F320071

General Info

Members Datasets Scaffolds Average Seq Length
210 137 208 184

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100067829|Ga0070663_1000678291
Length 197
Sequence MTSGAGGRPSLMAKLIYTSITSLDGYVADASGSWDWSFPDEEIHAFVNDLERPIGTHLYGRKLYEVLQAWETMDDPAPAMRDYATIWRASDKIVFSRTLDEVSTGRARIEREFDPEAIRALKDTASTDIGIGGPHLAAEALRAGLVDEVGLLVSPVVVGGGNPALPDGVRLDLELLAERRFGNGVVHLRYACSTGHQ

Samples

Sample ID Description Type Environment
1 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
2 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
95 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
96 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
137 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.43
Rhizosphere 97.14
Stem 0
Stem Tuber 0
Unclassified 1.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10009434 3300002077 Bacteria 2001
2 JGI25406J46586_10004544 3300003203 Bacteria 6458
3 Ga0070676_10230613 3300005328 Bacteria 1227
4 Ga0070683_100500540 3300005329 Bacteria 1161
5 Ga0070683_100528935 3300005329 Bacteria 1127
6 Ga0070682_100000011 3300005337 Bacteria 266253
7 Ga0070668_100040990 3300005347 Bacteria 3546
8 Ga0070714_100028029 3300005435 Bacteria 4668
9 Ga0070714_100043665 3300005435 Bacteria 3792
10 Ga0070700_100103005 3300005441 Bacteria 1884
11 Ga0070700_100125629 3300005441 Bacteria 1724
12 Ga0070708_100000581 3300005445 Bacteria 27429
13 Ga0070708_100012271 3300005445 Bacteria 6985
14 Ga0070663_100067829 3300005455 Bacteria 2589
15 Ga0070706_100001942 3300005467 Bacteria 21312
16 Ga0070707_100001043 3300005468 Bacteria 27429
17 Ga0070698_100008006 3300005471 Bacteria 11428
18 Ga0070699_100000922 3300005518 Bacteria 27429
19 Ga0070679_101363277 3300005530 Bacteria 655
20 Ga0070697_100122441 3300005536 Bacteria 2176
21 Ga0070696_100634362 3300005546 Bacteria 865
22 Ga0070693_100594099 3300005547 Bacteria 798
23 Ga0070665_100002426 3300005548 Bacteria 20546
24 Ga0070704_100001598 3300005549 Bacteria 12252
25 Ga0070704_100007099 3300005549 Bacteria 6651
26 Ga0070664_101351387 3300005564 Bacteria 673
27 Ga0068857_100021816 3300005577 Bacteria 5637
28 Ga0068857_101560861 3300005577 Bacteria 644
29 Ga0068854_100000113 3300005578 Bacteria 55436
30 Ga0068856_100248298 3300005614 Bacteria 1795
31 Ga0068866_10014632 3300005718 Bacteria 3469
32 Ga0068866_10448458 3300005718 Bacteria 843
33 Ga0068861_100015269 3300005719 Bacteria 5407
34 Ga0068851_10000873 3300005834 Bacteria 12997
35 Ga0068863_100485192 3300005841 Bacteria 1216
36 Ga0068863_100541512 3300005841 Bacteria 1149
37 Ga0068862_100047014 3300005844 Bacteria 3682
38 Ga0081455_10019737 3300005937 Bacteria 6366
39 Ga0081455_10032428 3300005937 Bacteria 4706
40 Ga0081539_10000170 3300005985 Bacteria 152854
41 Ga0075432_10028526 3300006058 Bacteria 1925
42 Ga0070715_10086838 3300006163 Bacteria 1431
43 Ga0070716_100054380 3300006173 Bacteria 2287
44 Ga0070712_100327297 3300006175 Bacteria 1247
45 Ga0075428_100040616 3300006844 Bacteria 5117
46 Ga0075428_100148226 3300006844 Bacteria 2550
47 Ga0075430_100135340 3300006846 Bacteria 2053
48 Ga0075430_100162335 3300006846 Bacteria 1860
49 Ga0075430_100227606 3300006846 Bacteria 1546
50 Ga0075431_100638938 3300006847 Bacteria 1045
51 Ga0075431_100857273 3300006847 Bacteria 879
52 Ga0075433_10001636 3300006852 Bacteria 16632
53 Ga0075433_10162741 3300006852 Bacteria 1986
54 Ga0075433_10676767 3300006852 Bacteria 904
55 Ga0075434_100073518 3300006871 Bacteria 3411
56 Ga0075429_100086772 3300006880 Bacteria 2727
57 Ga0075429_100127630 3300006880 Bacteria 2224
58 Ga0075429_100289522 3300006880 Bacteria 1434
59 Ga0075429_100808347 3300006880 Bacteria 821
60 Ga0068865_100317118 3300006881 Bacteria 1253
61 Ga0068865_100389481 3300006881 Bacteria 1139
62 Ga0111539_10018035 3300009094 Bacteria 8743
63 Ga0111539_10033060 3300009094 Bacteria 6280
64 Ga0111539_10076072 3300009094 Bacteria 3953
65 Ga0111539_10148335 3300009094 Bacteria 2746
66 Ga0111539_11426776 3300009094 Bacteria 803
67 Ga0114129_10001073 3300009147 Bacteria 35944
68 Ga0114129_10030288 3300009147 Bacteria 7660
69 Ga0114129_10546810 3300009147 Bacteria 1506
70 Ga0114129_11150040 3300009147 Bacteria 969
71 Ga0105249_10009125 3300009553 Bacteria 8673
72 Ga0105249_10661622 3300009553 Bacteria 1103
73 Ga0105249_11047068 3300009553 Bacteria 885
74 Ga0105239_10131586 3300010375 Bacteria 2783
75 Ga0157369_10000455 3300013105 Bacteria 54224
76 Ga0157375_11786756 3300013308 Bacteria 729
77 Ga0157380_10942863 3300014326 Bacteria 892
78 Ga0157379_10312601 3300014968 Bacteria 1433
79 Ga0207656_10001506 3300025321 Bacteria 7719
80 Ga0207642_10179192 3300025899 Bacteria 1153
81 Ga0207685_10057979 3300025905 Bacteria 1521
82 Ga0207699_10007696 3300025906 Bacteria 5274
83 Ga0207645_10166124 3300025907 Bacteria 1445
84 Ga0207684_10001303 3300025910 Bacteria 27445
85 Ga0207652_11038950 3300025921 Bacteria 719
86 Ga0207646_10001621 3300025922 Bacteria 27446
87 Ga0207664_11468780 3300025929 Unclassified 603
88 Ga0207704_10461850 3300025938 Bacteria 1015
89 Ga0207665_10027547 3300025939 Bacteria 3754
90 Ga0207665_10217889 3300025939 Bacteria 1397
91 Ga0207661_10624615 3300025944 Bacteria 990
92 Ga0207712_10025029 3300025961 Bacteria 3961
93 Ga0207668_10004944 3300025972 Bacteria 7842
94 Ga0207640_10000278 3300025981 Bacteria 34363
95 Ga0207708_10146706 3300026075 Bacteria 1855
96 Ga0207708_10176827 3300026075 Bacteria 1693
97 Ga0207708_10276597 3300026075 Bacteria 1359
98 Ga0207641_10768580 3300026088 Bacteria 952
99 Ga0207641_11478320 3300026088 Bacteria 681
100 Ga0207675_100013495 3300026118 Bacteria 7623
101 Ga0207698_10462898 3300026142 Bacteria 1227
102 Ga0207428_10003985 3300027907 Bacteria 14173
103 Ga0207428_10253065 3300027907 Bacteria 1313
104 Ga0268266_10006725 3300028379 Bacteria 10484
105 Ga0268265_10421260 3300028380 Bacteria 1240
106 Ga0268264_11337457 3300028381 Bacteria 727
107 Ga0307405_10426700 3300031731 Bacteria 1045
108 Ga0307405_10546819 3300031731 Bacteria 936
109 Ga0307413_10102513 3300031824 Bacteria 1895
110 Ga0307410_10452796 3300031852 Bacteria 1047
111 Ga0307410_10969221 3300031852 Unclassified 732
112 Ga0307406_10062333 3300031901 Bacteria 2412
113 Ga0307406_10316885 3300031901 Bacteria 1205
114 Ga0307412_10550853 3300031911 Bacteria 969
115 Ga0307409_100170207 3300031995 Bacteria 1917
116 Ga0307409_100588743 3300031995 Bacteria 1098
117 Ga0307409_100608662 3300031995 Bacteria 1081
118 Ga0307409_100970313 3300031995 Bacteria 867
119 Ga0307409_100974006 3300031995 Bacteria 865
120 Ga0307416_100069989 3300032002 Bacteria 2907
121 Ga0307416_100190216 3300032002 Bacteria 1935
122 Ga0307416_100548050 3300032002 Bacteria 1229
123 Ga0307415_100236466 3300032126 Bacteria 1475
124 Ga0307415_100310548 3300032126 Bacteria 1310
125 Ga0307415_100805028 3300032126 Bacteria 858
126 Ga0373926_0271748 3300035083 Bacteria 659
127 Ga0373935_0331420 3300035692 Bacteria 1082
128 Ga0373947_0006866 3300035725 Bacteria 6600
129 Ga0373925_0259684 3300037068 Bacteria 1395
130 Ga0395899_0003467 3300037312 Bacteria 12494
131 Ga0395900_0563595 3300037418 Bacteria 1082
132 Ga0395898_0009290 3300037466 Bacteria 10340
133 Ga0395905_0003633 3300037471 Bacteria 16385
134 Ga0395901_0641324 3300038443 Bacteria 1066
135 Ga0451853_0779971 3300041512 Bacteria 841
136 Ga0439450_036350 3300042008 Bacteria 1127
137 Ga0439446_0117023 3300042156 Bacteria 855
138 Ga0466965_0530940 3300044683 Bacteria 663
139 Ga0466963_0162964 3300044694 Bacteria 1552
140 Ga0466964_0224850 3300044706 Bacteria 913
141 Ga0466957_0562553 3300044842 Unclassified 795
142 Ga0466960_0000037 3300044901 Bacteria 43394
143 Ga0466960_0059749 3300044901 Bacteria 1866
144 Ga0466960_0183215 3300044901 Bacteria 1136
145 Ga0466960_0332302 3300044901 Bacteria 863
146 Ga0466959_0508579 3300045049 Bacteria 814
147 Ga0466967_0053299 3300045976 Bacteria 3554
148 Ga0466967_0068370 3300045976 Bacteria 3171
149 Ga0466967_0138494 3300045976 Bacteria 2265
150 Ga0466967_0490473 3300045976 Bacteria 1204
151 Ga0466967_0878276 3300045976 Bacteria 891
152 Ga0466967_1131427 3300045976 Bacteria 780
153 Ga0495603_0514587 3300046455 Bacteria 685
154 Ga0495629_0001190 3300046459 Bacteria 20523
155 Ga0495650_0000035 3300046471 Bacteria 403799
156 Ga0495580_0100570 3300046472 Bacteria 2011
157 Ga0495582_0000637 3300046473 Bacteria 19320
158 Ga0495582_0254442 3300046473 Bacteria 1007
159 Ga0495639_0006075 3300046475 Bacteria 5189
160 Ga0495639_0046287 3300046475 Bacteria 1969
161 Ga0495662_0202625 3300046476 Bacteria 978
162 Ga0495584_0042473 3300046491 Bacteria 2295
163 Ga0495594_0137877 3300046499 Bacteria 1383
164 Ga0495630_0232271 3300046517 Bacteria 1409
165 Ga0495665_0058304 3300046531 Bacteria 2039
166 Ga0495656_0066206 3300046615 Bacteria 1591
167 Ga0495588_0030971 3300046674 Bacteria 2691
168 Ga0495647_0014686 3300046681 Bacteria 2732
169 Ga0495647_0095431 3300046681 Bacteria 1225
170 Ga0495658_0000215 3300046683 Bacteria 33018
171 Ga0495658_0120874 3300046683 Bacteria 1584
172 Ga0495613_0000355 3300046689 Bacteria 40525
173 Ga0495613_0337015 3300046689 Bacteria 1038
174 Ga0495624_0162705 3300046690 Bacteria 1363
175 Ga0495624_0494809 3300046690 Bacteria 732
176 Ga0495581_0002201 3300047315 Bacteria 10994
177 Ga0495581_0005974 3300047315 Bacteria 7052
178 Ga0495581_0227784 3300047315 Bacteria 1090
179 Ga0495676_0022553 3300047321 Bacteria 5476
180 Ga0495676_0027396 3300047321 Bacteria 4887
181 Ga0495676_0043098 3300047321 Bacteria 3697
182 Ga0496105_0703803 3300048908 Unclassified 775
183 Ga0496109_0654123 3300048912 Bacteria 988
184 Ga0496110_0022922 3300048913 Bacteria 5306
185 Ga0496117_0001250 3300048920 Bacteria 37864
186 Ga0501034_0005460 3300049571 Bacteria 13884
187 Ga0501047_0154715 3300049581 Bacteria 2167
188 Ga0501044_0460438 3300049823 Unclassified 1177
189 nmdc:mga05p37_117710_c1 3300050507 Bacteria 3265
190 nmdc:mga05p37_724745_c1 3300050507 Bacteria 1101
191 nmdc:mga05p37_91212_c1 3300050507 Bacteria 3755
192 nmdc:mga09592_270575_c1 3300050508 Bacteria 1474
193 nmdc:mga09592_275710_c1 3300050508 Bacteria 1459
194 nmdc:mga09592_707564_c1 3300050508 Bacteria 857
195 nmdc:mga09592_89204_c1 3300050508 Bacteria 2633
196 nmdc:mga0qj67_170388_c1 3300050509 Bacteria 1768
197 nmdc:mga0qj67_356069_c1 3300050509 Bacteria 1183
198 nmdc:mga0qj67_658304_c1 3300050509 Bacteria 835
199 nmdc:mga06r32_686813_c1 3300050510 Bacteria 990
200 nmdc:mga06r32_727631_c1 3300050510 Bacteria 957
201 nmdc:mga08y16_148388_c1 3300050511 Bacteria 2437
202 nmdc:mga08y16_236516_c1 3300050511 Bacteria 1889
203 nmdc:mga08y16_48271_c1 3300050511 Bacteria 4456
204 nmdc:mga0n895_1096577_c1 3300050512 Bacteria 774
205 nmdc:mga0n895_1338103_c1 3300050512 Bacteria 686
206 nmdc:mga0a205_20350_c1 3300050515 Bacteria 6259
207 Ga0495655_0039677 3300053083 Bacteria 1195
208 Ga0466962_0045728 3300061719 Bacteria 2092

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005577 Ga0068857_100021816 Ga0068857_1000218163 149
2 3300035083 Ga0373926_0271748 Ga0373926_0271748_139_648 169
3 3300035692 Ga0373935_0331420 Ga0373935_0331420_73_633 170
4 3300046473 Ga0495582_0254442 Ga0495582_0254442_284_844 170
5 3300046475 Ga0495639_0046287 Ga0495639_0046287_1338_1898 170
6 3300046499 Ga0495594_0137877 Ga0495594_0137877_734_1294 170
7 3300046531 Ga0495665_0058304 Ga0495665_0058304_1328_1888 170
8 3300046681 Ga0495647_0014686 Ga0495647_0014686_1882_2442 170
9 3300046683 Ga0495658_0120874 Ga0495658_0120874_250_810 170
10 3300046689 Ga0495613_0337015 Ga0495613_0337015_214_774 170
11 3300047315 Ga0495581_0005974 Ga0495581_0005974_2420_2980 170
12 3300047321 Ga0495676_0043098 Ga0495676_0043098_1015_1575 170
13 3300046455 Ga0495603_0514587 Ga0495603_0514587_36_596 172
14 3300049581 Ga0501047_0154715 Ga0501047_0154715_1141_1695 175
15 3300049823 Ga0501044_0460438 Ga0501044_0460438_522_1076 175
16 3300005445 Ga0070708_100000581 Ga0070708_10000058130 177
17 3300005467 Ga0070706_100001942 Ga0070706_10000194224 177
18 3300005468 Ga0070707_100001043 Ga0070707_10000104330 177
19 3300005518 Ga0070699_100000922 Ga0070699_10000092230 177
20 3300005549 Ga0070704_100001598 Ga0070704_10000159816 177
21 3300025910 Ga0207684_10001303 Ga0207684_1000130328 177
22 3300025922 Ga0207646_10001621 Ga0207646_1000162128 177
23 3300048913 Ga0496110_0022922 Ga0496110_0022922_4723_5283 178
24 iso_pu_bacteria 2738541308 2738886858 178
25 3300048920 Ga0496117_0001250 Ga0496117_0001250_15736_16299 179
26 3300044683 Ga0466965_0530940 Ga0466965_0530940_41_583 180
27 3300044694 Ga0466963_0162964 Ga0466963_0162964_381_923 180
28 3300044706 Ga0466964_0224850 Ga0466964_0224850_289_831 180
29 3300045976 Ga0466967_0053299 Ga0466967_0053299_2749_3291 180
30 3300045976 Ga0466967_0068370 Ga0466967_0068370_2034_2576 180
31 3300061719 Ga0466962_0045728 Ga0466962_0045728_1260_1802 180
32 iso_pu_bacteria 2935409751 2935409890 180
33 3300005328 Ga0070676_10230613 Ga0070676_102306132 181
34 3300005329 Ga0070683_100500540 Ga0070683_1005005401 181
35 3300005441 Ga0070700_100125629 Ga0070700_1001256292 181
36 3300005564 Ga0070664_101351387 Ga0070664_1013513871 181
37 3300005718 Ga0068866_10448458 Ga0068866_104484582 181
38 3300006881 Ga0068865_100317118 Ga0068865_1003171182 181
39 3300009094 Ga0111539_11426776 Ga0111539_114267761 181
40 3300009553 Ga0105249_11047068 Ga0105249_110470682 181
41 3300014326 Ga0157380_10942863 Ga0157380_109428631 181
42 3300025907 Ga0207645_10166124 Ga0207645_101661242 181
43 3300026075 Ga0207708_10146706 Ga0207708_101467063 181
44 3300028380 Ga0268265_10421260 Ga0268265_104212604 181
45 3300042008 Ga0439450_036350 Ga0439450_036350_414_971 181
46 3300045976 Ga0466967_0490473 Ga0466967_0490473_522_1067 181
47 3300045976 Ga0466967_0878276 Ga0466967_0878276_123_668 181
48 3300045976 Ga0466967_1131427 Ga0466967_1131427_200_745 181
49 3300005548 Ga0070665_100002426 Ga0070665_1000024268 182
50 3300026075 Ga0207708_10276597 Ga0207708_102765972 182
51 3300028379 Ga0268266_10006725 Ga0268266_100067258 182
52 3300037312 Ga0395899_0003467 Ga0395899_0003467_9140_9691 182
53 3300037418 Ga0395900_0563595 Ga0395900_0563595_207_758 182
54 3300037466 Ga0395898_0009290 Ga0395898_0009290_9141_9692 182
55 3300038443 Ga0395901_0641324 Ga0395901_0641324_20_571 182
56 3300048908 Ga0496105_0703803 Ga0496105_0703803_151_699 182
57 3300053083 Ga0495655_0039677 Ga0495655_0039677_309_857 182
58 3300003203 JGI25406J46586_10004544 JGI25406J46586_100045446 183
59 3300005329 Ga0070683_100528935 Ga0070683_1005289352 183
60 3300005435 Ga0070714_100043665 Ga0070714_1000436653 183
61 3300005441 Ga0070700_100103005 Ga0070700_1001030052 183
62 3300005455 Ga0070663_100067829 Ga0070663_1000678291 183
63 3300005530 Ga0070679_101363277 Ga0070679_1013632771 183
64 3300005577 Ga0068857_101560861 Ga0068857_1015608611 183
65 3300005841 Ga0068863_100541512 Ga0068863_1005415122 183
66 3300005937 Ga0081455_10019737 Ga0081455_100197372 183
67 3300005985 Ga0081539_10000170 Ga0081539_1000017071 183
68 3300006175 Ga0070712_100327297 Ga0070712_1003272971 183
69 3300006881 Ga0068865_100389481 Ga0068865_1003894812 183
70 3300009094 Ga0111539_10148335 Ga0111539_101483353 183
71 3300025921 Ga0207652_11038950 Ga0207652_110389501 183
72 3300025938 Ga0207704_10461850 Ga0207704_104618502 183
73 3300025939 Ga0207665_10217889 Ga0207665_102178892 183
74 3300025944 Ga0207661_10624615 Ga0207661_106246152 183
75 3300026075 Ga0207708_10176827 Ga0207708_101768272 183
76 3300026088 Ga0207641_10768580 Ga0207641_107685802 183
77 3300026142 Ga0207698_10462898 Ga0207698_104628982 183
78 3300028381 Ga0268264_11337457 Ga0268264_113374572 183
79 3300031852 Ga0307410_10969221 Ga0307410_109692212 183
80 3300032126 Ga0307415_100805028 Ga0307415_1008050282 183
81 3300045976 Ga0466967_0138494 Ga0466967_0138494_490_1050 183
82 3300046471 Ga0495650_0000035 Ga0495650_0000035_91509_92060 183
83 3300048912 Ga0496109_0654123 Ga0496109_0654123_339_893 183
84 3300050511 nmdc:mga08y16_148388_c1 nmdc:mga08y16_148388_c1_1658_2212 183
85 3300005536 Ga0070697_100122441 Ga0070697_1001224413 184
86 3300006058 Ga0075432_10028526 Ga0075432_100285261 184
87 3300006844 Ga0075428_100040616 Ga0075428_1000406164 184
88 3300006844 Ga0075428_100148226 Ga0075428_1001482263 184
89 3300006852 Ga0075433_10001636 Ga0075433_1000163617 184
90 3300006852 Ga0075433_10162741 Ga0075433_101627412 184
91 3300006871 Ga0075434_100073518 Ga0075434_1000735182 184
92 3300006880 Ga0075429_100289522 Ga0075429_1002895223 184
93 3300006880 Ga0075429_100808347 Ga0075429_1008083472 184
94 3300009094 Ga0111539_10033060 Ga0111539_100330605 184
95 3300009147 Ga0114129_10001073 Ga0114129_1000107342 184
96 3300009147 Ga0114129_10030288 Ga0114129_100302885 184
97 3300027907 Ga0207428_10003985 Ga0207428_100039855 184
98 3300031731 Ga0307405_10426700 Ga0307405_104267002 184
99 3300031901 Ga0307406_10316885 Ga0307406_103168852 184
100 3300031995 Ga0307409_100170207 Ga0307409_1001702072 184
101 3300031995 Ga0307409_100970313 Ga0307409_1009703132 184
102 3300031995 Ga0307409_100974006 Ga0307409_1009740062 184
103 3300032002 Ga0307416_100069989 Ga0307416_1000699893 184
104 3300032002 Ga0307416_100548050 Ga0307416_1005480502 184
105 3300032126 Ga0307415_100236466 Ga0307415_1002364662 184
106 3300035725 Ga0373947_0006866 Ga0373947_0006866_5802_6356 184
107 3300037068 Ga0373925_0259684 Ga0373925_0259684_491_1045 184
108 3300037471 Ga0395905_0003633 Ga0395905_0003633_14266_14823 184
109 3300044901 Ga0466960_0183215 Ga0466960_0183215_124_681 184
110 3300046459 Ga0495629_0001190 Ga0495629_0001190_11593_12147 184
111 3300046473 Ga0495582_0000637 Ga0495582_0000637_13261_13815 184
112 3300046475 Ga0495639_0006075 Ga0495639_0006075_2875_3429 184
113 3300046476 Ga0495662_0202625 Ga0495662_0202625_410_964 184
114 3300046491 Ga0495584_0042473 Ga0495584_0042473_561_1118 184
115 3300046517 Ga0495630_0232271 Ga0495630_0232271_680_1234 184
116 3300046683 Ga0495658_0000215 Ga0495658_0000215_29147_29701 184
117 3300046689 Ga0495613_0000355 Ga0495613_0000355_3637_4191 184
118 3300046690 Ga0495624_0162705 Ga0495624_0162705_579_1133 184
119 3300047315 Ga0495581_0002201 Ga0495581_0002201_9262_9816 184
120 3300047321 Ga0495676_0022553 Ga0495676_0022553_741_1295 184
121 3300050507 nmdc:mga05p37_117710_c1 nmdc:mga05p37_117710_c1_1923_2480 184
122 3300050507 nmdc:mga05p37_91212_c1 nmdc:mga05p37_91212_c1_2597_3154 184
123 3300050508 nmdc:mga09592_275710_c1 nmdc:mga09592_275710_c1_682_1239 184
124 3300050508 nmdc:mga09592_707564_c1 nmdc:mga09592_707564_c1_75_632 184
125 3300050509 nmdc:mga0qj67_658304_c1 nmdc:mga0qj67_658304_c1_160_717 184
126 3300050511 nmdc:mga08y16_48271_c1 nmdc:mga08y16_48271_c1_713_1270 184
127 3300050512 nmdc:mga0n895_1096577_c1 nmdc:mga0n895_1096577_c1_105_662 184
128 3300050512 nmdc:mga0n895_1338103_c1 nmdc:mga0n895_1338103_c1_96_662 184
129 3300050515 nmdc:mga0a205_20350_c1 nmdc:mga0a205_20350_c1_741_1298 184
130 3300005337 Ga0070682_100000011 Ga0070682_100000011114 185
131 3300005347 Ga0070668_100040990 Ga0070668_1000409905 185
132 3300005546 Ga0070696_100634362 Ga0070696_1006343622 185
133 3300005547 Ga0070693_100594099 Ga0070693_1005940991 185
134 3300005614 Ga0068856_100248298 Ga0068856_1002482982 185
135 3300005719 Ga0068861_100015269 Ga0068861_1000152692 185
136 3300005844 Ga0068862_100047014 Ga0068862_1000470143 185
137 3300009553 Ga0105249_10009125 Ga0105249_100091251 185
138 3300013105 Ga0157369_10000455 Ga0157369_1000045546 185
139 3300013308 Ga0157375_11786756 Ga0157375_117867561 185
140 3300025961 Ga0207712_10025029 Ga0207712_100250291 185
141 3300025972 Ga0207668_10004944 Ga0207668_100049443 185
142 3300026118 Ga0207675_100013495 Ga0207675_1000134956 185
143 3300031731 Ga0307405_10546819 Ga0307405_105468192 185
144 3300031824 Ga0307413_10102513 Ga0307413_101025132 185
145 3300031852 Ga0307410_10452796 Ga0307410_104527962 185
146 3300031901 Ga0307406_10062333 Ga0307406_100623333 185
147 3300031911 Ga0307412_10550853 Ga0307412_105508531 185
148 3300031995 Ga0307409_100608662 Ga0307409_1006086622 185
149 3300032126 Ga0307415_100310548 Ga0307415_1003105482 185
150 3300041512 Ga0451853_0779971 Ga0451853_0779971_117_692 185
151 3300042156 Ga0439446_0117023 Ga0439446_0117023_25_585 185
152 3300044901 Ga0466960_0059749 Ga0466960_0059749_711_1268 185
153 3300046472 Ga0495580_0100570 Ga0495580_0100570_1289_1846 185
154 3300046615 Ga0495656_0066206 Ga0495656_0066206_634_1191 185
155 3300046674 Ga0495588_0030971 Ga0495588_0030971_776_1333 185
156 3300046681 Ga0495647_0095431 Ga0495647_0095431_488_1045 185
157 3300047315 Ga0495581_0227784 Ga0495581_0227784_78_635 185
158 3300047321 Ga0495676_0027396 Ga0495676_0027396_1685_2242 185
159 3300002077 JGI24744J21845_10009434 JGI24744J21845_100094342 186
160 3300005435 Ga0070714_100028029 Ga0070714_1000280292 186
161 3300005445 Ga0070708_100012271 Ga0070708_1000122717 186
162 3300005471 Ga0070698_100008006 Ga0070698_1000080062 186
163 3300005549 Ga0070704_100007099 Ga0070704_1000070997 186
164 3300005578 Ga0068854_100000113 Ga0068854_10000011319 186
165 3300005718 Ga0068866_10014632 Ga0068866_100146324 186
166 3300005834 Ga0068851_10000873 Ga0068851_1000087311 186
167 3300005841 Ga0068863_100485192 Ga0068863_1004851921 186
168 3300005937 Ga0081455_10032428 Ga0081455_100324283 186
169 3300006163 Ga0070715_10086838 Ga0070715_100868382 186
170 3300006173 Ga0070716_100054380 Ga0070716_1000543803 186
171 3300006846 Ga0075430_100135340 Ga0075430_1001353404 186
172 3300006846 Ga0075430_100162335 Ga0075430_1001623352 186
173 3300006846 Ga0075430_100227606 Ga0075430_1002276062 186
174 3300006847 Ga0075431_100638938 Ga0075431_1006389382 186
175 3300006847 Ga0075431_100857273 Ga0075431_1008572732 186
176 3300006852 Ga0075433_10676767 Ga0075433_106767671 186
177 3300006880 Ga0075429_100086772 Ga0075429_1000867722 186
178 3300006880 Ga0075429_100127630 Ga0075429_1001276302 186
179 3300009094 Ga0111539_10018035 Ga0111539_1001803514 186
180 3300009094 Ga0111539_10076072 Ga0111539_100760724 186
181 3300009147 Ga0114129_10546810 Ga0114129_105468103 186
182 3300009147 Ga0114129_11150040 Ga0114129_111500402 186
183 3300009553 Ga0105249_10661622 Ga0105249_106616221 186
184 3300010375 Ga0105239_10131586 Ga0105239_101315863 186
185 3300014968 Ga0157379_10312601 Ga0157379_103126012 186
186 3300025321 Ga0207656_10001506 Ga0207656_1000150610 186
187 3300025899 Ga0207642_10179192 Ga0207642_101791922 186
188 3300025905 Ga0207685_10057979 Ga0207685_100579792 186
189 3300025906 Ga0207699_10007696 Ga0207699_100076965 186
190 3300025929 Ga0207664_11468780 Ga0207664_114687801 186
191 3300025939 Ga0207665_10027547 Ga0207665_100275476 186
192 3300025981 Ga0207640_10000278 Ga0207640_1000027825 186
193 3300026088 Ga0207641_11478320 Ga0207641_114783201 186
194 3300027907 Ga0207428_10253065 Ga0207428_102530653 186
195 3300031995 Ga0307409_100588743 Ga0307409_1005887432 186
196 3300032002 Ga0307416_100190216 Ga0307416_1001902162 186
197 3300044842 Ga0466957_0562553 Ga0466957_0562553_104_667 186
198 3300044901 Ga0466960_0000037 Ga0466960_0000037_14905_15468 186
199 3300044901 Ga0466960_0332302 Ga0466960_0332302_131_694 186
200 3300045049 Ga0466959_0508579 Ga0466959_0508579_130_693 186
201 3300046690 Ga0495624_0494809 Ga0495624_0494809_27_617 186
202 3300049571 Ga0501034_0005460 Ga0501034_0005460_6506_7069 186
203 3300050507 nmdc:mga05p37_724745_c1 nmdc:mga05p37_724745_c1_77_667 186
204 3300050508 nmdc:mga09592_270575_c1 nmdc:mga09592_270575_c1_594_1184 186
205 3300050508 nmdc:mga09592_89204_c1 nmdc:mga09592_89204_c1_1874_2455 186
206 3300050509 nmdc:mga0qj67_170388_c1 nmdc:mga0qj67_170388_c1_419_1009 186
207 3300050509 nmdc:mga0qj67_356069_c1 nmdc:mga0qj67_356069_c1_398_979 186
208 3300050510 nmdc:mga06r32_686813_c1 nmdc:mga06r32_686813_c1_158_739 186
209 3300050510 nmdc:mga06r32_727631_c1 nmdc:mga06r32_727631_c1_161_742 186
210 3300050511 nmdc:mga08y16_236516_c1 nmdc:mga08y16_236516_c1_23_604 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

13

187

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8324 2 185
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8184 2 185
2gd9-assembly1.cif.gz_A crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8167 2 183
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8139 2 185
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8082 1 183
ID Description Score Start End Superfamily
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8256 3 182 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8159 3 182 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8024 2 186 3.40.430.10
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7932 3 185 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.793 1 183 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A7V9R701-F1-model_v4 Dihydrofolate reductase family protein 0.9964 1 185 GO:0008703
GO:0009231
AF-A0A2N3YZ04-F1-model_v4 deleted 0.994 1 186
AF-A0A7V9J129-F1-model_v4 Dihydrofolate reductase family protein 0.9905 49 186 GO:0008703
GO:0009231
AF-A0A536R3V8-F1-model_v4 Deaminase 0.9904 1 164 GO:0008703
GO:0009231
AF-A0A7V9R701-F1-model_v4 Dihydrofolate reductase family protein 0.9857 1 185 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
96.55 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map