F320182

General Info

Members Datasets Scaffolds Average Seq Length
210 140 420 267

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10023125|Ga0081539_100231252
Length 278
Sequence MNDADSRFASKDVPSALMRQTLLDRDLVRPATDREPVRLLPWLHVVAIGGRSIMDRGRDAVEPLVDELRAAYADRKLLIATGPGIRARHVFGVALDLGLPTGALAALAATEAEQNGHIVAALLAEDNVSYLAHTAVARQLAIHLAAAPAAVCNGFPPYEMFEFPPPVGKIPPHRTDAGAFLIADAYGAARVVYAKDVDGVYTRDPADEGEGEAELMPRVGAAELLAMDLPSLPIDRIVLELMATAKHQKEIQIVNGLTPGNVTKALAGEHVGTIIHAD

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
77 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
90 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
91 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
92 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
93 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
94 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
95 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
96 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
103 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
132 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
133 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
134 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
135 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
136 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
139 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
140 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 1.9
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.33
Nodule 0
Rhizoplane 4.29
Rhizosphere 82.86
Stem 0
Stem Tuber 0
Unclassified 17.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10023125 3300005985 Bacteria 4080
2 Ga0068868_100216904 3300005338 Bacteria 1601
3 Ga0068868_100373214 3300005338 Bacteria 1226
4 Ga0070674_100231872 3300005356 Bacteria 1441
5 Ga0070709_10049281 3300005434 Bacteria 2632
6 Ga0070709_10225152 3300005434 Bacteria 1339
7 Ga0070714_100212680 3300005435 Bacteria 1773
8 Ga0070714_100373415 3300005435 Unclassified 1343
9 Ga0070714_100382533 3300005435 Bacteria 1327
10 Ga0070713_100002411 3300005436 Bacteria 12197
11 Ga0070713_100003434 3300005436 Bacteria 10459
12 Ga0070713_100015450 3300005436 Bacteria 5709
13 Ga0070713_100021454 3300005436 Bacteria 4969
14 Ga0070713_100219093 3300005436 Unclassified 1726
15 Ga0070700_100099286 3300005441 Bacteria 1915
16 Ga0070708_100233119 3300005445 Unclassified 1727
17 Ga0070662_100061181 3300005457 Bacteria 2748
18 Ga0070681_10244724 3300005458 Unclassified 1706
19 Ga0070706_100549036 3300005467 Bacteria 1075
20 Ga0070679_100091499 3300005530 Bacteria 3030
21 Ga0070679_100181003 3300005530 Unclassified 2080
22 Ga0070684_100428649 3300005535 Bacteria 1221
23 Ga0068853_100016988 3300005539 Bacteria 6000
24 Ga0068853_100087054 3300005539 Bacteria 2740
25 Ga0068853_100168961 3300005539 Bacteria 1978
26 Ga0070696_100082379 3300005546 Bacteria 2281
27 Ga0070693_100005186 3300005547 Bacteria 6233
28 Ga0070665_100330435 3300005548 Bacteria 1529
29 Ga0070664_100104123 3300005564 Bacteria 2471
30 Ga0068856_100015172 3300005614 Bacteria 7442
31 Ga0070702_100479736 3300005615 Bacteria 908
32 Ga0068852_100027987 3300005616 Bacteria 4605
33 Ga0068852_100422825 3300005616 Bacteria 1315
34 Ga0068851_10025417 3300005834 Unclassified 2905
35 Ga0070717_10070362 3300006028 Unclassified 2916
36 Ga0070717_10082095 3300006028 Bacteria 2707
37 Ga0070717_10590695 3300006028 Unclassified 1007
38 Ga0070712_100000867 3300006175 Bacteria 18030
39 Ga0070712_100347270 3300006175 Unclassified 1213
40 Ga0075434_100170437 3300006871 Bacteria 2197
41 Ga0075434_100223946 3300006871 Bacteria 1901
42 Ga0068865_100318564 3300006881 Bacteria 1250
43 Ga0075436_100045457 3300006914 Bacteria 3029
44 Ga0075435_100086077 3300007076 Bacteria 2587
45 Ga0075435_100209507 3300007076 Bacteria 1653
46 Ga0105240_10009693 3300009093 Bacteria 13604
47 Ga0105240_10197589 3300009093 Bacteria 2359
48 Ga0105240_10201996 3300009093 Bacteria 2328
49 Ga0111539_10021311 3300009094 Bacteria 7980
50 Ga0111539_10111717 3300009094 Bacteria 3206
51 Ga0105245_10003018 3300009098 Bacteria 15096
52 Ga0105245_10189335 3300009098 Bacteria 1970
53 Ga0105243_10301276 3300009148 Bacteria 1453
54 Ga0105242_10592676 3300009176 Bacteria 1069
55 Ga0105238_10016428 3300009551 Bacteria 7493
56 Ga0105238_10026836 3300009551 Bacteria 5870
57 Ga0105249_10367979 3300009553 Bacteria 1460
58 Ga0099796_10005593 3300010159 Bacteria 3145
59 Ga0105239_10787810 3300010375 Bacteria 1089
60 Ga0157373_10015668 3300013100 Bacteria 5538
61 Ga0157369_10008920 3300013105 Bacteria 11488
62 Ga0157369_10109731 3300013105 Bacteria 2933
63 Ga0157369_10558233 3300013105 Unclassified 1183
64 Ga0157374_10061487 3300013296 Unclassified 3517
65 Ga0157378_10306253 3300013297 Bacteria 1539
66 Ga0157378_10367524 3300013297 Bacteria 1409
67 Ga0163162_10417093 3300013306 Bacteria 1475
68 Ga0157380_10020378 3300014326 Bacteria 4956
69 Ga0157380_10463244 3300014326 Bacteria 1221
70 Ga0157380_10987414 3300014326 Unclassified 874
71 Ga0182008_10069800 3300014497 Unclassified 1729
72 Ga0207692_10085659 3300025898 Bacteria 1696
73 Ga0207688_10062338 3300025901 Bacteria 2102
74 Ga0207699_10005969 3300025906 Bacteria 5862
75 Ga0207699_10186697 3300025906 Bacteria 1397
76 Ga0207645_10102563 3300025907 Bacteria 1847
77 Ga0207695_10030978 3300025913 Bacteria 5879
78 Ga0207693_10001204 3300025915 Bacteria 23045
79 Ga0207693_10014110 3300025915 Bacteria 6434
80 Ga0207693_10018962 3300025915 Bacteria 5476
81 Ga0207663_10075864 3300025916 Bacteria 2183
82 Ga0207652_10170697 3300025921 Bacteria 1952
83 Ga0207659_10230065 3300025926 Bacteria 1495
84 Ga0207687_10012941 3300025927 Bacteria 5453
85 Ga0207687_10302559 3300025927 Bacteria 1288
86 Ga0207700_10001425 3300025928 Bacteria 13549
87 Ga0207700_10005062 3300025928 Bacteria 7839
88 Ga0207700_10032989 3300025928 Bacteria 3701
89 Ga0207700_10106591 3300025928 Unclassified 2247
90 Ga0207700_10488330 3300025928 Bacteria 1089
91 Ga0207664_10505561 3300025929 Bacteria 1082
92 Ga0207664_10524742 3300025929 Bacteria 1061
93 Ga0207706_10087382 3300025933 Bacteria 2741
94 Ga0207706_10097666 3300025933 Bacteria 2583
95 Ga0207686_10290284 3300025934 Unclassified 1211
96 Ga0207669_10176044 3300025937 Bacteria 1528
97 Ga0207704_10244031 3300025938 Bacteria 1344
98 Ga0207712_10250001 3300025961 Bacteria 1432
99 Ga0207677_10184327 3300026023 Bacteria 1645
100 Ga0207703_10393978 3300026035 Bacteria 1284
101 Ga0207639_10000013 3300026041 Bacteria 293084
102 Ga0207639_10134068 3300026041 Unclassified 2054
103 Ga0207639_10278410 3300026041 Unclassified 1470
104 Ga0207702_10007382 3300026078 Bacteria 9385
105 Ga0207702_10213768 3300026078 Bacteria 1794
106 Ga0207698_10016874 3300026142 Bacteria 4936
107 Ga0207428_10065461 3300027907 Bacteria 2867
108 Ga0265340_10129144 3300031247 Bacteria 1160
109 Ga0307508_10156721 3300031616 Bacteria 1881
110 Ga0265314_10002205 3300031711 Bacteria 20322
111 Ga0316576_10000509 3300031727 Bacteria 18251
112 Ga0307516_10110895 3300031730 Bacteria 2546
113 Ga0316593_10034441 3300032168 Bacteria 1661
114 Ga0316593_10070568 3300032168 Bacteria 1208
115 Ga0316593_10074349 3300032168 Bacteria 1179
116 Ga0316596_1018027 3300033541 Bacteria 1781
117 Ga0373923_0037967 3300035111 Unclassified 1971
118 Ga0373936_0003133 3300035113 Bacteria 6192
119 Ga0373945_0004630 3300035116 Bacteria 4381
120 Ga0373943_0006566 3300035170 Bacteria 5219
121 Ga0373924_0000010 3300035410 Bacteria 49782
122 Ga0373924_0036983 3300035410 Bacteria 1986
123 Ga0373931_0147281 3300035691 Bacteria 1370
124 Ga0373935_0002163 3300035692 Bacteria 11152
125 Ga0373935_0144331 3300035692 Bacteria 1610
126 Ga0373935_0271692 3300035692 Unclassified 1191
127 Ga0373935_0293332 3300035692 Bacteria 1148
128 Ga0373927_0000618 3300035695 Bacteria 26937
129 Ga0373927_0064467 3300035695 Bacteria 2370
130 Ga0373927_0120614 3300035695 Unclassified 1711
131 Ga0373947_0013133 3300035725 Unclassified 4748
132 Ga0373947_0023103 3300035725 Bacteria 3615
133 Ga0373947_0066224 3300035725 Bacteria 2204
134 Ga0373947_0067793 3300035725 Bacteria 2180
135 Ga0373947_0356202 3300035725 Unclassified 982
136 Ga0373937_0574813 3300036401 Unclassified 1070
137 Ga0316584_0357668 3300036712 Bacteria 1047
138 Ga0373925_0043435 3300037068 Bacteria 3336
139 Ga0373925_0086355 3300037068 Unclassified 2393
140 Ga0395898_0047274 3300037466 Bacteria 4224
141 Ga0436364_1010063 3300037853 Unclassified 1711
142 Ga0400490_35834 3300038726 Bacteria 1786
143 Ga0400491_13680 3300038727 Bacteria 3226
144 Ga0400485_09941 3300038735 Bacteria 54196
145 Ga0400488_11462 3300038741 Bacteria 2501
146 Ga0400486_28778 3300038742 Bacteria 6577
147 Ga0400483_056104 3300039062 Bacteria 10111
148 Ga0400483_082421 3300039062 Bacteria 22526
149 Ga0400489_28094 3300039093 Unclassified 3226
150 Ga0400489_70635 3300039093 Bacteria 23179
151 Ga0400487_10872 3300039110 Bacteria 1058
152 Ga0400487_59619 3300039110 Bacteria 18261
153 Ga0436365_1212715 3300039437 Unclassified 1315
154 Ga0436363_1319301 3300039450 Bacteria 3127
155 Ga0436363_1506003 3300039450 Bacteria 6132
156 Ga0436362_1035530 3300039453 Bacteria 2179
157 Ga0439453_0004086 3300041408 Bacteria 2149
158 Ga0451853_0714033 3300041512 Bacteria 984
159 Ga0439464_0032488 3300042439 Bacteria 1467
160 Ga0439460_0021160 3300042461 Bacteria 1775
161 Ga0451577_0119326 3300042876 Unclassified 2362
162 Ga0453683_0000038 3300044673 Bacteria 229847
163 Ga0453683_0126098 3300044673 Bacteria 1612
164 Ga0453684_0001110 3300044712 Bacteria 84588
165 Ga0453684_0013151 3300044712 Bacteria 13496
166 Ga0453684_0051032 3300044712 Bacteria 5431
167 Ga0453684_0108603 3300044712 Bacteria 3376
168 Ga0453684_0631333 3300044712 Unclassified 1171
169 Ga0466957_0001216 3300044842 Bacteria 13423
170 Ga0466957_0475929 3300044842 Bacteria 863
171 Ga0495651_0277601 3300046462 Bacteria 1133
172 Ga0495662_0059896 3300046476 Bacteria 1839
173 Ga0495664_0237829 3300046477 Bacteria 1102
174 Ga0495606_0000947 3300046507 Bacteria 42735
175 Ga0495608_0156279 3300046511 Unclassified 1452
176 Ga0495628_0471308 3300046516 Unclassified 910
177 Ga0495665_0201081 3300046531 Bacteria 1033
178 Ga0495645_0311200 3300046543 Bacteria 1026
179 Ga0495667_0056286 3300046559 Bacteria 2586
180 Ga0495635_0024269 3300046663 Bacteria 4227
181 Ga0495674_0452293 3300047319 Bacteria 1032
182 Ga0495593_0034193 3300047673 Bacteria 2766
183 Ga0495602_0065661 3300048088 Unclassified 3131
184 Ga0495602_0118685 3300048088 Unclassified 2133
185 Ga0495602_0205259 3300048088 Bacteria 1500
186 Ga0495602_0391396 3300048088 Bacteria 993
187 Ga0496102_0144183 3300048905 Bacteria 2234
188 Ga0496104_0039247 3300048907 Bacteria 4433
189 Ga0496105_0000939 3300048908 Bacteria 19896
190 Ga0496105_0219161 3300048908 Bacteria 1549
191 Ga0496112_0000059 3300048915 Bacteria 74946
192 Ga0496112_0364701 3300048915 Unclassified 1386
193 Ga0496113_0006471 3300048916 Bacteria 7429
194 Ga0496114_0138591 3300048917 Unclassified 2105
195 Ga0496115_0502331 3300048918 Unclassified 974
196 Ga0496126_0064612 3300048929 Bacteria 3278
197 nmdc:mga0k408_300848_c1 3300050493 Bacteria 957
198 nmdc:mga08y16_392546_c1 3300050511 Bacteria 1421
199 nmdc:mga08y16_84715_c1 3300050511 Bacteria 3304
200 nmdc:mga0rr50_301197_c1 3300050513 Bacteria 1341
201 nmdc:mga08x19_259840_c1 3300050514 Unclassified 1200
202 nmdc:mga08x19_648058_c1 3300050514 Bacteria 749
203 Ga0495601_0226318 3300053077 Bacteria 1222
204 Ga0500559_0019564 3300053136 Bacteria 2860
205 Ga0500573_0000398 3300053140 Bacteria 18593
206 Ga0500590_016959 3300053148 Bacteria 3766
207 Ga0500616_0017190 3300053153 Bacteria 4107
208 Ga0500639_099815 3300053163 Bacteria 1431
209 Ga0500636_0000979 3300053177 Bacteria 15335
210 2740991287 2740891818 Bacteria 6711283
211 Ga0081539_10023125
212 Ga0068868_100216904
213 Ga0068868_100373214
214 Ga0070674_100231872
215 Ga0070709_10049281
216 Ga0070709_10225152
217 Ga0070714_100212680
218 Ga0070714_100373415
219 Ga0070714_100382533
220 Ga0070713_100002411
221 Ga0070713_100003434
222 Ga0070713_100015450
223 Ga0070713_100021454
224 Ga0070713_100219093
225 Ga0070700_100099286
226 Ga0070708_100233119
227 Ga0070662_100061181
228 Ga0070681_10244724
229 Ga0070706_100549036
230 Ga0070679_100091499
231 Ga0070679_100181003
232 Ga0070684_100428649
233 Ga0068853_100016988
234 Ga0068853_100087054
235 Ga0068853_100168961
236 Ga0070696_100082379
237 Ga0070693_100005186
238 Ga0070665_100330435
239 Ga0070664_100104123
240 Ga0068856_100015172
241 Ga0070702_100479736
242 Ga0068852_100027987
243 Ga0068852_100422825
244 Ga0068851_10025417
245 Ga0070717_10070362
246 Ga0070717_10082095
247 Ga0070717_10590695
248 Ga0070712_100000867
249 Ga0070712_100347270
250 Ga0075434_100170437
251 Ga0075434_100223946
252 Ga0068865_100318564
253 Ga0075436_100045457
254 Ga0075435_100086077
255 Ga0075435_100209507
256 Ga0105240_10009693
257 Ga0105240_10197589
258 Ga0105240_10201996
259 Ga0111539_10021311
260 Ga0111539_10111717
261 Ga0105245_10003018
262 Ga0105245_10189335
263 Ga0105243_10301276
264 Ga0105242_10592676
265 Ga0105238_10016428
266 Ga0105238_10026836
267 Ga0105249_10367979
268 Ga0099796_10005593
269 Ga0105239_10787810
270 Ga0157373_10015668
271 Ga0157369_10008920
272 Ga0157369_10109731
273 Ga0157369_10558233
274 Ga0157374_10061487
275 Ga0157378_10306253
276 Ga0157378_10367524
277 Ga0163162_10417093
278 Ga0157380_10020378
279 Ga0157380_10463244
280 Ga0157380_10987414
281 Ga0182008_10069800
282 Ga0207692_10085659
283 Ga0207688_10062338
284 Ga0207699_10005969
285 Ga0207699_10186697
286 Ga0207645_10102563
287 Ga0207695_10030978
288 Ga0207693_10001204
289 Ga0207693_10014110
290 Ga0207693_10018962
291 Ga0207663_10075864
292 Ga0207652_10170697
293 Ga0207659_10230065
294 Ga0207687_10012941
295 Ga0207687_10302559
296 Ga0207700_10001425
297 Ga0207700_10005062
298 Ga0207700_10032989
299 Ga0207700_10106591
300 Ga0207700_10488330
301 Ga0207664_10505561
302 Ga0207664_10524742
303 Ga0207706_10087382
304 Ga0207706_10097666
305 Ga0207686_10290284
306 Ga0207669_10176044
307 Ga0207704_10244031
308 Ga0207712_10250001
309 Ga0207677_10184327
310 Ga0207703_10393978
311 Ga0207639_10000013
312 Ga0207639_10134068
313 Ga0207639_10278410
314 Ga0207702_10007382
315 Ga0207702_10213768
316 Ga0207698_10016874
317 Ga0207428_10065461
318 Ga0265340_10129144
319 Ga0307508_10156721
320 Ga0265314_10002205
321 Ga0316576_10000509
322 Ga0307516_10110895
323 Ga0316593_10034441
324 Ga0316593_10070568
325 Ga0316593_10074349
326 Ga0316596_1018027
327 Ga0373923_0037967
328 Ga0373936_0003133
329 Ga0373945_0004630
330 Ga0373943_0006566
331 Ga0373924_0000010
332 Ga0373924_0036983
333 Ga0373931_0147281
334 Ga0373935_0002163
335 Ga0373935_0144331
336 Ga0373935_0271692
337 Ga0373935_0293332
338 Ga0373927_0000618
339 Ga0373927_0064467
340 Ga0373927_0120614
341 Ga0373947_0013133
342 Ga0373947_0023103
343 Ga0373947_0066224
344 Ga0373947_0067793
345 Ga0373947_0356202
346 Ga0373937_0574813
347 Ga0316584_0357668
348 Ga0373925_0043435
349 Ga0373925_0086355
350 Ga0395898_0047274
351 Ga0436364_1010063
352 Ga0400490_35834
353 Ga0400491_13680
354 Ga0400485_09941
355 Ga0400488_11462
356 Ga0400486_28778
357 Ga0400483_056104
358 Ga0400483_082421
359 Ga0400489_28094
360 Ga0400489_70635
361 Ga0400487_10872
362 Ga0400487_59619
363 Ga0436365_1212715
364 Ga0436363_1319301
365 Ga0436363_1506003
366 Ga0436362_1035530
367 Ga0439453_0004086
368 Ga0451853_0714033
369 Ga0439464_0032488
370 Ga0439460_0021160
371 Ga0451577_0119326
372 Ga0453683_0000038
373 Ga0453683_0126098
374 Ga0453684_0001110
375 Ga0453684_0013151
376 Ga0453684_0051032
377 Ga0453684_0108603
378 Ga0453684_0631333
379 Ga0466957_0001216
380 Ga0466957_0475929
381 Ga0495651_0277601
382 Ga0495662_0059896
383 Ga0495664_0237829
384 Ga0495606_0000947
385 Ga0495608_0156279
386 Ga0495628_0471308
387 Ga0495665_0201081
388 Ga0495645_0311200
389 Ga0495667_0056286
390 Ga0495635_0024269
391 Ga0495674_0452293
392 Ga0495593_0034193
393 Ga0495602_0065661
394 Ga0495602_0118685
395 Ga0495602_0205259
396 Ga0495602_0391396
397 Ga0496102_0144183
398 Ga0496104_0039247
399 Ga0496105_0000939
400 Ga0496105_0219161
401 Ga0496112_0000059
402 Ga0496112_0364701
403 Ga0496113_0006471
404 Ga0496114_0138591
405 Ga0496115_0502331
406 Ga0496126_0064612
407 nmdc:mga0k408_300848_c1
408 nmdc:mga08y16_392546_c1
409 nmdc:mga08y16_84715_c1
410 nmdc:mga0rr50_301197_c1
411 nmdc:mga08x19_259840_c1
412 nmdc:mga08x19_648058_c1
413 Ga0495601_0226318
414 Ga0500559_0019564
415 Ga0500573_0000398
416 Ga0500590_016959
417 Ga0500616_0017190
418 Ga0500639_099815
419 Ga0500636_0000979
420 2740991287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

42

257

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zse-assembly1.cif.gz_B molybdenum storage protein in complex with polyoxotungstates in the in-vitro state 0.9469 15 271
6h6w-assembly1.cif.gz_A-3 molybdenum storage protein- h156a 0.9462 31 271
6yt3-assembly1.cif.gz_B structure of the mostonano fusion protein 0.9438 15 272
6ris-assembly1.cif.gz_B the kb42s variant of the molybdenum storage protein 0.9394 15 272
6gwv-assembly2.cif.gz_J molybdenum storage protein without polymolybdate clusters and atp 0.9362 31 271
ID Description Score Start End Superfamily
2ogxA00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9345 30 271 3.40.1160.10
2ogxB00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.923 15 271 3.40.1160.10
2ogxA00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.905 30 271 3.40.1160.10
2ogxB00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.886 15 271 3.40.1160.10
2j4jC00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.8316 40 271 3.40.1160.10
ID Description Score Start End GO Terms
AF-A0A537T700-F1-model_v4 Uridine kinase 0.9854 179 272 GO:0016301
AF-A0A357NBH5-F1-model_v4 Aspartate/glutamate/uridylate kinase domain-containing protein 0.9759 184 271
AF-A0A849Z7D8-F1-model_v4 Uridine kinase 0.9751 164 271 GO:0016301
AF-A0A537T700-F1-model_v4 Uridine kinase 0.9651 179 272 GO:0016301
AF-A0A1E7IQT1-F1-model_v4 Aspartate/glutamate/uridylate kinase domain-containing protein 0.9649 180 272

Map