 Ga0207648_10000109 3300026089 Bacteria 80648
77 Ga0207698_10005546 3300026142 Bacteria 7807
78 Ga0209813_10001784 3300027866 Bacteria 4849
79 Ga0209813_10016808 3300027866 Bacteria 2001
80 Ga0268266_10005139 3300028379 Bacteria 12327
81 Ga0268264_10676983 3300028381 Bacteria 1023
82 Ga0307517_10043005 3300028786 Bacteria 4825
83 Ga0307515_10018168 3300028794 Bacteria 12755
84 Ga0307515_10022245 3300028794 Bacteria 11182
85 Ga0307515_10030011 3300028794 Bacteria 9160
86 Ga0307515_10081597 3300028794 Bacteria 4198
87 Ga0307515_10261098 3300028794 Bacteria 1468
88 Ga0307512_10370585 3300030522 Bacteria 618
89 Ga0265332_10000027 3300031238 Bacteria 190796
90 Ga0265328_10043513 3300031239 Bacteria 1652
91 Ga0265316_10000005 3300031344 Bacteria 304442
92 Ga0307408_100000023 3300031548 Bacteria 295931
93 Ga0307516_10000237 3300031730 Bacteria 70929
94 Ga0307516_10000476 3300031730 Bacteria 53151
95 Ga0307516_10437283 3300031730 Bacteria 965
96 Ga0307414_10177389 3300032004 Bacteria 1710
97 Ga0307411_10029408 3300032005 Bacteria 3354
98 Ga0373939_0000110 3300035114 Bacteria 25000
99 Ga0373931_0000092 3300035691 Bacteria 41580
100 Ga0395905_0000027 3300037471 Bacteria 297239
101 Ga0395905_0000151 3300037471 Bacteria 115485
102 Ga0395905_0003411 3300037471 Bacteria 17002
103 Ga0395905_0018805 3300037471 Bacteria 6553
104 Ga0395905_0023903 3300037471 Bacteria 5769
105 Ga0395905_0036751 3300037471 Bacteria 4601
106 Ga0439461_0038744 3300041410 Bacteria 1022
107 Ga0451798_0924843 3300041458 Unclassified 645
108 Ga0451800_0783843 3300041459 Bacteria 718
109 Ga0451807_0469672 3300041486 Bacteria 1048
110 Ga0451807_0923753 3300041486 Bacteria 1719
111 Ga0451853_2591822 3300041512 Unclassified 2328
112 Ga0439437_005100 3300042000 Bacteria 1441
113 Ga0439455_0057120 3300042012 Bacteria 1029
114 Ga0450888_000030 3300042126 Bacteria 9886
115 Ga0450890_000900 3300042127 Bacteria 4307
116 Ga0450891_000900 3300042129 Bacteria 3113
117 Ga0450892_000688 3300042130 Bacteria 3810
118 Ga0450904_009213 3300042139 Bacteria 972
119 Ga0439458_0128350 3300042157 Bacteria 671
120 Ga0450916_001472 3300042530 Bacteria 2364
121 Ga0450893_0000563 3300042532 Bacteria 5280
122 Ga0450901_003066 3300042533 Bacteria 1756
123 Ga0466969_0000046 3300044656 Bacteria 63999
124 Ga0466972_0003115 3300044658 Bacteria 8230
125 Ga0466966_0282320 3300044684 Bacteria 998
126 Ga0453684_0097441 3300044712 Bacteria 3609
127 Ga0466970_0027758 3300044765 Bacteria 2971
128 Ga0466959_0071524 3300045049 Bacteria 2511
129 Ga0451576_0024819 3300045051 Bacteria 6469
130 Ga0451576_0115715 3300045051 Bacteria 2791
131 Ga0451576_0841103 3300045051 Bacteria 963
132 Ga0495590_0006362 3300046457 Bacteria 4614
133 Ga0495590_0030986 3300046457 Bacteria 1873
134 Ga0495610_0157234 3300046512 Bacteria 964
135 Ga0495620_0231114 3300046515 Bacteria 707
136 Ga0495643_0180791 3300046522 Bacteria 1025
137 Ga0495649_0004870 3300046694 Bacteria 8675
138 Ga0495660_0005497 3300046810 Bacteria 7591
139 Ga0495687_011786 3300047443 Bacteria 4671
140 Ga0501309_002421 3300049129 Bacteria 2006
141 Ga0501310_000503 3300049130 Unclassified 3413
142 Ga0501294_000808 3300049517 Bacteria 3423
143 Ga0501300_002807 3300049523 Bacteria 2604
144 Ga0501301_004065 3300049524 Bacteria 1027
145 Ga0501314_000802 3300049530 Bacteria 2083
146 Ga0501323_007999 3300049539 Bacteria 1219
147 Ga0501043_0000002 3300049579 Bacteria 351081
148 Ga0501046_0000008 3300049580 Bacteria 351167
149 Ga0501047_0000003 3300049581 Bacteria 508375
150 Ga0501048_0001116 3300049582 Bacteria 20152
151 Ga0501206_010722 3300049653 Bacteria 1231
152 Ga0501211_001642 3300049658 Unclassified 2395
153 Ga0501227_001014 3300049665 Bacteria 6226
154 Ga0501235_006360 3300049669 Bacteria 2571
155 Ga0501242_031654 3300049674 Bacteria 719
156 Ga0501252_000620 3300049682 Bacteria 2841
157 Ga0501258_019645 3300049687 Bacteria 786
158 Ga0501221_000641 3300049704 Bacteria 5603
159 Ga0501229_000486 3300049706 Bacteria 4483
160 Ga0501083_0269002 3300049744 Bacteria 1109
161 Ga0501232_001537 3300049757 Bacteria 1858
162 Ga0501264_011805 3300049761 Bacteria 853
163 Ga0501267_000160 3300049764 Bacteria 4483
164 Ga0501269_011133 3300049766 Bacteria 1096
165 Ga0501272_008027 3300049769 Bacteria 1153
166 Ga0501283_007830 3300049779 Bacteria 1530
167 Ga0501045_0018977 3300049824 Bacteria 4897
168 nmdc:mga03683_38376_c1 3300050489 Bacteria 1956
169 nmdc:mga03n38_247499_c1 3300050490 Bacteria 940
170 nmdc:mga03n38_42133_c1 3300050490 Bacteria 1994
171 nmdc:mga03n38_709848_c1 3300050490 Bacteria 580
172 nmdc:mga00v17_570538_c1 3300050491 Bacteria 731
173 nmdc:mga0yw44_288796_c1 3300050492 Bacteria 1097
174 nmdc:mga0yw44_90477_c1 3300050492 Bacteria 1933
175 nmdc:mga0k408_1932_c1 3300050493 Bacteria 11089
176 nmdc:mga0k408_2242_c1 3300050493 Bacteria 10328
177 nmdc:mga0k408_22573_c1 3300050493 Bacteria 3543
178 nmdc:mga0k408_2381_c1 3300050493 Bacteria 10002
179 nmdc:mga0k408_4638_c1 3300050493 Bacteria 7281
180 nmdc:mga0k408_5467_c1 3300050493 Bacteria 6763
181 nmdc:mga0k408_93424_c1 3300050493 Bacteria 1769
182 nmdc:mga0k408_9949_c1 3300050493 Bacteria 5134
183 nmdc:mga06z11_119135_c1 3300050494 Bacteria 1471
184 nmdc:mga06z11_2567_c1 3300050494 Bacteria 6949
185 nmdc:mga06z11_59347_c1 3300050494 Bacteria 1988
186 nmdc:mga04h51_4041_c1 3300050495 Bacteria 3616
187 nmdc:mga04h51_5062_c1 3300050495 Bacteria 3334
188 nmdc:mga07m45_1525_c1 3300050496 Bacteria 10625
189 nmdc:mga07m45_160584_c1 3300050496 Bacteria 1305
190 nmdc:mga07m45_210307_c1 3300050496 Bacteria 1132
191 nmdc:mga07m45_3009_c1 3300050496 Bacteria 8031
192 nmdc:mga07m45_3544_c1 3300050496 Bacteria 7541
193 nmdc:mga07m45_38101_c1 3300050496 Bacteria 2682
194 nmdc:mga07m45_4836_c1 3300050496 Bacteria 6624
195 nmdc:mga07m45_7715_c1 3300050496 Bacteria 5506
196 nmdc:mga0sz30_217329_c1 3300050516 Bacteria 850
197 nmdc:mga0sz30_9476_c1 3300050516 Bacteria 3708
198 Ga0500651_0016745 3300053093 Bacteria 4512
199 Ga0500651_0338492 3300053093 Bacteria 856
200 Ga0500593_001276 3300053117 Bacteria 9103
201 Ga0500597_242922 3300053120 Bacteria 740
202 Ga0500658_0002363 3300053134 Bacteria 7316
203 Ga0500590_002385 3300053148 Bacteria 8302
204 Ga0590071_002628 3300059421 Bacteria 4513
205 Ga0590074_013979 3300059423 Bacteria 1357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041459 Ga0451800_0783843 Ga0451800_0783843_191_652 153
2 3300044658 Ga0466972_0003115 Ga0466972_0003115_1463_2008 158
3 3300005459 Ga0068867_100000039 Ga0068867_10000003939 162
4 3300026089 Ga0207648_10000109 Ga0207648_1000010939 162
5 3300003316 rootH1_10108074 rootH1_101080742 163
6 3300006353 Ga0075370_10031234 Ga0075370_100312342 163
7 3300050496 nmdc:mga07m45_38101_c1 nmdc:mga07m45_38101_c1_943_1482 163
8 3300009545 Ga0105237_10048991 Ga0105237_100489912 164
9 3300009551 Ga0105238_10010770 Ga0105238_100107706 164
10 3300010375 Ga0105239_10161337 Ga0105239_101613372 164
11 3300025914 Ga0207671_10035289 Ga0207671_100352893 164
12 3300025924 Ga0207694_10392737 Ga0207694_103927372 164
13 iso_pu_bacteria 2643221544 2643743092 164
14 iso_pu_bacteria 2643221646 2644260385 164
15 3300059421 Ga0590071_002628 Ga0590071_002628_2783_3307 166
16 3300059423 Ga0590074_013979 Ga0590074_013979_772_1296 166
17 3300003316 rootH1_10008575 rootH1_100085759 168
18 3300003322 rootL2_10006020 rootL2_100060202 168
19 3300005337 Ga0070682_100011327 Ga0070682_1000113272 168
20 3300005355 Ga0070671_100229020 Ga0070671_1002290202 168
21 3300005459 Ga0068867_100645361 Ga0068867_1006453611 168
22 3300005459 Ga0068867_100955999 Ga0068867_1009559991 168
23 3300005614 Ga0068856_100095750 Ga0068856_1000957502 168
24 3300005614 Ga0068856_100108649 Ga0068856_1001086492 168
25 3300005841 Ga0068863_100038779 Ga0068863_1000387792 168
26 3300006195 Ga0075366_10001479 Ga0075366_100014799 168
27 3300006195 Ga0075366_10008019 Ga0075366_100080193 168
28 3300006195 Ga0075366_10042460 Ga0075366_100424601 168
29 3300006195 Ga0075366_10086829 Ga0075366_100868292 168
30 3300006353 Ga0075370_10004481 Ga0075370_100044815 168
31 3300006353 Ga0075370_10021022 Ga0075370_100210223 168
32 3300009098 Ga0105245_10150107 Ga0105245_101501072 168
33 3300014968 Ga0157379_10109860 Ga0157379_101098602 168
34 3300025298 Ga0209050_1016239 Ga0209050_10162392 168
35 3300025304 Ga0209257_1000033 Ga0209257_100003332 168
36 3300025935 Ga0207709_10008440 Ga0207709_100084403 168
37 3300026078 Ga0207702_10082524 Ga0207702_100825242 168
38 3300026078 Ga0207702_10095375 Ga0207702_100953752 168
39 3300028794 Ga0307515_10081597 Ga0307515_100815972 168
40 3300028794 Ga0307515_10261098 Ga0307515_102610982 168
41 3300031548 Ga0307408_100000023 Ga0307408_100000023231 168
42 3300031730 Ga0307516_10000237 Ga0307516_1000023761 168
43 3300032005 Ga0307411_10029408 Ga0307411_100294082 168
44 3300037471 Ga0395905_0000151 Ga0395905_0000151_63790_64329 168
45 3300037471 Ga0395905_0023903 Ga0395905_0023903_1214_1768 168
46 3300041512 Ga0451853_2591822 Ga0451853_2591822_1581_2120 168
47 3300044712 Ga0453684_0097441 Ga0453684_0097441_1660_2199 168
48 3300046457 Ga0495590_0006362 Ga0495590_0006362_3152_3706 168
49 3300050490 nmdc:mga03n38_247499_c1 nmdc:mga03n38_247499_c1_10_582 168
50 3300050493 nmdc:mga0k408_5467_c1 nmdc:mga0k408_5467_c1_521_1060 168
51 3300050496 nmdc:mga07m45_1525_c1 nmdc:mga07m45_1525_c1_4022_4561 168
52 3300053117 Ga0500593_001276 Ga0500593_001276_7541_8083 168
53 3300006195 Ga0075366_10278328 Ga0075366_102783282 170
54 3300031239 Ga0265328_10043513 Ga0265328_100435132 170
55 3300031344 Ga0265316_10000005 Ga0265316_10000005151 170
56 3300046457 Ga0495590_0030986 Ga0495590_0030986_597_1145 170
57 3300046512 Ga0495610_0157234 Ga0495610_0157234_239_787 170
58 3300046515 Ga0495620_0231114 Ga0495620_0231114_21_569 170
59 3300046694 Ga0495649_0004870 Ga0495649_0004870_7521_8069 170
60 3300046810 Ga0495660_0005497 Ga0495660_0005497_2988_3536 170
61 3300047443 Ga0495687_011786 Ga0495687_011786_2920_3468 170
62 3300050493 nmdc:mga0k408_1932_c1 nmdc:mga0k408_1932_c1_2103_2651 170
63 3300050493 nmdc:mga0k408_93424_c1 nmdc:mga0k408_93424_c1_314_862 170
64 3300050496 nmdc:mga07m45_160584_c1 nmdc:mga07m45_160584_c1_186_734 170
65 3300053134 Ga0500658_0002363 Ga0500658_0002363_2268_2816 170
66 iso_pu_bacteria 2643221585 2643932882 170
67 iso_pu_bacteria 2643221656 2644314132 170
68 iso_pu_bacteria 2738541337 2739055954 170
69 3300005616 Ga0068852_100009141 Ga0068852_1000091418 171
70 3300009148 Ga0105243_10006397 Ga0105243_100063974 171
71 3300014745 Ga0157377_10000044 Ga0157377_1000004435 171
72 3300025935 Ga0207709_10004230 Ga0207709_100042303 171
73 3300026142 Ga0207698_10005546 Ga0207698_100055466 171
74 3300031238 Ga0265332_10000027 Ga0265332_10000027127 171
75 3300049579 Ga0501043_0000002 Ga0501043_0000002_251522_252073 171
76 3300049580 Ga0501046_0000008 Ga0501046_0000008_251605_252156 171
77 3300049581 Ga0501047_0000003 Ga0501047_0000003_274787_275338 171
78 3300049582 Ga0501048_0001116 Ga0501048_0001116_14879_15430 171
79 3300049744 Ga0501083_0269002 Ga0501083_0269002_540_1091 171
80 3300049824 Ga0501045_0018977 Ga0501045_0018977_4003_4554 171
81 3300050493 nmdc:mga0k408_9949_c1 nmdc:mga0k408_9949_c1_1217_1768 171
82 3300027866 Ga0209813_10016808 Ga0209813_100168082 174
83 3300050495 nmdc:mga04h51_5062_c1 nmdc:mga04h51_5062_c1_1795_2319 174
84 3300003322 rootL2_10120293 rootL2_101202932 175
85 3300005548 Ga0070665_100002946 Ga0070665_10000294612 175
86 3300005718 Ga0068866_10505485 Ga0068866_105054852 175
87 3300009177 Ga0105248_10094898 Ga0105248_100948982 175
88 3300013307 Ga0157372_10208624 Ga0157372_102086241 175
89 3300025941 Ga0207711_10814268 Ga0207711_108142682 175
90 3300028379 Ga0268266_10005139 Ga0268266_100051395 175
91 3300028786 Ga0307517_10043005 Ga0307517_100430054 175
92 3300030522 Ga0307512_10370585 Ga0307512_103705851 175
93 3300031730 Ga0307516_10000476 Ga0307516_1000047619 175
94 3300031730 Ga0307516_10437283 Ga0307516_104372832 175
95 3300037471 Ga0395905_0000027 Ga0395905_0000027_103040_103567 175
96 3300037471 Ga0395905_0018805 Ga0395905_0018805_781_1308 175
97 3300041410 Ga0439461_0038744 Ga0439461_0038744_55_615 175
98 3300041458 Ga0451798_0924843 Ga0451798_0924843_16_624 175
99 3300041486 Ga0451807_0923753 Ga0451807_0923753_602_1210 175
100 3300042000 Ga0439437_005100 Ga0439437_005100_442_1002 175
101 3300042126 Ga0450888_000030 Ga0450888_000030_2155_2715 175
102 3300042127 Ga0450890_000900 Ga0450890_000900_89_649 175
103 3300042129 Ga0450891_000900 Ga0450891_000900_1709_2269 175
104 3300042130 Ga0450892_000688 Ga0450892_000688_2734_3294 175
105 3300042139 Ga0450904_009213 Ga0450904_009213_58_618 175
106 3300042530 Ga0450916_001472 Ga0450916_001472_348_908 175
107 3300042532 Ga0450893_0000563 Ga0450893_0000563_93_653 175
108 3300042533 Ga0450901_003066 Ga0450901_003066_560_1120 175
109 3300045051 Ga0451576_0024819 Ga0451576_0024819_1466_2026 175
110 3300045051 Ga0451576_0115715 Ga0451576_0115715_1025_1597 175
111 3300049129 Ga0501309_002421 Ga0501309_002421_1234_1794 175
112 3300049130 Ga0501310_000503 Ga0501310_000503_151_711 175
113 3300049517 Ga0501294_000808 Ga0501294_000808_1722_2282 175
114 3300049523 Ga0501300_002807 Ga0501300_002807_1822_2382 175
115 3300049524 Ga0501301_004065 Ga0501301_004065_171_731 175
116 3300049530 Ga0501314_000802 Ga0501314_000802_1314_1874 175
117 3300049539 Ga0501323_007999 Ga0501323_007999_89_649 175
118 3300049653 Ga0501206_010722 Ga0501206_010722_456_1016 175
119 3300049658 Ga0501211_001642 Ga0501211_001642_270_830 175
120 3300049665 Ga0501227_001014 Ga0501227_001014_3479_4039 175
121 3300049669 Ga0501235_006360 Ga0501235_006360_1315_1875 175
122 3300049674 Ga0501242_031654 Ga0501242_031654_136_696 175
123 3300049687 Ga0501258_019645 Ga0501258_019645_26_586 175
124 3300049704 Ga0501221_000641 Ga0501221_000641_1795_2355 175
125 3300049706 Ga0501229_000486 Ga0501229_000486_2480_3040 175
126 3300049757 Ga0501232_001537 Ga0501232_001537_149_709 175
127 3300049761 Ga0501264_011805 Ga0501264_011805_97_657 175
128 3300049764 Ga0501267_000160 Ga0501267_000160_3907_4467 175
129 3300049766 Ga0501269_011133 Ga0501269_011133_457_1017 175
130 3300049769 Ga0501272_008027 Ga0501272_008027_392_952 175
131 3300049779 Ga0501283_007830 Ga0501283_007830_89_649 175
132 3300053120 Ga0500597_242922 Ga0500597_242922_18_572 175
133 3300053148 Ga0500590_002385 Ga0500590_002385_6171_6734 175
134 3300006178 Ga0075367_10037452 Ga0075367_100374523 176
135 3300032004 Ga0307414_10177389 Ga0307414_101773892 176
136 3300044656 Ga0466969_0000046 Ga0466969_0000046_6514_7068 176
137 3300044684 Ga0466966_0282320 Ga0466966_0282320_394_948 176
138 3300044765 Ga0466970_0027758 Ga0466970_0027758_405_959 176
139 3300045049 Ga0466959_0071524 Ga0466959_0071524_51_605 176
140 3300050490 nmdc:mga03n38_709848_c1 nmdc:mga03n38_709848_c1_16_552 176
141 3300050492 nmdc:mga0yw44_288796_c1 nmdc:mga0yw44_288796_c1_459_995 176
142 3300050494 nmdc:mga06z11_59347_c1 nmdc:mga06z11_59347_c1_1322_1858 176
143 3300002773 JGI25152J39213_1001322 JGI25152J39213_10013223 177
144 3300002774 JGI25150J39212_1006748 JGI25150J39212_10067482 177
145 3300003215 JGI25153J46596_10001181 JGI25153J46596_100011814 177
146 3300003316 rootH1_10044567 rootH1_100445674 177
147 3300003323 rootH1_10014994 rootH1_100149943 177
148 3300003771 Ga0055526_1001607 Ga0055526_10016076 177
149 3300003794 Ga0055531_10000108 Ga0055531_1000010832 177
150 3300005445 Ga0070708_100336032 Ga0070708_1003360322 177
151 3300005467 Ga0070706_100001547 Ga0070706_10000154710 177
152 3300005468 Ga0070707_100845602 Ga0070707_1008456021 177
153 3300005471 Ga0070698_100303000 Ga0070698_1003030002 177
154 3300005518 Ga0070699_101227026 Ga0070699_1012270261 177
155 3300005563 Ga0068855_100226307 Ga0068855_1002263072 177
156 3300005843 Ga0068860_100657836 Ga0068860_1006578362 177
157 3300006051 Ga0075364_10079230 Ga0075364_100792303 177
158 3300006177 Ga0075362_10031619 Ga0075362_100316193 177
159 3300006178 Ga0075367_10001980 Ga0075367_100019803 177
160 3300006178 Ga0075367_10018773 Ga0075367_100187733 177
161 3300006186 Ga0075369_10000791 Ga0075369_100007913 177
162 3300006186 Ga0075369_10048938 Ga0075369_100489383 177
163 3300006195 Ga0075366_10017652 Ga0075366_100176523 177
164 3300006195 Ga0075366_10024373 Ga0075366_100243732 177
165 3300006195 Ga0075366_10029275 Ga0075366_100292753 177
166 3300006195 Ga0075366_10137806 Ga0075366_101378062 177
167 3300006353 Ga0075370_10015745 Ga0075370_100157452 177
168 3300006353 Ga0075370_10018730 Ga0075370_100187302 177
169 3300006353 Ga0075370_10030009 Ga0075370_100300092 177
170 3300006353 Ga0075370_10084371 Ga0075370_100843713 177
171 3300006353 Ga0075370_10202096 Ga0075370_102020962 177
172 3300025303 Ga0209051_1090502 Ga0209051_10905022 177
173 3300025910 Ga0207684_10003302 Ga0207684_1000330216 177
174 3300025949 Ga0207667_10186401 Ga0207667_101864012 177
175 3300027866 Ga0209813_10001784 Ga0209813_100017843 177
176 3300028381 Ga0268264_10676983 Ga0268264_106769832 177
177 3300028794 Ga0307515_10018168 Ga0307515_100181682 177
178 3300028794 Ga0307515_10022245 Ga0307515_100222452 177
179 3300028794 Ga0307515_10030011 Ga0307515_100300114 177
180 3300035114 Ga0373939_0000110 Ga0373939_0000110_8543_9136 177
181 3300035691 Ga0373931_0000092 Ga0373931_0000092_9627_10220 177
182 3300037471 Ga0395905_0003411 Ga0395905_0003411_706_1269 177
183 3300037471 Ga0395905_0036751 Ga0395905_0036751_3952_4563 177
184 3300041486 Ga0451807_0469672 Ga0451807_0469672_332_925 177
185 3300042012 Ga0439455_0057120 Ga0439455_0057120_118_684 177
186 3300042157 Ga0439458_0128350 Ga0439458_0128350_43_624 177
187 3300045051 Ga0451576_0841103 Ga0451576_0841103_139_762 177
188 3300046522 Ga0495643_0180791 Ga0495643_0180791_331_906 177
189 3300049682 Ga0501252_000620 Ga0501252_000620_688_1284 177
190 3300050489 nmdc:mga03683_38376_c1 nmdc:mga03683_38376_c1_579_1154 177
191 3300050490 nmdc:mga03n38_42133_c1 nmdc:mga03n38_42133_c1_1182_1757 177
192 3300050491 nmdc:mga00v17_570538_c1 nmdc:mga00v17_570538_c1_50_625 177
193 3300050492 nmdc:mga0yw44_90477_c1 nmdc:mga0yw44_90477_c1_234_809 177
194 3300050493 nmdc:mga0k408_2242_c1 nmdc:mga0k408_2242_c1_8100_8675 177
195 3300050493 nmdc:mga0k408_22573_c1 nmdc:mga0k408_22573_c1_1058_1651 177
196 3300050493 nmdc:mga0k408_2381_c1 nmdc:mga0k408_2381_c1_8768_9343 177
197 3300050493 nmdc:mga0k408_4638_c1 nmdc:mga0k408_4638_c1_3999_4577 177
198 3300050494 nmdc:mga06z11_119135_c1 nmdc:mga06z11_119135_c1_56_634 177
199 3300050494 nmdc:mga06z11_2567_c1 nmdc:mga06z11_2567_c1_2930_3505 177
200 3300050495 nmdc:mga04h51_4041_c1 nmdc:mga04h51_4041_c1_3016_3591 177
201 3300050496 nmdc:mga07m45_210307_c1 nmdc:mga07m45_210307_c1_75_668 177
202 3300050496 nmdc:mga07m45_3009_c1 nmdc:mga07m45_3009_c1_3398_3976 177
203 3300050496 nmdc:mga07m45_3544_c1 nmdc:mga07m45_3544_c1_6400_6993 177
204 3300050496 nmdc:mga07m45_4836_c1 nmdc:mga07m45_4836_c1_271_846 177
205 3300050496 nmdc:mga07m45_7715_c1 nmdc:mga07m45_7715_c1_713_1291 177
206 3300050516 nmdc:mga0sz30_217329_c1 nmdc:mga0sz30_217329_c1_95_670 177
207 3300050516 nmdc:mga0sz30_9476_c1 nmdc:mga0sz30_9476_c1_1772_2347 177
208 3300053093 Ga0500651_0016745 Ga0500651_0016745_1857_2483 177
209 3300053093 Ga0500651_0338492 Ga0500651_0338492_28_585 177
210 iso_pu_bacteria 2904479285 2904482887 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01202

SKI

Shikimate kinase

9

168

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1shk-assembly1.cif.gz_A the three-dimensional structure of shikimate kinase from erwinia chrysanthemi 0.9627 1 168
1shk-assembly2.cif.gz_B the three-dimensional structure of shikimate kinase from erwinia chrysanthemi 0.9457 1 169
1kag-assembly2.cif.gz_B crystal structure of the escherichia coli shikimate kinase i (arok) 0.9448 1 167
2iyz-assembly1.cif.gz_A shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and adp 0.9412 5 168
1u8a-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and adp at 2.15 angstrom resolution 0.938 5 167
ID Description Score Start End Superfamily
2shkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9592 1 169 3.40.50.300
2shkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9357 1 169 3.40.50.300
af_P0A6E1_1_171_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9259 1 169 3.40.50.300
4y0aA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9195 3 174 3.40.50.300
3n2eC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9148 3 173 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1I1FPH3-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9915 2 174 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A7Y9UIG9-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9908 2 177 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A0Q7CG40-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9888 5 174 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A1I4NV85-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9879 23 175 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A520CDB9-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9868 3 177 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423

Feature Viewer

pLDDT pTM Quality
89.93 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map