F320195

General Info

Members Datasets Scaffolds Average Seq Length
210 126 420 147

Family's Representative Sequence

Representative Sequence 3300006058|Ga0075432_10041702|Ga0075432_100417022
Length 160
Sequence VKRAQIAMAPAEVAAFLEQERVVTCATLGRDGWPHLMPLWYVLRTQPTSSAGTGGDELWAWTYAKSQKVRNLERDPRCTLQVEAGDSYDQLRGVMLKAEAVLHRDLDTVTALGEEIAVRYGGAALNDDARAYVARQAAKRVGLQFQARDRATWDHRKLVS

Samples

Sample ID Description Type Environment
1 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
34 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
48 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
54 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
55 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
59 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
60 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
61 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
62 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
66 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
76 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
77 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
78 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
79 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
80 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
81 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
86 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
87 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
108 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
123 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
125 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
126 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 6.19
Rhizosphere 91.43
Stem 0
Stem Tuber 0
Unclassified 1.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075432_10041702 3300006058 Bacteria 1604
2 JGI25406J46586_10004570 3300003203 Bacteria 6444
3 JGI25407J50210_10027313 3300003373 Bacteria 1480
4 Ga0070683_100307399 3300005329 Bacteria 1508
5 Ga0070680_100511874 3300005336 Bacteria 1027
6 Ga0070682_100464274 3300005337 Bacteria 973
7 Ga0070660_100798135 3300005339 Bacteria 794
8 Ga0070660_100814255 3300005339 Bacteria 786
9 Ga0070687_100297289 3300005343 Bacteria 1023
10 Ga0070687_100427881 3300005343 Bacteria 875
11 Ga0070659_100516171 3300005366 Bacteria 1020
12 Ga0070701_10272647 3300005438 Bacteria 1030
13 Ga0070700_101643138 3300005441 Bacteria 550
14 Ga0070662_100138761 3300005457 Bacteria 1882
15 Ga0070706_101203139 3300005467 Bacteria 696
16 Ga0070679_100296920 3300005530 Bacteria 1567
17 Ga0070679_100535645 3300005530 Bacteria 1115
18 Ga0070679_101342105 3300005530 Bacteria 661
19 Ga0070684_100372149 3300005535 Bacteria 1315
20 Ga0070686_100412219 3300005544 Bacteria 1030
21 Ga0070693_100125410 3300005547 Bacteria 1598
22 Ga0070693_101057764 3300005547 Bacteria 617
23 Ga0068855_100178861 3300005563 Bacteria 2399
24 Ga0068854_101064433 3300005578 Bacteria 719
25 Ga0068856_101342323 3300005614 Bacteria 730
26 Ga0068866_10290288 3300005718 Bacteria 1017
27 Ga0068861_101078478 3300005719 Bacteria 771
28 Ga0081455_10033817 3300005937 Bacteria 4588
29 Ga0081538_10001103 3300005981 Bacteria 28593
30 Ga0081540_1073653 3300005983 Bacteria 1568
31 Ga0081539_10005953 3300005985 Bacteria 12025
32 Ga0068865_100454275 3300006881 Bacteria 1060
33 Ga0111539_10916064 3300009094 Bacteria 1019
34 Ga0105245_11326801 3300009098 Bacteria 769
35 Ga0105243_12034318 3300009148 Bacteria 609
36 Ga0105248_11457075 3300009177 Bacteria 775
37 Ga0157372_10662353 3300013307 Bacteria 1215
38 Ga0157377_10658539 3300014745 Bacteria 755
39 Ga0206353_11942834 3300020082 Bacteria 551
40 Ga0207426_1024909 3300025302 Bacteria 2023
41 Ga0207657_10391437 3300025919 Bacteria 1094
42 Ga0207652_10991907 3300025921 Bacteria 739
43 Ga0207652_11147220 3300025921 Bacteria 678
44 Ga0207681_11045175 3300025923 Bacteria 686
45 Ga0207690_10131722 3300025932 Bacteria 1831
46 Ga0207706_10098313 3300025933 Bacteria 2574
47 Ga0207661_10074871 3300025944 Bacteria 2776
48 Ga0207679_10951757 3300025945 Bacteria 787
49 Ga0207640_10913773 3300025981 Bacteria 767
50 Ga0207678_10767081 3300026067 Bacteria 851
51 Ga0207678_11052605 3300026067 Bacteria 720
52 Ga0207708_10586432 3300026075 Bacteria 943
53 Ga0207674_10835952 3300026116 Bacteria 888
54 Ga0207428_10223033 3300027907 Bacteria 1412
55 Ga0307405_10576397 3300031731 Bacteria 915
56 Ga0307405_11598890 3300031731 Bacteria 575
57 Ga0307410_10212651 3300031852 Bacteria 1483
58 Ga0307406_10600396 3300031901 Bacteria 907
59 Ga0307406_11278555 3300031901 Bacteria 640
60 Ga0307409_100505497 3300031995 Bacteria 1178
61 Ga0307416_100044589 3300032002 Bacteria 3484
62 Ga0307411_12127888 3300032005 Bacteria 525
63 Ga0307415_100192337 3300032126 Bacteria 1611
64 Ga0307415_100328568 3300032126 Bacteria 1278
65 Ga0307415_100525835 3300032126 Bacteria 1039
66 Ga0373943_0677871 3300035170 Bacteria 610
67 Ga0395899_0310393 3300037312 Bacteria 1065
68 Ga0395901_0139115 3300038443 Bacteria 2552
69 Ga0395901_0208400 3300038443 Bacteria 2047
70 Ga0451807_0249304 3300041486 Unclassified 1645
71 Ga0451807_0706003 3300041486 Bacteria 589
72 Ga0451851_0409339 3300041507 Bacteria 1013
73 Ga0451853_1446254 3300041512 Bacteria 1018
74 Ga0451853_2600461 3300041512 Bacteria 563
75 Ga0466972_0318343 3300044658 Bacteria 727
76 Ga0466965_0082679 3300044683 Bacteria 1625
77 Ga0466961_0186139 3300044693 Bacteria 1288
78 Ga0466963_0007050 3300044694 Bacteria 6692
79 Ga0466963_0033657 3300044694 Bacteria 3329
80 Ga0466963_0063509 3300044694 Bacteria 2472
81 Ga0466963_0122271 3300044694 Bacteria 1792
82 Ga0466963_0383664 3300044694 Bacteria 990
83 Ga0466963_0576931 3300044694 Bacteria 794
84 Ga0466964_0082559 3300044706 Bacteria 1382
85 Ga0466964_0112777 3300044706 Bacteria 1215
86 Ga0466964_0367185 3300044706 Bacteria 744
87 Ga0466968_0324816 3300044735 Bacteria 744
88 Ga0466968_0398784 3300044735 Bacteria 674
89 Ga0466970_0141440 3300044765 Bacteria 1326
90 Ga0466957_0146786 3300044842 Bacteria 1523
91 Ga0466957_0254329 3300044842 Bacteria 1169
92 Ga0466960_0159773 3300044901 Bacteria 1209
93 Ga0466960_0395693 3300044901 Bacteria 795
94 Ga0466960_0860074 3300044901 Bacteria 551
95 Ga0466959_0682141 3300045049 Bacteria 689
96 Ga0466958_0392720 3300045836 Bacteria 895
97 Ga0466967_0021246 3300045976 Bacteria 5265
98 Ga0466967_0036173 3300045976 Bacteria 4212
99 Ga0466967_0045562 3300045976 Bacteria 3811
100 Ga0466967_0060733 3300045976 Bacteria 3351
101 Ga0466967_0135591 3300045976 Bacteria 2289
102 Ga0466967_0191893 3300045976 Bacteria 1931
103 Ga0466967_0278293 3300045976 Bacteria 1605
104 Ga0466967_0336283 3300045976 Bacteria 1459
105 Ga0466967_0373879 3300045976 Bacteria 1382
106 Ga0466967_0523466 3300045976 Bacteria 1165
107 Ga0466967_0712706 3300045976 Bacteria 994
108 Ga0466967_0823221 3300045976 Bacteria 922
109 Ga0466967_1067792 3300045976 Bacteria 804
110 Ga0466967_1463264 3300045976 Bacteria 680
111 Ga0466967_1694470 3300045976 Bacteria 629
112 Ga0466967_1912081 3300045976 Bacteria 590
113 Ga0466967_2085751 3300045976 Bacteria 563
114 Ga0495603_0004515 3300046455 Bacteria 8304
115 Ga0495629_0000028 3300046459 Bacteria 127409
116 Ga0495629_0004252 3300046459 Bacteria 10732
117 Ga0495638_0001810 3300046460 Bacteria 18592
118 Ga0495653_0144823 3300046463 Bacteria 1666
119 Ga0495650_0000104 3300046471 Bacteria 208976
120 Ga0495662_0004276 3300046476 Bacteria 7181
121 Ga0495594_0195365 3300046499 Unclassified 1153
122 Ga0495618_0552188 3300046514 Bacteria 689
123 Ga0495628_0472185 3300046516 Bacteria 909
124 Ga0495640_0015470 3300046533 Bacteria 5741
125 Ga0495640_0615741 3300046533 Bacteria 655
126 Ga0495625_0735927 3300046660 Unclassified 579
127 Ga0495613_0336606 3300046689 Bacteria 1039
128 Ga0495670_0037411 3300046691 Bacteria 2419
129 Ga0495674_0000007 3300047319 Bacteria 336257
130 Ga0495686_0070473 3300047472 Bacteria 2154
131 Ga0496104_0032447 3300048907 Bacteria 4860
132 Ga0496105_0181685 3300048908 Bacteria 1722
133 Ga0496107_0275721 3300048910 Bacteria 1252
134 Ga0496108_0548927 3300048911 Bacteria 1008
135 Ga0496109_0179113 3300048912 Bacteria 1990
136 Ga0496109_0466202 3300048912 Bacteria 1193
137 Ga0496112_0146491 3300048915 Bacteria 2330
138 Ga0496112_0575306 3300048915 Bacteria 1059
139 Ga0496112_0606667 3300048915 Bacteria 1026
140 Ga0496113_0009182 3300048916 Bacteria 6484
141 Ga0496113_0427160 3300048916 Bacteria 1064
142 Ga0496125_0268478 3300048928 Bacteria 1065
143 Ga0501031_0221878 3300049568 Bacteria 1231
144 Ga0501031_0295767 3300049568 Bacteria 1049
145 Ga0501032_0516980 3300049569 Bacteria 762
146 Ga0501036_0133705 3300049572 Bacteria 2093
147 Ga0501036_0207704 3300049572 Bacteria 1646
148 Ga0501037_0196929 3300049573 Bacteria 1425
149 Ga0501038_0219367 3300049574 Bacteria 1518
150 Ga0501038_0301868 3300049574 Bacteria 1257
151 Ga0501039_0015536 3300049575 Bacteria 5827
152 Ga0501039_0112805 3300049575 Bacteria 2126
153 Ga0501039_0249891 3300049575 Bacteria 1394
154 Ga0501039_0328425 3300049575 Bacteria 1202
155 Ga0501039_0719545 3300049575 Bacteria 780
156 Ga0501040_0049679 3300049576 Bacteria 2868
157 Ga0501040_0127897 3300049576 Bacteria 1785
158 Ga0501040_1396714 3300049576 Bacteria 508
159 Ga0501041_0040564 3300049577 Bacteria 2826
160 Ga0501042_0019506 3300049578 Bacteria 4710
161 Ga0501042_0119270 3300049578 Bacteria 1899
162 Ga0501042_0371918 3300049578 Bacteria 1034
163 Ga0501043_1125885 3300049579 Bacteria 554
164 Ga0501046_0352588 3300049580 Bacteria 1068
165 Ga0501046_0872872 3300049580 Bacteria 628
166 Ga0501068_0260815 3300049584 Bacteria 1105
167 Ga0501068_0566863 3300049584 Bacteria 739
168 Ga0501069_0430354 3300049585 Bacteria 783
169 Ga0501069_0620588 3300049585 Bacteria 650
170 Ga0501070_0326448 3300049586 Bacteria 1248
171 Ga0501070_0450830 3300049586 Bacteria 1037
172 Ga0501070_0721431 3300049586 Bacteria 787
173 Ga0501071_0018068 3300049587 Bacteria 4876
174 Ga0501071_0161564 3300049587 Bacteria 1674
175 Ga0501072_0060711 3300049588 Bacteria 2981
176 Ga0501072_0090339 3300049588 Bacteria 2431
177 Ga0501072_0342429 3300049588 Bacteria 1187
178 Ga0501074_0077738 3300049590 Bacteria 2382
179 Ga0501074_0156493 3300049590 Bacteria 1628
180 Ga0501074_0199036 3300049590 Bacteria 1428
181 Ga0501075_0069069 3300049591 Bacteria 2670
182 Ga0501075_0086828 3300049591 Bacteria 2370
183 Ga0501075_0114214 3300049591 Bacteria 2053
184 Ga0501076_0057652 3300049592 Bacteria 3085
185 Ga0501076_0059254 3300049592 Bacteria 3045
186 Ga0501076_0087324 3300049592 Bacteria 2507
187 Ga0501076_1317058 3300049592 Bacteria 594
188 Ga0501079_0168097 3300049741 Bacteria 1710
189 Ga0501079_1352560 3300049741 Bacteria 560
190 Ga0501081_0202022 3300049743 Bacteria 1441
191 Ga0501081_0267007 3300049743 Bacteria 1251
192 Ga0501081_0405748 3300049743 Bacteria 1009
193 Ga0501083_0419493 3300049744 Bacteria 871
194 Ga0501035_0269288 3300049822 Bacteria 1442
195 Ga0501035_0727766 3300049822 Bacteria 798
196 Ga0501044_0475887 3300049823 Bacteria 1153
197 Ga0501044_0926769 3300049823 Bacteria 745
198 Ga0501045_0016932 3300049824 Bacteria 5178
199 Ga0501045_0084676 3300049824 Bacteria 2339
200 Ga0495601_0934115 3300053077 Bacteria 547
201 Ga0495595_0556073 3300053084 Bacteria 586
202 Ga0501084_0030401 3300054114 Bacteria 4517
203 Ga0501084_0151267 3300054114 Bacteria 1956
204 Ga0501084_1426776 3300054114 Bacteria 580
205 Ga0501082_0018026 3300060353 Bacteria 6081
206 Ga0501082_0253572 3300060353 Bacteria 1531
207 Ga0466962_0143983 3300061719 Bacteria 1155
208 Ga0466962_0241854 3300061719 Bacteria 886
209 Ga0530510_0076868 3300061734 Bacteria 2426
210 Ga0530510_0531222 3300061734 Bacteria 893
211 Ga0075432_10041702
212 JGI25406J46586_10004570
213 JGI25407J50210_10027313
214 Ga0070683_100307399
215 Ga0070680_100511874
216 Ga0070682_100464274
217 Ga0070660_100798135
218 Ga0070660_100814255
219 Ga0070687_100297289
220 Ga0070687_100427881
221 Ga0070659_100516171
222 Ga0070701_10272647
223 Ga0070700_101643138
224 Ga0070662_100138761
225 Ga0070706_101203139
226 Ga0070679_100296920
227 Ga0070679_100535645
228 Ga0070679_101342105
229 Ga0070684_100372149
230 Ga0070686_100412219
231 Ga0070693_100125410
232 Ga0070693_101057764
233 Ga0068855_100178861
234 Ga0068854_101064433
235 Ga0068856_101342323
236 Ga0068866_10290288
237 Ga0068861_101078478
238 Ga0081455_10033817
239 Ga0081538_10001103
240 Ga0081540_1073653
241 Ga0081539_10005953
242 Ga0068865_100454275
243 Ga0111539_10916064
244 Ga0105245_11326801
245 Ga0105243_12034318
246 Ga0105248_11457075
247 Ga0157372_10662353
248 Ga0157377_10658539
249 Ga0206353_11942834
250 Ga0207426_1024909
251 Ga0207657_10391437
252 Ga0207652_10991907
253 Ga0207652_11147220
254 Ga0207681_11045175
255 Ga0207690_10131722
256 Ga0207706_10098313
257 Ga0207661_10074871
258 Ga0207679_10951757
259 Ga0207640_10913773
260 Ga0207678_10767081
261 Ga0207678_11052605
262 Ga0207708_10586432
263 Ga0207674_10835952
264 Ga0207428_10223033
265 Ga0307405_10576397
266 Ga0307405_11598890
267 Ga0307410_10212651
268 Ga0307406_10600396
269 Ga0307406_11278555
270 Ga0307409_100505497
271 Ga0307416_100044589
272 Ga0307411_12127888
273 Ga0307415_100192337
274 Ga0307415_100328568
275 Ga0307415_100525835
276 Ga0373943_0677871
277 Ga0395899_0310393
278 Ga0395901_0139115
279 Ga0395901_0208400
280 Ga0451807_0249304
281 Ga0451807_0706003
282 Ga0451851_0409339
283 Ga0451853_1446254
284 Ga0451853_2600461
285 Ga0466972_0318343
286 Ga0466965_0082679
287 Ga0466961_0186139
288 Ga0466963_0007050
289 Ga0466963_0033657
290 Ga0466963_0063509
291 Ga0466963_0122271
292 Ga0466963_0383664
293 Ga0466963_0576931
294 Ga0466964_0082559
295 Ga0466964_0112777
296 Ga0466964_0367185
297 Ga0466968_0324816
298 Ga0466968_0398784
299 Ga0466970_0141440
300 Ga0466957_0146786
301 Ga0466957_0254329
302 Ga0466960_0159773
303 Ga0466960_0395693
304 Ga0466960_0860074
305 Ga0466959_0682141
306 Ga0466958_0392720
307 Ga0466967_0021246
308 Ga0466967_0036173
309 Ga0466967_0045562
310 Ga0466967_0060733
311 Ga0466967_0135591
312 Ga0466967_0191893
313 Ga0466967_0278293
314 Ga0466967_0336283
315 Ga0466967_0373879
316 Ga0466967_0523466
317 Ga0466967_0712706
318 Ga0466967_0823221
319 Ga0466967_1067792
320 Ga0466967_1463264
321 Ga0466967_1694470
322 Ga0466967_1912081
323 Ga0466967_2085751
324 Ga0495603_0004515
325 Ga0495629_0000028
326 Ga0495629_0004252
327 Ga0495638_0001810
328 Ga0495653_0144823
329 Ga0495650_0000104
330 Ga0495662_0004276
331 Ga0495594_0195365
332 Ga0495618_0552188
333 Ga0495628_0472185
334 Ga0495640_0015470
335 Ga0495640_0615741
336 Ga0495625_0735927
337 Ga0495613_0336606
338 Ga0495670_0037411
339 Ga0495674_0000007
340 Ga0495686_0070473
341 Ga0496104_0032447
342 Ga0496105_0181685
343 Ga0496107_0275721
344 Ga0496108_0548927
345 Ga0496109_0179113
346 Ga0496109_0466202
347 Ga0496112_0146491
348 Ga0496112_0575306
349 Ga0496112_0606667
350 Ga0496113_0009182
351 Ga0496113_0427160
352 Ga0496125_0268478
353 Ga0501031_0221878
354 Ga0501031_0295767
355 Ga0501032_0516980
356 Ga0501036_0133705
357 Ga0501036_0207704
358 Ga0501037_0196929
359 Ga0501038_0219367
360 Ga0501038_0301868
361 Ga0501039_0015536
362 Ga0501039_0112805
363 Ga0501039_0249891
364 Ga0501039_0328425
365 Ga0501039_0719545
366 Ga0501040_0049679
367 Ga0501040_0127897
368 Ga0501040_1396714
369 Ga0501041_0040564
370 Ga0501042_0019506
371 Ga0501042_0119270
372 Ga0501042_0371918
373 Ga0501043_1125885
374 Ga0501046_0352588
375 Ga0501046_0872872
376 Ga0501068_0260815
377 Ga0501068_0566863
378 Ga0501069_0430354
379 Ga0501069_0620588
380 Ga0501070_0326448
381 Ga0501070_0450830
382 Ga0501070_0721431
383 Ga0501071_0018068
384 Ga0501071_0161564
385 Ga0501072_0060711
386 Ga0501072_0090339
387 Ga0501072_0342429
388 Ga0501074_0077738
389 Ga0501074_0156493
390 Ga0501074_0199036
391 Ga0501075_0069069
392 Ga0501075_0086828
393 Ga0501075_0114214
394 Ga0501076_0057652
395 Ga0501076_0059254
396 Ga0501076_0087324
397 Ga0501076_1317058
398 Ga0501079_0168097
399 Ga0501079_1352560
400 Ga0501081_0202022
401 Ga0501081_0267007
402 Ga0501081_0405748
403 Ga0501083_0419493
404 Ga0501035_0269288
405 Ga0501035_0727766
406 Ga0501044_0475887
407 Ga0501044_0926769
408 Ga0501045_0016932
409 Ga0501045_0084676
410 Ga0495601_0934115
411 Ga0495595_0556073
412 Ga0501084_0030401
413 Ga0501084_0151267
414 Ga0501084_1426776
415 Ga0501082_0018026
416 Ga0501082_0253572
417 Ga0466962_0143983
418 Ga0466962_0241854
419 Ga0530510_0076868
420 Ga0530510_0531222

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

9

107

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rfe-assembly1.cif.gz_A crystal structure of conserved hypothetical protein rv2991 from mycobacterium tuberculosis 0.926 1 148
1rfe-assembly1.cif.gz_A crystal structure of conserved hypothetical protein rv2991 from mycobacterium tuberculosis 0.9084 1 148
6eci-assembly4.cif.gz_G structure of the fad binding protein msmeg_5243 from mycobacterium smegmatis 0.8594 9 143
2hti-assembly1.cif.gz_A-2 crystal structure of a flavin-nucleotide-binding protein (bh_0577) from bacillus halodurans at 2.50 a resolution 0.8471 9 143
5jab-assembly1.cif.gz_B structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.8441 9 144
ID Description Score Start End Superfamily
af_O53240_10_156_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.938 9 148 2.30.110.10
1rfeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9323 9 148 2.30.110.10
1rfeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8846 9 148 2.30.110.10
af_O53240_10_156_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8832 9 148 2.30.110.10
6eciG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8594 9 143 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A535E3M8-F1-model_v4 TIGR03618 family F420-dependent PPOX class oxidoreductase 0.9822 1 148 GO:0005829
GO:0016627
GO:0070967
AF-A0A7W1RAB4-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9778 1 148 GO:0005829
GO:0016627
GO:0070967
AF-A0A3M0ZRH4-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.968 4 149 GO:0005829
GO:0016627
GO:0070967
AF-A0A7W1RAB4-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9649 1 148 GO:0005829
GO:0016627
GO:0070967
AF-A0A535E3M8-F1-model_v4 TIGR03618 family F420-dependent PPOX class oxidoreductase 0.9628 1 148 GO:0005829
GO:0016627
GO:0070967

Map