F320448

General Info

Members Datasets Scaffolds Average Seq Length
210 127 192 342

Family's Representative Sequence

Representative Sequence 3300025931|Ga0207644_10030766|Ga0207644_100307662
Length 386
Sequence MAGKTLSLCLRDILCSIFNESNQIINQINPTTIVMKKILLXXSXXXXTXASVKAATTAVADTGKVGTTADPKDPPLIFSGSVDTYYKYDFSGHANIPTSFASDQNSVSIGMIDLGLKKKVGKAAFVGELAFGPRGQYQSIPNGDGTTANNGNSFHIQNLYVSYDVTDKLNFTAGYMATFIGYEVISPVGNFNYSTSYLFTSGPFQNAGFKATYAFSDKVSLMAGIFNDNWNTYTAQHDVSTFGAQLMIAPVKGWTAYLNVASGPTSGTIFDLTTAYQITDAFKLGLNAADYSTAHGGLGYQGVALYPQVAVSKIVTFGLRGEYFKIKQGDNIKAVTLTSNIKAGALTIIPEVRLDGANVDTFGFTKGDGTPTKSAGQFVIAAVYAF

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541302 Pedobacter sp. CF074 Isolate Unclassified
5 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
6 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
7 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
8 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
9 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
10 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
11 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
12 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
13 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
14 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
15 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
21 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
22 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
111 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
112 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
115 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
116 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
117 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
118 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
119 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
120 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
123 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
124 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
125 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
126 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
127 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.48
Metatranscriptomes 0.95
Isolates 8.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.43
Nodule 0
Rhizoplane 0.48
Rhizosphere 77.14
Stem 0
Stem Tuber 0
Unclassified 10.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002460 3300001979 Bacteria 8390
2 JGI24739J22299_10013939 3300001989 Bacteria 2928
3 JGI24737J22298_10000014 3300001990 Bacteria 50004
4 JGI24737J22298_10001792 3300001990 Bacteria 7692
5 JGI24737J22298_10010944 3300001990 Bacteria 2979
6 JGI24735J21928_10000008 3300002067 Bacteria 319819
7 JGI25162J39368_1000110 3300002737 Bacteria 89871
8 JGI25152J39213_1000292 3300002773 Bacteria 32967
9 JGI25150J39212_1000014 3300002774 Bacteria 170955
10 JGI25151J46595_10000042 3300003187 Bacteria 170955
11 JGI25153J46596_10000009 3300003215 Bacteria 340925
12 rootH2_10001334 3300003320 Bacteria 238709
13 rootH2_10002127 3300003320 Bacteria 66384
14 rootH2_10064485 3300003320 Bacteria 6031
15 rootH1_10145779 3300003323 Bacteria 2738
16 Ga0055536_1000019 3300003781 Bacteria 203087
17 Ga0055530_10011852 3300003791 Bacteria 3091
18 Ga0065714_10065813 3300005288 Bacteria 8417
19 Ga0065714_10070949 3300005288 Bacteria 3719
20 Ga0070658_10077249 3300005327 Bacteria 2731
21 Ga0068868_100003844 3300005338 Bacteria 10487
22 Ga0070660_100009437 3300005339 Bacteria 6862
23 Ga0070671_100001929 3300005355 Bacteria 15895
24 Ga0070659_100000578 3300005366 Bacteria 26773
25 Ga0070659_100041711 3300005366 Bacteria 3588
26 Ga0070662_100000011 3300005457 Bacteria 133652
27 Ga0068853_100002150 3300005539 Bacteria 14673
28 Ga0068855_100027462 3300005563 Bacteria 6808
29 Ga0068855_100068685 3300005563 Bacteria 4125
30 Ga0068855_100187849 3300005563 Bacteria 2333
31 Ga0068855_100232236 3300005563 Bacteria 2065
32 Ga0068856_100239221 3300005614 Bacteria 1831
33 Ga0068852_100220306 3300005616 Bacteria 1804
34 Ga0068858_100100771 3300005842 Bacteria 2693
35 Ga0075366_10003988 3300006195 Bacteria 7884
36 Ga0075366_10010177 3300006195 Bacteria 5276
37 Ga0105240_10012904 3300009093 Bacteria 11507
38 Ga0105240_10049535 3300009093 Bacteria 5301
39 Ga0105240_10140321 3300009093 Bacteria 2890
40 Ga0105240_10153658 3300009093 Bacteria 2739
41 Ga0105241_10022200 3300009174 Bacteria 4699
42 Ga0105242_10355660 3300009176 Bacteria 1354
43 Ga0105248_10288533 3300009177 Bacteria 1848
44 Ga0105237_10000411 3300009545 Bacteria 60960
45 Ga0105237_10021023 3300009545 Bacteria 6716
46 Ga0105237_10054550 3300009545 Bacteria 4005
47 Ga0105237_10107187 3300009545 Bacteria 2786
48 Ga0105237_10442881 3300009545 Bacteria 1305
49 Ga0105239_10003910 3300010375 Bacteria 18055
50 Ga0105239_10009216 3300010375 Bacteria 11163
51 Ga0105239_10077253 3300010375 Bacteria 3664
52 Ga0105239_10128289 3300010375 Bacteria 2820
53 Ga0105239_10128714 3300010375 Bacteria 2815
54 Ga0105239_10137259 3300010375 Bacteria 2723
55 Ga0157373_10012274 3300013100 Bacteria 6298
56 Ga0157373_10051370 3300013100 Bacteria 2937
57 Ga0157371_10000527 3300013102 Bacteria 45686
58 Ga0157371_10009884 3300013102 Bacteria 7470
59 Ga0157370_10000285 3300013104 Bacteria 64200
60 Ga0157370_10029968 3300013104 Bacteria 5333
61 Ga0157370_10040658 3300013104 Bacteria 4489
62 Ga0157370_10057381 3300013104 Bacteria 3702
63 Ga0157370_10093374 3300013104 Bacteria 2824
64 Ga0157370_10099312 3300013104 Bacteria 2728
65 Ga0157370_10156710 3300013104 Unclassified 2119
66 Ga0157370_10190052 3300013104 Bacteria 1906
67 Ga0157370_10285609 3300013104 Bacteria 1524
68 Ga0157369_10000897 3300013105 Bacteria 37997
69 Ga0157369_10020600 3300013105 Bacteria 7373
70 Ga0157369_10069938 3300013105 Bacteria 3771
71 Ga0157369_10308768 3300013105 Bacteria 1645
72 Ga0157378_10273164 3300013297 Unclassified 1626
73 Ga0163162_10000024 3300013306 Bacteria 188515
74 Ga0163162_10103395 3300013306 Bacteria 2943
75 Ga0163162_10141790 3300013306 Bacteria 2517
76 Ga0163162_10171003 3300013306 Bacteria 2298
77 Ga0157372_10000118 3300013307 Bacteria 84096
78 Ga0157372_10011013 3300013307 Bacteria 9625
79 Ga0157375_10095213 3300013308 Bacteria 3048
80 Ga0157375_10197197 3300013308 Bacteria 2168
81 Ga0157375_10418753 3300013308 Bacteria 1506
82 Ga0163163_10486332 3300014325 Bacteria 1296
83 Ga0182008_10000078 3300014497 Bacteria 77087
84 Ga0182008_10001962 3300014497 Bacteria 13209
85 Ga0182006_1000297 3300015261 Bacteria 43680
86 Ga0182007_10000002 3300015262 Bacteria 564661
87 Ga0182007_10003829 3300015262 Bacteria 7000
88 Ga0182007_10011075 3300015262 Bacteria 3526
89 Ga0183373_1004 3300015682 Bacteria 537398
90 Ga0163161_10003475 3300017792 Bacteria 11043
91 Ga0163161_10009430 3300017792 Bacteria 6754
92 Ga0163161_10009767 3300017792 Bacteria 6651
93 Ga0163161_10013474 3300017792 Bacteria 5692
94 Ga0163161_10042224 3300017792 Bacteria 3279
95 Ga0206351_10985716 3300020077 Bacteria 2600
96 Ga0206350_10138342 3300020080 Bacteria 1833
97 Ga0209437_100077 3300025233 Bacteria 286656
98 Ga0207425_1000023 3300025245 Bacteria 341339
99 Ga0209026_1001207 3300025250 Bacteria 11966
100 Ga0209026_1004773 3300025250 Bacteria 3884
101 Ga0209129_1000032 3300025258 Bacteria 341150
102 Ga0209676_1000009 3300025292 Bacteria 981719
103 Ga0209025_1000047 3300025294 Bacteria 341150
104 Ga0209758_1000145 3300025297 Bacteria 170553
105 Ga0209050_1000094 3300025298 Bacteria 242893
106 Ga0207647_10000543 3300025904 Bacteria 30114
107 Ga0207705_10000108 3300025909 Bacteria 93501
108 Ga0207705_10000916 3300025909 Bacteria 24137
109 Ga0207695_10043778 3300025913 Bacteria 4767
110 Ga0207671_10001816 3300025914 Bacteria 23813
111 Ga0207671_10002127 3300025914 Bacteria 21616
112 Ga0207671_10003999 3300025914 Bacteria 14330
113 Ga0207671_10008018 3300025914 Bacteria 9038
114 Ga0207671_10009786 3300025914 Bacteria 7977
115 Ga0207671_10015758 3300025914 Bacteria 5903
116 Ga0207644_10030766 3300025931 Bacteria 3736
117 Ga0207690_10002593 3300025932 Bacteria 10912
118 Ga0207690_10019605 3300025932 Bacteria 4169
119 Ga0207690_10113315 3300025932 Bacteria 1957
120 Ga0207706_10000246 3300025933 Bacteria 59254
121 Ga0207704_10000011 3300025938 Bacteria 180140
122 Ga0207667_10011579 3300025949 Bacteria 10242
123 Ga0207667_10038565 3300025949 Bacteria 5101
124 Ga0207667_10083603 3300025949 Bacteria 3305
125 Ga0207667_10367518 3300025949 Bacteria 1466
126 Ga0207640_10023086 3300025981 Bacteria 3735
127 Ga0207677_10062395 3300026023 Bacteria 2585
128 Ga0207703_10076557 3300026035 Bacteria 2776
129 Ga0207639_10031064 3300026041 Bacteria 3923
130 Ga0207702_10164815 3300026078 Bacteria 2027
131 Ga0268266_10000380 3300028379 Bacteria 67791
132 Ga0307515_10000172 3300028794 Bacteria 159265
133 Ga0307515_10001710 3300028794 Bacteria 48899
134 Ga0307515_10007640 3300028794 Bacteria 21325
135 Ga0307515_10107926 3300028794 Bacteria 3285
136 Ga0307515_10219407 3300028794 Bacteria 1724
137 Ga0307408_100001899 3300031548 Bacteria 15198
138 Ga0307408_100001976 3300031548 Bacteria 14793
139 Ga0307413_10094162 3300031824 Bacteria 1960
140 Ga0307412_10000698 3300031911 Bacteria 19359
141 Ga0307414_10015327 3300032004 Bacteria 4627
142 Ga0307414_10118115 3300032004 Bacteria 2033
143 Ga0307510_10002780 3300033180 Bacteria 20056
144 Ga0307510_10088304 3300033180 Bacteria 2960
145 Ga0395899_0000926 3300037312 Bacteria 27634
146 Ga0395900_0000014 3300037418 Bacteria 386513
147 Ga0395900_0000557 3300037418 Bacteria 51834
148 Ga0395898_0006998 3300037466 Bacteria 11986
149 Ga0395905_0000241 3300037471 Bacteria 82847
150 Ga0395905_0000303 3300037471 Bacteria 71615
151 Ga0395901_0000446 3300038443 Bacteria 48079
152 Ga0395901_0000582 3300038443 Bacteria 42425
153 Ga0395901_0047267 3300038443 Bacteria 4469
154 Ga0436361_1100175 3300039447 Bacteria 5051
155 Ga0495650_0021786 3300046471 Bacteria 3085
156 Ga0495605_0117257 3300046474 Bacteria 1210
157 Ga0495585_0000767 3300046492 Bacteria 28423
158 Ga0495606_0156957 3300046507 Unclassified 1330
159 Ga0495616_0010864 3300046513 Bacteria 5244
160 Ga0495631_0003938 3300046518 Bacteria 8024
161 Ga0495632_0046040 3300046519 Bacteria 2170
162 Ga0495648_0004548 3300046524 Bacteria 11816
163 Ga0495648_0029991 3300046524 Bacteria 3603
164 Ga0495633_0000161 3300046558 Bacteria 87685
165 Ga0495633_0080114 3300046558 Bacteria 1520
166 Ga0495668_0000041 3300046616 Bacteria 229462
167 Ga0495625_0000586 3300046660 Bacteria 52844
168 Ga0495625_0002085 3300046660 Bacteria 22344
169 Ga0495625_0005888 3300046660 Bacteria 11039
170 Ga0495625_0007171 3300046660 Bacteria 9779
171 Ga0495625_0016289 3300046660 Bacteria 5854
172 Ga0495661_0044274 3300046665 Unclassified 2730
173 Ga0495671_0133592 3300046692 Bacteria 1210
174 Ga0495687_002833 3300047443 Bacteria 13355
175 Ga0495687_058071 3300047443 Bacteria 1606
176 Ga0495686_0000196 3300047472 Bacteria 112875
177 Ga0495686_0065058 3300047472 Bacteria 2255
178 Ga0495614_0009626 3300048089 Bacteria 4271
179 Ga0496122_0001975 3300048925 Bacteria 30642
180 Ga0496123_0013583 3300048926 Bacteria 6819
181 Ga0495678_004793 3300049459 Bacteria 7698
182 Ga0495682_0092029 3300049460 Bacteria 1089
183 Ga0501238_021492 3300049671 Bacteria 914
184 Ga0501249_000025 3300049679 Bacteria 91259
185 nmdc:mga0k408_3988_c1 3300050493 Bacteria 7827
186 nmdc:mga0k408_433_c2 3300050493 Bacteria 5846
187 Ga0500635_0014614 3300053080 Bacteria 2304
188 Ga0500647_0096238 3300053091 Bacteria 1416
189 Ga0500594_0001373 3300053118 Bacteria 5285
190 Ga0500608_000548 3300053122 Bacteria 14063
191 Ga0500608_044169 3300053122 Bacteria 2139
192 Ga0500622_0001353 3300053156 Bacteria 19841

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049671 Ga0501238_021492 Ga0501238_021492_29_874 280
2 3300046692 Ga0495671_0133592 Ga0495671_0133592_37_882 281
3 3300013104 Ga0157370_10156710 Ga0157370_101567102 293
4 3300013297 Ga0157378_10273164 Ga0157378_102731641 298
5 3300046507 Ga0495606_0156957 Ga0495606_0156957_264_1301 299
6 3300002737 JGI25162J39368_1000110 JGI25162J39368_10001103 301
7 3300010375 Ga0105239_10003910 Ga0105239_100039102 301
8 3300025233 Ga0209437_100077 Ga0209437_10007765 301
9 3300005616 Ga0068852_100220306 Ga0068852_1002203062 302
10 3300010375 Ga0105239_10128289 Ga0105239_101282893 302
11 3300013306 Ga0163162_10171003 Ga0163162_101710032 302
12 3300017792 Ga0163161_10009430 Ga0163161_100094303 302
13 3300025914 Ga0207671_10008018 Ga0207671_100080185 302
14 3300053118 Ga0500594_0001373 Ga0500594_0001373_918_1982 302
15 3300005563 Ga0068855_100187849 Ga0068855_1001878492 304
16 3300025949 Ga0207667_10367518 Ga0207667_103675182 304
17 3300033180 Ga0307510_10088304 Ga0307510_100883043 304
18 3300005288 Ga0065714_10065813 Ga0065714_100658137 308
19 3300025250 Ga0209026_1001207 Ga0209026_10012078 310
20 3300031824 Ga0307413_10094162 Ga0307413_100941622 310
21 3300017792 Ga0163161_10009767 Ga0163161_100097672 311
22 3300032004 Ga0307414_10118115 Ga0307414_101181151 311
23 3300049679 Ga0501249_000025 Ga0501249_000025_64004_65062 311
24 3300013104 Ga0157370_10190052 Ga0157370_101900523 312
25 3300013104 Ga0157370_10029968 Ga0157370_100299684 313
26 3300002773 JGI25152J39213_1000292 JGI25152J39213_100029228 314
27 3300002774 JGI25150J39212_1000014 JGI25150J39212_100001428 314
28 3300003187 JGI25151J46595_10000042 JGI25151J46595_1000004228 314
29 3300003215 JGI25153J46596_10000009 JGI25153J46596_1000000928 314
30 3300025245 Ga0207425_1000023 Ga0207425_100002327 314
31 3300025258 Ga0209129_1000032 Ga0209129_1000032246 314
32 3300025294 Ga0209025_1000047 Ga0209025_1000047246 314
33 3300025297 Ga0209758_1000145 Ga0209758_100014527 314
34 3300014325 Ga0163163_10486332 Ga0163163_104863322 315
35 3300003320 rootH2_10002127 rootH2_1000212730 317
36 3300009093 Ga0105240_10012904 Ga0105240_100129043 317
37 3300049460 Ga0495682_0092029 Ga0495682_0092029_32_1030 317
38 3300014497 Ga0182008_10001962 Ga0182008_1000196210 318
39 3300047472 Ga0495686_0065058 Ga0495686_0065058_1048_2082 318
40 3300015682 Ga0183373_1004 Ga0183373_1004444 322
41 3300039447 Ga0436361_1100175 Ga0436361_1100175_3647_4714 322
42 3300046518 Ga0495631_0003938 Ga0495631_0003938_2494_3561 323
43 3300005288 Ga0065714_10070949 Ga0065714_100709491 324
44 3300005327 Ga0070658_10077249 Ga0070658_100772492 325
45 3300020077 Ga0206351_10985716 Ga0206351_109857162 325
46 3300020080 Ga0206350_10138342 Ga0206350_101383421 325
47 3300003320 rootH2_10064485 rootH2_100644852 326
48 3300005338 Ga0068868_100003844 Ga0068868_10000384410 327
49 3300013104 Ga0157370_10285609 Ga0157370_102856092 327
50 3300026023 Ga0207677_10062395 Ga0207677_100623953 327
51 3300031548 Ga0307408_100001899 Ga0307408_1000018996 327
52 3300031911 Ga0307412_10000698 Ga0307412_100006983 327
53 iso_pu_bacteria 2857627736 2857629258 327
54 iso_pu_bacteria 2738541302 2738856122 328
55 3300046660 Ga0495625_0005888 Ga0495625_0005888_161_1150 329
56 iso_pu_bacteria 8056440228 8056440229 329
57 3300009545 Ga0105237_10054550 Ga0105237_100545504 330
58 3300025914 Ga0207671_10001816 Ga0207671_100018162 330
59 iso_pu_bacteria 2919683626 2919686237 330
60 3300046474 Ga0495605_0117257 Ga0495605_0117257_150_1199 331
61 3300046665 Ga0495661_0044274 Ga0495661_0044274_237_1262 331
62 iso_pu_bacteria 2513020052 2513232308 331
63 iso_pu_bacteria 2738541283 2738755266 331
64 iso_pu_bacteria 2852623160 2852623396 331
65 iso_pu_bacteria 2884933994 2884937727 331
66 3300003781 Ga0055536_1000019 Ga0055536_1000019158 332
67 3300003791 Ga0055530_10011852 Ga0055530_100118524 332
68 3300013100 Ga0157373_10051370 Ga0157373_100513702 332
69 3300013104 Ga0157370_10093374 Ga0157370_100933744 332
70 3300013105 Ga0157369_10000897 Ga0157369_1000089728 332
71 3300015262 Ga0182007_10000002 Ga0182007_1000000228 332
72 3300017792 Ga0163161_10003475 Ga0163161_100034753 332
73 3300025292 Ga0209676_1000009 Ga0209676_100000928 332
74 3300025298 Ga0209050_1000094 Ga0209050_100009428 332
75 3300025909 Ga0207705_10000108 Ga0207705_100001083 332
76 3300009545 Ga0105237_10000411 Ga0105237_1000041131 333
77 3300013104 Ga0157370_10000285 Ga0157370_1000028512 333
78 3300014497 Ga0182008_10000078 Ga0182008_1000007813 333
79 3300015261 Ga0182006_1000297 Ga0182006_100029726 333
80 3300015262 Ga0182007_10003829 Ga0182007_100038294 333
81 3300015262 Ga0182007_10011075 Ga0182007_100110752 333
82 3300017792 Ga0163161_10013474 Ga0163161_100134746 333
83 3300025914 Ga0207671_10015758 Ga0207671_100157583 333
84 3300028794 Ga0307515_10000172 Ga0307515_1000017212 333
85 3300032004 Ga0307414_10015327 Ga0307414_100153272 333
86 3300046558 Ga0495633_0000161 Ga0495633_0000161_78255_79304 333
87 3300048925 Ga0496122_0001975 Ga0496122_0001975_26872_27912 333
88 3300048926 Ga0496123_0013583 Ga0496123_0013583_4769_5809 333
89 3300003323 rootH1_10145779 rootH1_101457792 334
90 3300005355 Ga0070671_100001929 Ga0070671_1000019292 334
91 3300005457 Ga0070662_100000011 Ga0070662_10000001144 334
92 3300005563 Ga0068855_100068685 Ga0068855_1000686854 334
93 3300009093 Ga0105240_10049535 Ga0105240_100495352 334
94 3300009093 Ga0105240_10140321 Ga0105240_101403212 334
95 3300009174 Ga0105241_10022200 Ga0105241_100222002 334
96 3300009176 Ga0105242_10355660 Ga0105242_103556601 334
97 3300010375 Ga0105239_10128714 Ga0105239_101287143 334
98 3300013105 Ga0157369_10308768 Ga0157369_103087682 334
99 3300013308 Ga0157375_10095213 Ga0157375_100952133 334
100 3300013308 Ga0157375_10418753 Ga0157375_104187532 334
101 3300025913 Ga0207695_10043778 Ga0207695_100437782 334
102 3300025931 Ga0207644_10030766 Ga0207644_100307662 334
103 3300025949 Ga0207667_10011579 Ga0207667_100115794 334
104 3300037312 Ga0395899_0000926 Ga0395899_0000926_19736_20797 334
105 3300037418 Ga0395900_0000014 Ga0395900_0000014_263645_264706 334
106 3300037471 Ga0395905_0000241 Ga0395905_0000241_1954_3015 334
107 3300038443 Ga0395901_0000582 Ga0395901_0000582_334_1395 334
108 3300046558 Ga0495633_0080114 Ga0495633_0080114_410_1444 334
109 3300047443 Ga0495687_002833 Ga0495687_002833_2292_3353 334
110 3300048089 Ga0495614_0009626 Ga0495614_0009626_2831_3880 334
111 3300053080 Ga0500635_0014614 Ga0500635_0014614_207_1211 334
112 iso_pu_bacteria 2919186247 2919190212 334
113 iso_pu_bacteria 2939664404 2939668493 334
114 3300025909 Ga0207705_10000916 Ga0207705_100009162 335
115 3300025949 Ga0207667_10038565 Ga0207667_100385654 335
116 3300031548 Ga0307408_100001976 Ga0307408_1000019768 335
117 3300001990 JGI24737J22298_10001792 JGI24737J22298_100017923 336
118 3300005366 Ga0070659_100041711 Ga0070659_1000417112 336
119 3300010375 Ga0105239_10137259 Ga0105239_101372593 336
120 3300013100 Ga0157373_10012274 Ga0157373_100122741 336
121 3300013102 Ga0157371_10000527 Ga0157371_1000052713 336
122 3300013104 Ga0157370_10040658 Ga0157370_100406583 336
123 3300013105 Ga0157369_10069938 Ga0157369_100699382 336
124 3300013307 Ga0157372_10000118 Ga0157372_100001187 336
125 3300025904 Ga0207647_10000543 Ga0207647_100005439 336
126 3300025932 Ga0207690_10019605 Ga0207690_100196053 336
127 3300038443 Ga0395901_0047267 Ga0395901_0047267_569_1579 336
128 3300003320 rootH2_10001334 rootH2_100013349 337
129 3300005539 Ga0068853_100002150 Ga0068853_1000021505 337
130 3300005614 Ga0068856_100239221 Ga0068856_1002392212 337
131 3300009177 Ga0105248_10288533 Ga0105248_102885332 337
132 3300010375 Ga0105239_10077253 Ga0105239_100772533 337
133 3300013306 Ga0163162_10000024 Ga0163162_10000024120 337
134 3300013308 Ga0157375_10197197 Ga0157375_101971972 337
135 3300025914 Ga0207671_10009786 Ga0207671_100097866 337
136 3300025938 Ga0207704_10000011 Ga0207704_10000011122 337
137 3300026041 Ga0207639_10031064 Ga0207639_100310642 337
138 3300026078 Ga0207702_10164815 Ga0207702_101648152 337
139 3300028379 Ga0268266_10000380 Ga0268266_1000038056 337
140 3300028794 Ga0307515_10219407 Ga0307515_102194071 337
141 3300033180 Ga0307510_10002780 Ga0307510_100027809 337
142 3300037418 Ga0395900_0000557 Ga0395900_0000557_24991_26058 337
143 3300037466 Ga0395898_0006998 Ga0395898_0006998_6314_7381 337
144 3300037471 Ga0395905_0000303 Ga0395905_0000303_20070_21137 337
145 3300038443 Ga0395901_0000446 Ga0395901_0000446_26943_28010 337
146 3300046471 Ga0495650_0021786 Ga0495650_0021786_16_1032 337
147 3300046519 Ga0495632_0046040 Ga0495632_0046040_466_1533 337
148 3300053122 Ga0500608_000548 Ga0500608_000548_10323_11390 337
149 3300009545 Ga0105237_10442881 Ga0105237_104428812 338
150 3300013105 Ga0157369_10020600 Ga0157369_100206003 338
151 3300013307 Ga0157372_10011013 Ga0157372_100110133 338
152 3300001990 JGI24737J22298_10010944 JGI24737J22298_100109443 339
153 3300005563 Ga0068855_100232236 Ga0068855_1002322362 339
154 3300005842 Ga0068858_100100771 Ga0068858_1001007713 339
155 3300025932 Ga0207690_10113315 Ga0207690_101133152 339
156 3300025933 Ga0207706_10000246 Ga0207706_1000024612 339
157 3300026035 Ga0207703_10076557 Ga0207703_100765573 339
158 iso_pu_bacteria 2977232053 2977235953 339
159 3300006195 Ga0075366_10003988 Ga0075366_100039882 340
160 3300013306 Ga0163162_10141790 Ga0163162_101417902 340
161 3300050493 nmdc:mga0k408_3988_c1 nmdc:mga0k408_3988_c1_4994_6046 340
162 iso_pu_bacteria 2919437846 2919438509 340
163 iso_pu_bacteria 2919437846 2919442957 340
164 3300025250 Ga0209026_1004773 Ga0209026_10047734 341
165 iso_pu_bacteria 2977232053 2977232541 341
166 3300013104 Ga0157370_10057381 Ga0157370_100573812 342
167 3300028794 Ga0307515_10107926 Ga0307515_101079262 344
168 3300053156 Ga0500622_0001353 Ga0500622_0001353_6553_7593 344
169 iso_pu_bacteria 2599185184 2599480170 344
170 iso_pu_bacteria 2928078545 2928083613 344
171 iso_pu_bacteria 2928147474 2928151126 344
172 iso_pu_bacteria 2932082852 2932084424 344
173 3300005339 Ga0070660_100009437 Ga0070660_1000094374 345
174 3300005366 Ga0070659_100000578 Ga0070659_1000005785 345
175 3300009093 Ga0105240_10153658 Ga0105240_101536583 345
176 3300009545 Ga0105237_10021023 Ga0105237_100210233 345
177 3300009545 Ga0105237_10107187 Ga0105237_101071873 345
178 3300010375 Ga0105239_10009216 Ga0105239_100092169 345
179 3300013306 Ga0163162_10103395 Ga0163162_101033953 345
180 3300017792 Ga0163161_10042224 Ga0163161_100422242 345
181 3300025914 Ga0207671_10002127 Ga0207671_1000212713 345
182 3300025914 Ga0207671_10003999 Ga0207671_100039993 345
183 3300025932 Ga0207690_10002593 Ga0207690_100025935 345
184 3300025981 Ga0207640_10023086 Ga0207640_100230861 345
185 3300046660 Ga0495625_0007171 Ga0495625_0007171_2065_3102 345
186 3300047443 Ga0495687_058071 Ga0495687_058071_430_1521 345
187 3300006195 Ga0075366_10010177 Ga0075366_100101772 346
188 3300028794 Ga0307515_10007640 Ga0307515_100076401 346
189 3300046660 Ga0495625_0000586 Ga0495625_0000586_12712_13764 346
190 3300047472 Ga0495686_0000196 Ga0495686_0000196_786_1832 346
191 3300050493 nmdc:mga0k408_433_c2 nmdc:mga0k408_433_c2_2837_3889 346
192 3300053122 Ga0500608_044169 Ga0500608_044169_590_1642 346
193 3300046513 Ga0495616_0010864 Ga0495616_0010864_562_1611 347
194 3300046524 Ga0495648_0029991 Ga0495648_0029991_2433_3482 347
195 3300046660 Ga0495625_0016289 Ga0495625_0016289_1063_2112 347
196 3300049459 Ga0495678_004793 Ga0495678_004793_5203_6252 347
197 3300001979 JGI24740J21852_10002460 JGI24740J21852_100024605 348
198 3300001989 JGI24739J22299_10013939 JGI24739J22299_100139393 348
199 3300001990 JGI24737J22298_10000014 JGI24737J22298_1000001410 348
200 3300002067 JGI24735J21928_10000008 JGI24735J21928_1000000888 348
201 3300005563 Ga0068855_100027462 Ga0068855_1000274623 348
202 3300013102 Ga0157371_10009884 Ga0157371_100098844 348
203 3300013104 Ga0157370_10099312 Ga0157370_100993122 348
204 3300025949 Ga0207667_10083603 Ga0207667_100836033 348
205 3300028794 Ga0307515_10001710 Ga0307515_1000171010 348
206 3300046492 Ga0495585_0000767 Ga0495585_0000767_20176_21225 348
207 3300046524 Ga0495648_0004548 Ga0495648_0004548_2714_3763 348
208 3300046616 Ga0495668_0000041 Ga0495668_0000041_98558_99607 348
209 3300046660 Ga0495625_0002085 Ga0495625_0002085_13501_14550 348
210 3300053091 Ga0500647_0096238 Ga0500647_0096238_169_1218 348

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07642

BBP2

Putative beta-barrel porin-2, OmpL-like. bbp2

75

386

0.93

PF07396

Porin_O_P

Phosphate-selective porin O and P

84

297

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uu2-assembly1.cif.gz_C salmonella typhi osmoporin(ompc):an outer membrane protein 0.7118 21 348
3uu2-assembly1.cif.gz_C salmonella typhi osmoporin(ompc):an outer membrane protein 0.7096 21 348
7ff7-assembly1.cif.gz_A structure of ompf2 0.7017 24 348
1e54-assembly1.cif.gz_A anion-selective porin from comamonas acidovorans 0.69 31 348
1bt9-assembly1.cif.gz_A ompf porin mutant d74a 0.6865 21 348
ID Description Score Start End Superfamily
3uu2B00 Mainly Beta;Beta Barrel;Porin;Porin 0.7259 21 348 2.40.160.10
3uu2B00 Mainly Beta;Beta Barrel;Porin;Porin 0.7237 21 348 2.40.160.10
1e54A00 Mainly Beta;Beta Barrel;Porin;Porin 0.6912 30 348 2.40.160.10
4gf4A00 Mainly Beta;Beta Barrel;Porin;Carbohydrate-selective porin OprB 0.6735 32 348 2.40.160.180
1e54A00 Mainly Beta;Beta Barrel;Porin;Porin 0.6671 30 348 2.40.160.10
ID Description Score Start End GO Terms
AF-A0A7Y1YD85-F1-model_v4 Porin 0.9233 21 348
AF-A0A2J6H808-F1-model_v4 Porin 0.9186 20 247
AF-A0A4Q6DYI4-F1-model_v4 Porin 0.914 144 348
AF-W6TME4-F1-model_v4 Porin 0.9106 68 348
AF-W6TME4-F1-model_v4 Porin 0.9075 68 348

Feature Viewer

pLDDT pTM Quality
82.79 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map