F320313

General Info

Members Datasets Scaffolds Average Seq Length
210 153 420 322

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10000027|Ga0105248_10000027174
Length 355
Sequence MPHDLFSVNGIVEVMIQEILGDPRMDHVNLGTTGVKVSRLCLGMMTYGSSQWREWVLDEETSKPLIRRAVEAGVNFFDTADIYSLGVSEEITGRALKEFAGSRDNVVIATKVYYPMSDAPNDRGLSRKHIMAAIDRSLKRLGTDYIDLYQIHRFDPQTPIEETVEALSDLVRAGKVLYLGASSMYAWQFLKMLQIQRENGLARFVTMQNHYNLVYREEEREMIPLCMAEGVGLIPWSPLARGFLAGNRKKNEEKQQGETARAKTDAYAHSMYYRDSDFTVVDRLTEIAQARGVKNAQIALAWILSKPGLTAPIIGASKPYQLEDALAALSLQLTSEEIAKLEEPYEPHPVLGHSY

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
84 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
85 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
86 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
93 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
100 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
150 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 0.95
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 5.24
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 1.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10000027 3300009177 Bacteria 255822
2 rootH2_10043728 3300003320 Bacteria 14461
3 JGI25404J52841_10008108 3300003659 Bacteria 2231
4 Ga0065712_10072436 3300005290 Bacteria 4754
5 Ga0065707_10092779 3300005295 Bacteria 3715
6 Ga0070690_100065874 3300005330 Bacteria 2343
7 Ga0070690_100281925 3300005330 Bacteria 1185
8 Ga0070680_100072227 3300005336 Bacteria 2836
9 Ga0070682_100049762 3300005337 Bacteria 2614
10 Ga0070689_100149822 3300005340 Bacteria 1881
11 Ga0070691_10010000 3300005341 Bacteria 4322
12 Ga0070675_100323679 3300005354 Bacteria 1362
13 Ga0070671_100369735 3300005355 Bacteria 1224
14 Ga0070674_100401683 3300005356 Bacteria 1120
15 Ga0070705_100036998 3300005440 Bacteria 2749
16 Ga0070705_100068957 3300005440 Bacteria 2131
17 Ga0070700_100040638 3300005441 Bacteria 2848
18 Ga0070694_100000694 3300005444 Bacteria 18753
19 Ga0070694_100024648 3300005444 Bacteria 3884
20 Ga0070708_100086767 3300005445 Bacteria 2843
21 Ga0070708_100272354 3300005445 Bacteria 1592
22 Ga0070681_10170922 3300005458 Bacteria 2095
23 Ga0070706_100011723 3300005467 Bacteria 8135
24 Ga0070707_100000104 3300005468 Bacteria 77618
25 Ga0070707_100004855 3300005468 Bacteria 12599
26 Ga0070707_100005584 3300005468 Archaea 11751
27 Ga0070707_100239400 3300005468 Unclassified 1766
28 Ga0070698_100043391 3300005471 Bacteria 4611
29 Ga0070698_100505959 3300005471 Bacteria 1146
30 Ga0070699_100109907 3300005518 Bacteria 2420
31 Ga0070697_100021291 3300005536 Archaea 5137
32 Ga0070697_100050376 3300005536 Archaea 3380
33 Ga0070697_100109923 3300005536 Bacteria 2296
34 Ga0068855_100308081 3300005563 Bacteria 1753
35 Ga0068854_100093763 3300005578 Bacteria 2238
36 Ga0068859_100090030 3300005617 Bacteria 3119
37 Ga0068862_100437802 3300005844 Bacteria 1230
38 Ga0081540_1000129 3300005983 Bacteria 80446
39 Ga0070717_10085040 3300006028 Bacteria 2661
40 Ga0075430_100005178 3300006846 Bacteria 10983
41 Ga0075431_100008366 3300006847 Bacteria 10349
42 Ga0075434_100000241 3300006871 Bacteria 38088
43 Ga0075434_100048718 3300006871 Bacteria 4204
44 Ga0075436_100003121 3300006914 Bacteria 11356
45 Ga0075436_100060721 3300006914 Bacteria 2611
46 Ga0097620_100090031 3300006931 Bacteria 3119
47 Ga0075435_100000001 3300007076 Bacteria 207579
48 Ga0099794_10009856 3300007265 Archaea 4038
49 Ga0099794_10073967 3300007265 Bacteria 1673
50 Ga0105240_10215205 3300009093 Bacteria 2242
51 Ga0105245_10067760 3300009098 Bacteria 3233
52 Ga0114129_10007132 3300009147 Bacteria 15905
53 Ga0114129_10044808 3300009147 Bacteria 6222
54 Ga0105241_10026281 3300009174 Bacteria 4330
55 Ga0105248_10029230 3300009177 Bacteria 6147
56 Ga0105248_10099267 3300009177 Bacteria 3281
57 Ga0105237_10185487 3300009545 Bacteria 2080
58 Ga0105238_10295171 3300009551 Bacteria 1604
59 Ga0105239_10151547 3300010375 Bacteria 2587
60 Ga0157376_10112937 3300014969 Bacteria 2395
61 Ga0154015_1677238 3300020610 Bacteria 1548
62 Ga0207653_10033374 3300025885 Bacteria 1670
63 Ga0207642_10108428 3300025899 Bacteria 1409
64 Ga0207647_10003008 3300025904 Bacteria 12674
65 Ga0207699_10043758 3300025906 Bacteria 2603
66 Ga0207693_10018816 3300025915 Bacteria 5496
67 Ga0207663_10166209 3300025916 Bacteria 1563
68 Ga0207660_10068548 3300025917 Bacteria 2573
69 Ga0207662_10092602 3300025918 Bacteria 1861
70 Ga0207657_10128331 3300025919 Bacteria 2081
71 Ga0207652_10116171 3300025921 Bacteria 2377
72 Ga0207652_10149687 3300025921 Bacteria 2089
73 Ga0207646_10000098 3300025922 Bacteria 116686
74 Ga0207646_10015586 3300025922 Bacteria 7175
75 Ga0207646_10105815 3300025922 Unclassified 2523
76 Ga0207694_10112282 3300025924 Bacteria 2168
77 Ga0207659_10160137 3300025926 Bacteria 1766
78 Ga0207700_10026693 3300025928 Bacteria 4031
79 Ga0207700_10039368 3300025928 Bacteria 3441
80 Ga0207664_10064869 3300025929 Bacteria 2922
81 Ga0207664_10325346 3300025929 Bacteria 1357
82 Ga0207670_10004739 3300025936 Bacteria 7376
83 Ga0207665_10017239 3300025939 Bacteria 4744
84 Ga0207691_10030635 3300025940 Bacteria 5025
85 Ga0207711_10000036 3300025941 Bacteria 176168
86 Ga0207679_10365381 3300025945 Bacteria 1261
87 Ga0207667_10021472 3300025949 Bacteria 7153
88 Ga0207708_10003709 3300026075 Bacteria 11282
89 Ga0207708_10278479 3300026075 Bacteria 1355
90 Ga0207698_10241153 3300026142 Bacteria 1648
91 Ga0209588_1000147 3300027671 Archaea 20424
92 Ga0209588_1003668 3300027671 Unclassified 4268
93 Ga0209588_1024368 3300027671 Bacteria 1910
94 Ga0265318_10039650 3300028577 Bacteria 1796
95 Ga0307515_10001983 3300028794 Bacteria 45325
96 Ga0265330_10031930 3300031235 Bacteria 2361
97 Ga0265325_10006237 3300031241 Bacteria 7267
98 Ga0265340_10006066 3300031247 Bacteria 6663
99 Ga0265340_10025525 3300031247 Bacteria 2992
100 Ga0265339_10006549 3300031249 Bacteria 7633
101 Ga0265339_10042315 3300031249 Bacteria 2522
102 Ga0265339_10103683 3300031249 Bacteria 1477
103 Ga0265331_10006374 3300031250 Bacteria 6985
104 Ga0265316_10154996 3300031344 Bacteria 1714
105 Ga0307509_10036818 3300031507 Bacteria 5354
106 Ga0265313_10000325 3300031595 Bacteria 51942
107 Ga0265313_10013392 3300031595 Bacteria 4924
108 Ga0316575_10000636 3300031665 Bacteria 10352
109 Ga0265314_10013668 3300031711 Bacteria 6545
110 Ga0265314_10021616 3300031711 Bacteria 4942
111 Ga0265314_10167332 3300031711 Bacteria 1331
112 Ga0265342_10020811 3300031712 Bacteria 4197
113 Ga0265342_10119460 3300031712 Bacteria 1485
114 Ga0373926_0012844 3300035083 Bacteria 2834
115 Ga0373926_0114708 3300035083 Bacteria 1013
116 Ga0373934_0011544 3300035086 Bacteria 3322
117 Ga0373949_0000237 3300035090 Bacteria 20582
118 Ga0373941_0057935 3300035115 Bacteria 1252
119 Ga0373953_0006147 3300035117 Bacteria 3941
120 Ga0373956_0012374 3300035119 Bacteria 3535
121 Ga0373956_0029779 3300035119 Bacteria 2382
122 Ga0373957_0001104 3300035120 Bacteria 7148
123 Ga0373943_0006823 3300035170 Bacteria 5122
124 Ga0373955_0086497 3300035172 Bacteria 1780
125 Ga0373961_0077693 3300035241 Bacteria 1039
126 Ga0316574_0040774 3300035398 Bacteria 2859
127 Ga0373924_0000475 3300035410 Bacteria 12269
128 Ga0373927_0098543 3300035695 Bacteria 1900
129 Ga0373933_0020101 3300035724 Bacteria 3782
130 Ga0373947_0051448 3300035725 Bacteria 2478
131 Ga0373937_0002719 3300036401 Bacteria 14771
132 Ga0373937_0079891 3300036401 Bacteria 3023
133 Ga0373937_0113857 3300036401 Bacteria 2517
134 Ga0372808_011438 3300036459 Bacteria 1256
135 Ga0316582_0042907 3300036647 Bacteria 2836
136 Ga0395901_0424077 3300038443 Bacteria 1364
137 Ga0451577_0010951 3300042876 Bacteria 8617
138 Ga0466963_0000988 3300044694 Bacteria 14650
139 Ga0466963_0030963 3300044694 Bacteria 3456
140 Ga0453684_0037985 3300044712 Bacteria 6596
141 Ga0453684_0161432 3300044712 Bacteria 2651
142 Ga0451576_0189885 3300045051 Bacteria 2145
143 Ga0495592_0041104 3300046454 Bacteria 3466
144 Ga0495653_0011420 3300046463 Bacteria 7259
145 Ga0495580_0007773 3300046472 Bacteria 8591
146 Ga0495580_0065706 3300046472 Bacteria 2540
147 Ga0495580_0139329 3300046472 Bacteria 1682
148 Ga0495608_0012854 3300046511 Bacteria 5808
149 Ga0495628_0006041 3300046516 Bacteria 10584
150 Ga0495628_0212915 3300046516 Bacteria 1453
151 Ga0495628_0354051 3300046516 Bacteria 1079
152 Ga0495652_0207119 3300046529 Bacteria 1484
153 Ga0495665_0014480 3300046531 Bacteria 4255
154 Ga0495645_0017664 3300046543 Bacteria 5113
155 Ga0495667_0166942 3300046559 Bacteria 1415
156 Ga0495657_0016153 3300046675 Bacteria 5443
157 Ga0495599_0049045 3300046678 Bacteria 2647
158 Ga0495600_0123552 3300046809 Bacteria 1683
159 Ga0495604_0086608 3300047317 Bacteria 2335
160 Ga0495593_0110226 3300047673 Bacteria 1406
161 Ga0496100_0133081 3300048903 Bacteria 1754
162 Ga0496104_0016923 3300048907 Bacteria 6632
163 Ga0496104_0035769 3300048907 Bacteria 4639
164 Ga0496104_0042812 3300048907 Bacteria 4252
165 Ga0496105_0066355 3300048908 Bacteria 2979
166 Ga0496109_0026889 3300048912 Bacteria 5132
167 Ga0496112_0016239 3300048915 Bacteria 6967
168 Ga0496112_0016415 3300048915 Bacteria 6936
169 Ga0496112_0099496 3300048915 Bacteria 2877
170 Ga0496112_0383182 3300048915 Bacteria 1347
171 Ga0496113_0000539 3300048916 Bacteria 18705
172 Ga0496126_0000636 3300048929 Bacteria 65473
173 Ga0496126_0017151 3300048929 Bacteria 7221
174 Ga0501032_0003019 3300049569 Bacteria 13053
175 Ga0501033_0074959 3300049570 Bacteria 2483
176 Ga0501034_0169606 3300049571 Bacteria 2150
177 Ga0501034_0209591 3300049571 Bacteria 1904
178 Ga0501039_0253294 3300049575 Bacteria 1384
179 Ga0501043_0091626 3300049579 Bacteria 2390
180 Ga0501043_0296656 3300049579 Bacteria 1236
181 Ga0501047_0012558 3300049581 Bacteria 8022
182 Ga0501047_0033302 3300049581 Bacteria 4973
183 Ga0501047_0314115 3300049581 Bacteria 1407
184 Ga0501048_0038652 3300049582 Bacteria 3424
185 Ga0501067_0076954 3300049583 Bacteria 1849
186 Ga0501067_0088421 3300049583 Bacteria 1719
187 Ga0501068_0026308 3300049584 Bacteria 3426
188 Ga0501070_0097736 3300049586 Bacteria 2428
189 Ga0501074_0022745 3300049590 Bacteria 4557
190 Ga0501077_0073579 3300049593 Bacteria 2165
191 Ga0501080_0384519 3300049742 Bacteria 1264
192 Ga0501080_0585494 3300049742 Bacteria 991
193 Ga0501083_0002682 3300049744 Bacteria 12262
194 Ga0501083_0038882 3300049744 Bacteria 3232
195 Ga0501044_0072487 3300049823 Bacteria 3501
196 nmdc:mga05p37_208819_c1 3300050507 Bacteria 2361
197 nmdc:mga05p37_93318_c1 3300050507 Bacteria 3709
198 nmdc:mga0qj67_114857_c1 3300050509 Bacteria 2175
199 nmdc:mga0n895_140403_c1 3300050512 Bacteria 2444
200 nmdc:mga0n895_150033_c1 3300050512 Bacteria 2361
201 nmdc:mga0n895_23_c1 3300050512 Bacteria 92165
202 nmdc:mga0rr50_17208_c1 3300050513 Bacteria 4820
203 nmdc:mga0a205_17914_c1 3300050515 Bacteria 6647
204 Ga0495595_0015474 3300053084 Bacteria 3254
205 Ga0495619_0012655 3300053085 Bacteria 5311
206 Ga0500566_0034678 3300053094 Bacteria 2935
207 Ga0500597_011006 3300053120 Bacteria 3255
208 Ga0501084_0166947 3300054114 Bacteria 1857
209 Ga0501082_0048118 3300060353 Bacteria 3675
210 2687237809 2684623219 Bacteria 8442773
211 Ga0105248_10000027
212 rootH2_10043728
213 JGI25404J52841_10008108
214 Ga0065712_10072436
215 Ga0065707_10092779
216 Ga0070690_100065874
217 Ga0070690_100281925
218 Ga0070680_100072227
219 Ga0070682_100049762
220 Ga0070689_100149822
221 Ga0070691_10010000
222 Ga0070675_100323679
223 Ga0070671_100369735
224 Ga0070674_100401683
225 Ga0070705_100036998
226 Ga0070705_100068957
227 Ga0070700_100040638
228 Ga0070694_100000694
229 Ga0070694_100024648
230 Ga0070708_100086767
231 Ga0070708_100272354
232 Ga0070681_10170922
233 Ga0070706_100011723
234 Ga0070707_100000104
235 Ga0070707_100004855
236 Ga0070707_100005584
237 Ga0070707_100239400
238 Ga0070698_100043391
239 Ga0070698_100505959
240 Ga0070699_100109907
241 Ga0070697_100021291
242 Ga0070697_100050376
243 Ga0070697_100109923
244 Ga0068855_100308081
245 Ga0068854_100093763
246 Ga0068859_100090030
247 Ga0068862_100437802
248 Ga0081540_1000129
249 Ga0070717_10085040
250 Ga0075430_100005178
251 Ga0075431_100008366
252 Ga0075434_100000241
253 Ga0075434_100048718
254 Ga0075436_100003121
255 Ga0075436_100060721
256 Ga0097620_100090031
257 Ga0075435_100000001
258 Ga0099794_10009856
259 Ga0099794_10073967
260 Ga0105240_10215205
261 Ga0105245_10067760
262 Ga0114129_10007132
263 Ga0114129_10044808
264 Ga0105241_10026281
265 Ga0105248_10029230
266 Ga0105248_10099267
267 Ga0105237_10185487
268 Ga0105238_10295171
269 Ga0105239_10151547
270 Ga0157376_10112937
271 Ga0154015_1677238
272 Ga0207653_10033374
273 Ga0207642_10108428
274 Ga0207647_10003008
275 Ga0207699_10043758
276 Ga0207693_10018816
277 Ga0207663_10166209
278 Ga0207660_10068548
279 Ga0207662_10092602
280 Ga0207657_10128331
281 Ga0207652_10116171
282 Ga0207652_10149687
283 Ga0207646_10000098
284 Ga0207646_10015586
285 Ga0207646_10105815
286 Ga0207694_10112282
287 Ga0207659_10160137
288 Ga0207700_10026693
289 Ga0207700_10039368
290 Ga0207664_10064869
291 Ga0207664_10325346
292 Ga0207670_10004739
293 Ga0207665_10017239
294 Ga0207691_10030635
295 Ga0207711_10000036
296 Ga0207679_10365381
297 Ga0207667_10021472
298 Ga0207708_10003709
299 Ga0207708_10278479
300 Ga0207698_10241153
301 Ga0209588_1000147
302 Ga0209588_1003668
303 Ga0209588_1024368
304 Ga0265318_10039650
305 Ga0307515_10001983
306 Ga0265330_10031930
307 Ga0265325_10006237
308 Ga0265340_10006066
309 Ga0265340_10025525
310 Ga0265339_10006549
311 Ga0265339_10042315
312 Ga0265339_10103683
313 Ga0265331_10006374
314 Ga0265316_10154996
315 Ga0307509_10036818
316 Ga0265313_10000325
317 Ga0265313_10013392
318 Ga0316575_10000636
319 Ga0265314_10013668
320 Ga0265314_10021616
321 Ga0265314_10167332
322 Ga0265342_10020811
323 Ga0265342_10119460
324 Ga0373926_0012844
325 Ga0373926_0114708
326 Ga0373934_0011544
327 Ga0373949_0000237
328 Ga0373941_0057935
329 Ga0373953_0006147
330 Ga0373956_0012374
331 Ga0373956_0029779
332 Ga0373957_0001104
333 Ga0373943_0006823
334 Ga0373955_0086497
335 Ga0373961_0077693
336 Ga0316574_0040774
337 Ga0373924_0000475
338 Ga0373927_0098543
339 Ga0373933_0020101
340 Ga0373947_0051448
341 Ga0373937_0002719
342 Ga0373937_0079891
343 Ga0373937_0113857
344 Ga0372808_011438
345 Ga0316582_0042907
346 Ga0395901_0424077
347 Ga0451577_0010951
348 Ga0466963_0000988
349 Ga0466963_0030963
350 Ga0453684_0037985
351 Ga0453684_0161432
352 Ga0451576_0189885
353 Ga0495592_0041104
354 Ga0495653_0011420
355 Ga0495580_0007773
356 Ga0495580_0065706
357 Ga0495580_0139329
358 Ga0495608_0012854
359 Ga0495628_0006041
360 Ga0495628_0212915
361 Ga0495628_0354051
362 Ga0495652_0207119
363 Ga0495665_0014480
364 Ga0495645_0017664
365 Ga0495667_0166942
366 Ga0495657_0016153
367 Ga0495599_0049045
368 Ga0495600_0123552
369 Ga0495604_0086608
370 Ga0495593_0110226
371 Ga0496100_0133081
372 Ga0496104_0016923
373 Ga0496104_0035769
374 Ga0496104_0042812
375 Ga0496105_0066355
376 Ga0496109_0026889
377 Ga0496112_0016239
378 Ga0496112_0016415
379 Ga0496112_0099496
380 Ga0496112_0383182
381 Ga0496113_0000539
382 Ga0496126_0000636
383 Ga0496126_0017151
384 Ga0501032_0003019
385 Ga0501033_0074959
386 Ga0501034_0169606
387 Ga0501034_0209591
388 Ga0501039_0253294
389 Ga0501043_0091626
390 Ga0501043_0296656
391 Ga0501047_0012558
392 Ga0501047_0033302
393 Ga0501047_0314115
394 Ga0501048_0038652
395 Ga0501067_0076954
396 Ga0501067_0088421
397 Ga0501068_0026308
398 Ga0501070_0097736
399 Ga0501074_0022745
400 Ga0501077_0073579
401 Ga0501080_0384519
402 Ga0501080_0585494
403 Ga0501083_0002682
404 Ga0501083_0038882
405 Ga0501044_0072487
406 nmdc:mga05p37_208819_c1
407 nmdc:mga05p37_93318_c1
408 nmdc:mga0qj67_114857_c1
409 nmdc:mga0n895_140403_c1
410 nmdc:mga0n895_150033_c1
411 nmdc:mga0n895_23_c1
412 nmdc:mga0rr50_17208_c1
413 nmdc:mga0a205_17914_c1
414 Ga0495595_0015474
415 Ga0495619_0012655
416 Ga0500566_0034678
417 Ga0500597_011006
418 Ga0501084_0166947
419 Ga0501082_0048118
420 2687237809

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

39

346

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9567 1 326
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9554 1 326
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9503 1 326
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9419 1 326
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9375 1 327
ID Description Score Start End Superfamily
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9542 1 328 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9512 1 328 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9269 1 320 3.20.20.100
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9251 1 327 3.20.20.100
5danA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9207 1 318 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A3M1Z231-F1-model_v4 Aldo/keto reductase 0.9863 1 211 GO:0005829
GO:0016491
AF-A0A0N0MYB0-F1-model_v4 NADP-dependent oxidoreductase domain containing protein 0.9845 1 184 GO:0005829
GO:0016491
AF-A0A7V8WGH0-F1-model_v4 Aldo/keto reductase 0.9837 1 221 GO:0005829
GO:0016491
AF-A0A3M1Z231-F1-model_v4 Aldo/keto reductase 0.9816 1 211 GO:0005829
GO:0016491
AF-A0A7V8WGH0-F1-model_v4 Aldo/keto reductase 0.9793 1 221 GO:0005829
GO:0016491

Map