F319793

General Info

Members Datasets Scaffolds Average Seq Length
209 150 418 272

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2997600082|2997605919
Length 313
Sequence YVPPVWSGVEIAVPVPSDRLPGISMAGFRQRVAAPVDIAMVAHPSVTLLIDLSDDRGLVCDTQGRHGRGSVVIGLAPGELRASGLVGECLQIRLQPGVAAAVLGSSAGAGGSVESLADVWGRDAVRIEERLRTAGSWGERFAMVADVVRRRTGDGLRVDPEVAHIWRRTVAGRGRVRIDGLAEEVGWSRKRLWARFRGQLGITPKRAAQLVRFDHAAHLLAAGLPPAGVAAESGYVDQPHLHRDVKAFTGLTPTAVAAAPWLAIDDVAWPDSWRAGRPVTGDAPGPGRRPGAGVRPDVDAHRPHLRRTGVGSG

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
35 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
36 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
37 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
38 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
39 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
40 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
41 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
42 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
43 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
44 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
45 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
46 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
47 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
48 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
49 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
50 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
51 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
52 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
53 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
54 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
57 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
58 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
61 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
62 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
63 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
64 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
65 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
66 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
67 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
68 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
69 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
70 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
71 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
72 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
73 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
74 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
75 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
76 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
77 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
80 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
81 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
86 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
87 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
96 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
101 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
102 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
110 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
113 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
114 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
115 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
124 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
125 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
127 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
128 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
129 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
130 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
131 2643221714 Streptomyces sp. Root264 Isolate Unclassified
132 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
133 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
134 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
135 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
136 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
137 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
138 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
139 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
140 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
141 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
142 2891562705 Microbispora tritici MT50 Isolate Unclassified
143 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
144 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
145 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
146 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
147 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
148 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
149 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
150 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.52
Metatranscriptomes 0
Isolates 11.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.78
Nodule 0
Rhizoplane 0.96
Rhizosphere 81.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10007124 3300003316 Bacteria 10904
2 rootH1_10130597 3300003316 Bacteria 1683
3 rootH2_10008570 3300003320 Bacteria 18848
4 rootL2_10063211 3300003322 Bacteria 10745
5 rootH1_10007626 3300003323 Bacteria 14736
6 Ga0070671_100159113 3300005355 Bacteria 1909
7 Ga0070714_100352280 3300005435 Bacteria 1383
8 Ga0070713_100002575 3300005436 Bacteria 11851
9 Ga0070713_100218211 3300005436 Bacteria 1729
10 Ga0070710_10044321 3300005437 Bacteria 2468
11 Ga0070711_100006309 3300005439 Bacteria 7138
12 Ga0070706_100208730 3300005467 Bacteria 1824
13 Ga0068856_100013036 3300005614 Bacteria 8050
14 Ga0068864_100413174 3300005618 Bacteria 1284
15 Ga0081455_10002943 3300005937 Bacteria 19945
16 Ga0075365_10001024 3300006038 Bacteria 11997
17 Ga0075368_10001247 3300006042 Bacteria 8047
18 Ga0075363_100000752 3300006048 Bacteria 11078
19 Ga0075364_10003070 3300006051 Bacteria 9437
20 Ga0075364_10034426 3300006051 Bacteria 3267
21 Ga0075367_10008322 3300006178 Bacteria 5372
22 Ga0075366_10074743 3300006195 Bacteria 2021
23 Ga0075370_10000341 3300006353 Bacteria 16842
24 Ga0075428_100005600 3300006844 Bacteria 13950
25 Ga0075428_100633405 3300006844 Bacteria 1141
26 Ga0075430_100065880 3300006846 Bacteria 3042
27 Ga0075431_100013666 3300006847 Bacteria 8205
28 Ga0075431_100015508 3300006847 Bacteria 7722
29 Ga0075429_100107010 3300006880 Bacteria 2444
30 Ga0105251_10058257 3300009011 Bacteria 1824
31 Ga0105248_10008332 3300009177 Bacteria 11390
32 Ga0207713_1096120 3300025735 Bacteria 1031
33 Ga0207692_10074295 3300025898 Bacteria 1801
34 Ga0207684_10139810 3300025910 Bacteria 2081
35 Ga0207663_10019396 3300025916 Bacteria 3830
36 Ga0207700_10076695 3300025928 Bacteria 2594
37 Ga0207700_10087745 3300025928 Bacteria 2447
38 Ga0207689_10424160 3300025942 Bacteria 1110
39 Ga0207702_10004761 3300026078 Bacteria 11974
40 Ga0307515_10043926 3300028794 Bacteria 6929
41 Ga0307513_10045619 3300031456 Bacteria 4788
42 Ga0307509_10020304 3300031507 Bacteria 7538
43 Ga0307516_10065897 3300031730 Bacteria 3496
44 Ga0307516_10087517 3300031730 Bacteria 2949
45 Ga0307516_10221269 3300031730 Bacteria 1602
46 Ga0307507_10062911 3300033179 Bacteria 3441
47 Ga0373945_0052792 3300035116 Bacteria 1499
48 Ga0373946_0093643 3300035171 Bacteria 1335
49 Ga0373955_0039490 3300035172 Bacteria 2520
50 Ga0373924_0052138 3300035410 Bacteria 1697
51 Ga0373935_0087610 3300035692 Bacteria 2033
52 Ga0373947_0175428 3300035725 Bacteria 1393
53 Ga0373937_0082761 3300036401 Bacteria 2969
54 Ga0373937_0432994 3300036401 Bacteria 1248
55 Ga0373925_0013638 3300037068 Bacteria 5884
56 Ga0373925_0039065 3300037068 Bacteria 3511
57 Ga0373925_0679369 3300037068 Bacteria 849
58 Ga0395898_0234516 3300037466 Bacteria 1750
59 Ga0451853_0581594 3300041512 Bacteria 5030
60 Ga0451853_1616540 3300041512 Bacteria 1562
61 Ga0466969_0036122 3300044656 Bacteria 2497
62 Ga0466969_0119087 3300044656 Bacteria 1230
63 Ga0466965_0000170 3300044683 Bacteria 19940
64 Ga0466966_0003775 3300044684 Bacteria 9991
65 Ga0466966_0184176 3300044684 Bacteria 1266
66 Ga0466961_0013771 3300044693 Bacteria 5183
67 Ga0466961_0032916 3300044693 Bacteria 3330
68 Ga0466963_0001375 3300044694 Bacteria 13021
69 Ga0466971_0006567 3300044719 Bacteria 5053
70 Ga0466970_0009136 3300044765 Bacteria 5003
71 Ga0466957_0037159 3300044842 Bacteria 2931
72 Ga0466960_0044985 3300044901 Bacteria 2107
73 Ga0466959_0011203 3300045049 Bacteria 6432
74 Ga0466959_0075472 3300045049 Bacteria 2435
75 Ga0466967_0267595 3300045976 Bacteria 1637
76 Ga0495592_0052331 3300046454 Bacteria 3032
77 Ga0495603_0059842 3300046455 Bacteria 2251
78 Ga0495629_0035761 3300046459 Bacteria 3509
79 Ga0495629_0049214 3300046459 Bacteria 2954
80 Ga0495641_0014660 3300046461 Bacteria 4231
81 Ga0495651_0094470 3300046462 Bacteria 2237
82 Ga0495651_0198636 3300046462 Bacteria 1405
83 Ga0495653_0019025 3300046463 Bacteria 5573
84 Ga0495653_0108044 3300046463 Bacteria 2004
85 Ga0495605_0003279 3300046474 Bacteria 9701
86 Ga0495662_0024679 3300046476 Bacteria 2901
87 Ga0495662_0042446 3300046476 Bacteria 2195
88 Ga0495664_0099906 3300046477 Bacteria 1747
89 Ga0495664_0235590 3300046477 Bacteria 1107
90 Ga0495585_0069805 3300046492 Bacteria 1917
91 Ga0495594_0141651 3300046499 Bacteria 1364
92 Ga0495583_0023173 3300046506 Bacteria 3146
93 Ga0495583_0055414 3300046506 Bacteria 1791
94 Ga0495606_0010158 3300046507 Bacteria 7852
95 Ga0495608_0038813 3300046511 Bacteria 3196
96 Ga0495610_0046764 3300046512 Bacteria 2133
97 Ga0495616_0013476 3300046513 Bacteria 4611
98 Ga0495618_0092545 3300046514 Bacteria 1933
99 Ga0495620_0001170 3300046515 Bacteria 16068
100 Ga0495620_0006042 3300046515 Bacteria 6701
101 Ga0495628_0107805 3300046516 Bacteria 2144
102 Ga0495643_0050389 3300046522 Bacteria 2242
103 Ga0495648_0059362 3300046524 Bacteria 2282
104 Ga0495648_0156436 3300046524 Bacteria 1183
105 Ga0495666_0052920 3300046526 Bacteria 1949
106 Ga0495652_0008744 3300046529 Bacteria 9218
107 Ga0495665_0038337 3300046531 Bacteria 2555
108 Ga0495640_0003046 3300046533 Bacteria 13488
109 Ga0495640_0081898 3300046533 Bacteria 2145
110 Ga0495586_0067582 3300046535 Bacteria 1949
111 Ga0495586_0279608 3300046535 Bacteria 955
112 Ga0495587_0028295 3300046536 Bacteria 3408
113 Ga0495587_0070970 3300046536 Bacteria 2026
114 Ga0495597_0009726 3300046542 Bacteria 4735
115 Ga0495597_0047600 3300046542 Bacteria 1898
116 Ga0495645_0097761 3300046543 Bacteria 2090
117 Ga0495645_0112678 3300046543 Bacteria 1923
118 Ga0495645_0248452 3300046543 Bacteria 1183
119 Ga0495645_0258090 3300046543 Bacteria 1155
120 Ga0495667_0267497 3300046559 Bacteria 1086
121 Ga0495668_0023933 3300046616 Bacteria 3476
122 Ga0495634_0054415 3300046642 Bacteria 2679
123 Ga0495634_0170402 3300046642 Bacteria 1368
124 Ga0495611_0093159 3300046648 Bacteria 1393
125 Ga0495611_0192087 3300046648 Bacteria 953
126 Ga0495625_0087573 3300046660 Bacteria 2158
127 Ga0495635_0161416 3300046663 Bacteria 1525
128 Ga0495635_0366106 3300046663 Bacteria 960
129 Ga0495657_0004333 3300046675 Bacteria 11339
130 Ga0495657_0008690 3300046675 Bacteria 7752
131 Ga0495657_0091571 3300046675 Bacteria 1949
132 Ga0495599_0025763 3300046678 Bacteria 3683
133 Ga0495646_0014794 3300046680 Bacteria 4960
134 Ga0495658_0033516 3300046683 Bacteria 2814
135 Ga0495658_0114039 3300046683 Bacteria 1628
136 Ga0495613_0004388 3300046689 Bacteria 10556
137 Ga0495613_0015321 3300046689 Bacteria 5698
138 Ga0495613_0061997 3300046689 Bacteria 2737
139 Ga0495613_0090194 3300046689 Bacteria 2220
140 Ga0495624_0006761 3300046690 Bacteria 8104
141 Ga0495624_0026457 3300046690 Bacteria 3802
142 Ga0495624_0045027 3300046690 Bacteria 2811
143 Ga0495624_0217145 3300046690 Bacteria 1160
144 Ga0495624_0217352 3300046690 Bacteria 1159
145 Ga0495649_0109109 3300046694 Bacteria 1468
146 Ga0495589_0036831 3300046794 Bacteria 2452
147 Ga0495600_0039094 3300046809 Bacteria 3089
148 Ga0495660_0085737 3300046810 Bacteria 1645
149 Ga0495604_0071925 3300047317 Bacteria 2615
150 Ga0495604_0175613 3300047317 Bacteria 1502
151 Ga0495604_0230495 3300047317 Bacteria 1270
152 Ga0495674_0017097 3300047319 Bacteria 6756
153 Ga0495674_0080584 3300047319 Bacteria 2794
154 Ga0495674_0179428 3300047319 Bacteria 1764
155 Ga0495674_0304797 3300047319 Bacteria 1300
156 Ga0495676_0005869 3300047321 Bacteria 11269
157 Ga0495676_0296133 3300047321 Bacteria 1092
158 Ga0495680_0054783 3300047322 Bacteria 3095
159 Ga0495680_0078010 3300047322 Bacteria 2507
160 Ga0495680_0151807 3300047322 Bacteria 1688
161 Ga0495683_0058335 3300047323 Bacteria 1917
162 Ga0495687_025184 3300047443 Bacteria 2817
163 Ga0495687_057380 3300047443 Bacteria 1619
164 Ga0495675_0030021 3300047444 Bacteria 3469
165 Ga0495685_014078 3300047447 Bacteria 2715
166 Ga0495685_019726 3300047447 Bacteria 2316
167 Ga0495684_0130193 3300047471 Bacteria 1890
168 Ga0495593_0008747 3300047673 Bacteria 5880
169 Ga0495593_0008758 3300047673 Bacteria 5875
170 Ga0495593_0017556 3300047673 Bacteria 4027
171 Ga0495593_0116089 3300047673 Bacteria 1364
172 Ga0495614_0009007 3300048089 Bacteria 4429
173 Ga0496109_0152965 3300048912 Bacteria 2160
174 Ga0496109_0303756 3300048912 Bacteria 1505
175 Ga0501038_0056164 3300049574 Bacteria 3381
176 Ga0501047_0011665 3300049581 Bacteria 8308
177 Ga0501047_0444476 3300049581 Bacteria 1126
178 nmdc:mga05p37_128779_c1 3300050507 Bacteria 3107
179 nmdc:mga09592_8492_c1 3300050508 Bacteria 8354
180 nmdc:mga0qj67_27807_c1 3300050509 Bacteria 4385
181 nmdc:mga06r32_10808_c1 3300050510 Bacteria 8225
182 Ga0495601_0036021 3300053077 Bacteria 3090
183 Ga0500560_021997 3300053107 Bacteria 1830
184 Ga0500573_0106332 3300053140 Bacteria 1575
185 Ga0466962_0000239 3300061719 Bacteria 22995
186 2997605919 2997600082 Bacteria 9896405
187 2515856427 2515154155 Bacteria 7985436
188 2558909768 2558860112 Bacteria 9931328
189 2616698406 2616644814 Bacteria 11555299
190 2644627653 2643221714 Bacteria 9015452
191 2676491076 2675903060 Bacteria 10051191
192 2768644220 2767802112 Bacteria 6465194
193 2819746003 2818991472 Bacteria 10089953
194 2856742166 2856741275 Bacteria 8096094
195 2862178789 2862178590 Bacteria 8583590
196 2870723297 2870721527 Bacteria 9689237
197 2873320535 2873314349 Bacteria 8512634
198 2884704301 2884693830 Bacteria 11273186
199 2891397694 2891395885 Bacteria 9251614
200 2891559220 2891554331 Bacteria 8812224
201 2891565808 2891562705 Bacteria 8039471
202 2895437592 2895427314 Bacteria 13147766
203 2895448390 2895442618 Bacteria 11027144
204 2919715042 2919713450 Bacteria 7431245
205 2946072316 2946064051 Bacteria 8957905
206 3006394811 3006393351 Bacteria 6615579
207 3006489697 3006486233 Bacteria 8157040
208 8003318292 8003314358 Bacteria 10575343
209 8025486212 8025478263 Bacteria 8209203
210 rootH1_10007124
211 rootH1_10130597
212 rootH2_10008570
213 rootL2_10063211
214 rootH1_10007626
215 Ga0070671_100159113
216 Ga0070714_100352280
217 Ga0070713_100002575
218 Ga0070713_100218211
219 Ga0070710_10044321
220 Ga0070711_100006309
221 Ga0070706_100208730
222 Ga0068856_100013036
223 Ga0068864_100413174
224 Ga0081455_10002943
225 Ga0075365_10001024
226 Ga0075368_10001247
227 Ga0075363_100000752
228 Ga0075364_10003070
229 Ga0075364_10034426
230 Ga0075367_10008322
231 Ga0075366_10074743
232 Ga0075370_10000341
233 Ga0075428_100005600
234 Ga0075428_100633405
235 Ga0075430_100065880
236 Ga0075431_100013666
237 Ga0075431_100015508
238 Ga0075429_100107010
239 Ga0105251_10058257
240 Ga0105248_10008332
241 Ga0207713_1096120
242 Ga0207692_10074295
243 Ga0207684_10139810
244 Ga0207663_10019396
245 Ga0207700_10076695
246 Ga0207700_10087745
247 Ga0207689_10424160
248 Ga0207702_10004761
249 Ga0307515_10043926
250 Ga0307513_10045619
251 Ga0307509_10020304
252 Ga0307516_10065897
253 Ga0307516_10087517
254 Ga0307516_10221269
255 Ga0307507_10062911
256 Ga0373945_0052792
257 Ga0373946_0093643
258 Ga0373955_0039490
259 Ga0373924_0052138
260 Ga0373935_0087610
261 Ga0373947_0175428
262 Ga0373937_0082761
263 Ga0373937_0432994
264 Ga0373925_0013638
265 Ga0373925_0039065
266 Ga0373925_0679369
267 Ga0395898_0234516
268 Ga0451853_0581594
269 Ga0451853_1616540
270 Ga0466969_0036122
271 Ga0466969_0119087
272 Ga0466965_0000170
273 Ga0466966_0003775
274 Ga0466966_0184176
275 Ga0466961_0013771
276 Ga0466961_0032916
277 Ga0466963_0001375
278 Ga0466971_0006567
279 Ga0466970_0009136
280 Ga0466957_0037159
281 Ga0466960_0044985
282 Ga0466959_0011203
283 Ga0466959_0075472
284 Ga0466967_0267595
285 Ga0495592_0052331
286 Ga0495603_0059842
287 Ga0495629_0035761
288 Ga0495629_0049214
289 Ga0495641_0014660
290 Ga0495651_0094470
291 Ga0495651_0198636
292 Ga0495653_0019025
293 Ga0495653_0108044
294 Ga0495605_0003279
295 Ga0495662_0024679
296 Ga0495662_0042446
297 Ga0495664_0099906
298 Ga0495664_0235590
299 Ga0495585_0069805
300 Ga0495594_0141651
301 Ga0495583_0023173
302 Ga0495583_0055414
303 Ga0495606_0010158
304 Ga0495608_0038813
305 Ga0495610_0046764
306 Ga0495616_0013476
307 Ga0495618_0092545
308 Ga0495620_0001170
309 Ga0495620_0006042
310 Ga0495628_0107805
311 Ga0495643_0050389
312 Ga0495648_0059362
313 Ga0495648_0156436
314 Ga0495666_0052920
315 Ga0495652_0008744
316 Ga0495665_0038337
317 Ga0495640_0003046
318 Ga0495640_0081898
319 Ga0495586_0067582
320 Ga0495586_0279608
321 Ga0495587_0028295
322 Ga0495587_0070970
323 Ga0495597_0009726
324 Ga0495597_0047600
325 Ga0495645_0097761
326 Ga0495645_0112678
327 Ga0495645_0248452
328 Ga0495645_0258090
329 Ga0495667_0267497
330 Ga0495668_0023933
331 Ga0495634_0054415
332 Ga0495634_0170402
333 Ga0495611_0093159
334 Ga0495611_0192087
335 Ga0495625_0087573
336 Ga0495635_0161416
337 Ga0495635_0366106
338 Ga0495657_0004333
339 Ga0495657_0008690
340 Ga0495657_0091571
341 Ga0495599_0025763
342 Ga0495646_0014794
343 Ga0495658_0033516
344 Ga0495658_0114039
345 Ga0495613_0004388
346 Ga0495613_0015321
347 Ga0495613_0061997
348 Ga0495613_0090194
349 Ga0495624_0006761
350 Ga0495624_0026457
351 Ga0495624_0045027
352 Ga0495624_0217145
353 Ga0495624_0217352
354 Ga0495649_0109109
355 Ga0495589_0036831
356 Ga0495600_0039094
357 Ga0495660_0085737
358 Ga0495604_0071925
359 Ga0495604_0175613
360 Ga0495604_0230495
361 Ga0495674_0017097
362 Ga0495674_0080584
363 Ga0495674_0179428
364 Ga0495674_0304797
365 Ga0495676_0005869
366 Ga0495676_0296133
367 Ga0495680_0054783
368 Ga0495680_0078010
369 Ga0495680_0151807
370 Ga0495683_0058335
371 Ga0495687_025184
372 Ga0495687_057380
373 Ga0495675_0030021
374 Ga0495685_014078
375 Ga0495685_019726
376 Ga0495684_0130193
377 Ga0495593_0008747
378 Ga0495593_0008758
379 Ga0495593_0017556
380 Ga0495593_0116089
381 Ga0495614_0009007
382 Ga0496109_0152965
383 Ga0496109_0303756
384 Ga0501038_0056164
385 Ga0501047_0011665
386 Ga0501047_0444476
387 nmdc:mga05p37_128779_c1
388 nmdc:mga09592_8492_c1
389 nmdc:mga0qj67_27807_c1
390 nmdc:mga06r32_10808_c1
391 Ga0495601_0036021
392 Ga0500560_021997
393 Ga0500573_0106332
394 Ga0466962_0000239
395 2997605919
396 2515856427
397 2558909768
398 2616698406
399 2644627653
400 2676491076
401 2768644220
402 2819746003
403 2856742166
404 2862178789
405 2870723297
406 2873320535
407 2884704301
408 2891397694
409 2891559220
410 2891565808
411 2895437592
412 2895448390
413 2919715042
414 2946072316
415 3006394811
416 3006489697
417 8003318292
418 8025486212

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

181

259

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9081 164 264
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.8765 169 263
1bl0-assembly1.cif.gz_A multiple antibiotic resistance protein (mara)/dna complex 0.8679 167 268
3oou-assembly1.cif.gz_A the structure of a protein with unkown function from listeria innocua 0.8503 165 264
3mn2-assembly2.cif.gz_B the crystal structure of a probable arac family transcriptional regulator from rhodopseudomonas palustris cga009 0.8423 165 264
ID Description Score Start End Superfamily
af_P31449_179_288_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9161 165 264 1.10.10.60
af_P09377_170_274_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8982 165 264 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8955 218 263 1.10.10.60
af_Q59SD2_79_141_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8898 167 217 1.10.10.60
af_Q2FY65_11_117_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8854 167 265 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A544XW46-F1-model_v4 deleted 0.9793 14 278
AF-A0A269TQ99-F1-model_v4 deleted 0.9624 18 278
AF-A0A7U9KP81-F1-model_v4 AraC family transcriptional regulator 0.9562 23 278 GO:0003700
GO:0043565
AF-A0A531M788-F1-model_v4 Helix-turn-helix domain-containing protein 0.9494 167 260 GO:0003700
GO:0003908
GO:0006281
GO:0043565
AF-A0A3N5JMC0-F1-model_v4 Methylated-DNA--[protein]-cysteine S-methyltransferase (EC 2.1.1.63) 0.9489 167 263 GO:0003700
GO:0003908
GO:0006281
GO:0032259
GO:0043565

Map