F319675

General Info

Members Datasets Scaffolds Average Seq Length
209 141 418 162

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_270711_c1|nmdc:mga06r32_270711_c1_625_1404
Length 187
Sequence LDDVTTTYDARGLVELDGTIPKVSEIDGERAVMEARDLSTRKINAELRWLLYEQGVKDVTILNPSARHSLGVGILTRCKVTFEGSLGYFGCGLGDGAEFQVNGRVGWSVAENMMSGVVVIESNAGSLAAALGIDCVEGEWTDADTELIERKFSIYGLGTPPSFTKFVCGKKLYNYDSLEPSERKLVL

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
86 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
98 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
99 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
103 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.35
Rhizosphere 94.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_270711_c1 3300050510 Bacteria 1686
2 JGI25406J46586_10007343 3300003203 Bacteria 5035
3 JGI25407J50210_10000810 3300003373 Bacteria 6665
4 JGI25407J50210_10002159 3300003373 Bacteria 4595
5 JGI25407J50210_10009997 3300003373 Bacteria 2409
6 Ga0070676_10190457 3300005328 Bacteria 1339
7 Ga0070670_100171185 3300005331 Bacteria 1883
8 Ga0070670_100220301 3300005331 Bacteria 1651
9 Ga0070692_10186116 3300005345 Bacteria 1207
10 Ga0070675_100100929 3300005354 Bacteria 2430
11 Ga0070675_100120309 3300005354 Bacteria 2230
12 Ga0070674_100042711 3300005356 Bacteria 3081
13 Ga0070673_100016723 3300005364 Bacteria 5196
14 Ga0070688_100086918 3300005365 Bacteria 2035
15 Ga0070659_100211463 3300005366 Bacteria 1598
16 Ga0070714_100056610 3300005435 Bacteria 3354
17 Ga0070694_100439040 3300005444 Bacteria 1028
18 Ga0070678_100475438 3300005456 Bacteria 1099
19 Ga0070706_100002108 3300005467 Bacteria 20260
20 Ga0070706_100047384 3300005467 Bacteria 3966
21 Ga0070706_100184709 3300005467 Bacteria 1948
22 Ga0070707_100000784 3300005468 Bacteria 31447
23 Ga0070707_100343745 3300005468 Bacteria 1449
24 Ga0070698_100003347 3300005471 Bacteria 17650
25 Ga0070698_100201930 3300005471 Bacteria 1923
26 Ga0070698_100372874 3300005471 Bacteria 1359
27 Ga0070699_100036170 3300005518 Bacteria 4271
28 Ga0070699_100117668 3300005518 Bacteria 2336
29 Ga0070699_100224465 3300005518 Bacteria 1674
30 Ga0070684_100090741 3300005535 Bacteria 2717
31 Ga0068857_100422743 3300005577 Bacteria 1243
32 Ga0068861_100451885 3300005719 Bacteria 1151
33 Ga0068870_10135469 3300005840 Bacteria 1435
34 Ga0081455_10055662 3300005937 Bacteria 3364
35 Ga0081455_10111853 3300005937 Bacteria 2169
36 Ga0081538_10000270 3300005981 Bacteria 59449
37 Ga0081538_10001027 3300005981 Bacteria 29805
38 Ga0081538_10007617 3300005981 Bacteria 9334
39 Ga0081538_10007718 3300005981 Bacteria 9269
40 Ga0081538_10024504 3300005981 Bacteria 4296
41 Ga0081538_10039259 3300005981 Bacteria 3039
42 Ga0081540_1002825 3300005983 Bacteria 14054
43 Ga0081540_1081650 3300005983 Bacteria 1453
44 Ga0081539_10000957 3300005985 Bacteria 54155
45 Ga0081539_10005390 3300005985 Bacteria 13091
46 Ga0070717_10376549 3300006028 Bacteria 1272
47 Ga0070712_100286353 3300006175 Bacteria 1329
48 Ga0075433_10130712 3300006852 Bacteria 2231
49 Ga0075434_100466116 3300006871 Bacteria 1284
50 Ga0111539_10028483 3300009094 Bacteria 6813
51 Ga0105247_10113119 3300009101 Bacteria 1749
52 Ga0105237_10539041 3300009545 Bacteria 1174
53 Ga0105239_11209799 3300010375 Bacteria 871
54 Ga0105246_10169112 3300011119 Bacteria 1672
55 Ga0157373_10060538 3300013100 Bacteria 2682
56 Ga0157370_10114263 3300013104 Bacteria 2522
57 Ga0163162_10708418 3300013306 Bacteria 1128
58 Ga0157372_10900324 3300013307 Bacteria 1027
59 Ga0163163_10272044 3300014325 Bacteria 1745
60 Ga0157377_10299907 3300014745 Bacteria 1060
61 Ga0157377_11460883 3300014745 Bacteria 542
62 Ga0157376_10714072 3300014969 Bacteria 1009
63 Ga0163161_10308051 3300017792 Bacteria 1249
64 Ga0213876_10057550 3300021384 Bacteria 2052
65 Ga0207682_10035097 3300025893 Bacteria 2024
66 Ga0207688_10072376 3300025901 Bacteria 1958
67 Ga0207643_10125800 3300025908 Bacteria 1522
68 Ga0207684_10310279 3300025910 Bacteria 1360
69 Ga0207671_10877434 3300025914 Bacteria 710
70 Ga0207693_10254887 3300025915 Bacteria 1377
71 Ga0207662_10028761 3300025918 Bacteria 3215
72 Ga0207657_10138372 3300025919 Bacteria 1991
73 Ga0207646_10027842 3300025922 Bacteria 5152
74 Ga0207646_10060056 3300025922 Bacteria 3395
75 Ga0207650_10037527 3300025925 Bacteria 3532
76 Ga0207650_10611914 3300025925 Bacteria 917
77 Ga0207659_10164218 3300025926 Bacteria 1746
78 Ga0207687_10158588 3300025927 Bacteria 1734
79 Ga0207664_10024983 3300025929 Bacteria 4493
80 Ga0207664_10095700 3300025929 Bacteria 2443
81 Ga0207670_10386527 3300025936 Bacteria 1116
82 Ga0207669_10008194 3300025937 Bacteria 4894
83 Ga0207669_10167453 3300025937 Bacteria 1560
84 Ga0207679_10081337 3300025945 Bacteria 2477
85 Ga0207677_10171745 3300026023 Bacteria 1696
86 Ga0207677_10480407 3300026023 Bacteria 1070
87 Ga0207708_10123248 3300026075 Bacteria 2021
88 Ga0207708_10177409 3300026075 Bacteria 1690
89 Ga0207702_10215119 3300026078 Bacteria 1788
90 Ga0207648_10121753 3300026089 Bacteria 2294
91 Ga0207676_10163817 3300026095 Bacteria 1930
92 Ga0207675_100115107 3300026118 Bacteria 2540
93 Ga0207675_100581673 3300026118 Bacteria 1121
94 Ga0207683_10162631 3300026121 Bacteria 2019
95 Ga0207428_10024189 3300027907 Bacteria 5102
96 Ga0307513_10002941 3300031456 Bacteria 23304
97 Ga0307408_100610485 3300031548 Bacteria 970
98 Ga0307412_10597161 3300031911 Bacteria 934
99 Ga0307409_100062650 3300031995 Bacteria 2912
100 Ga0307409_100203343 3300031995 Bacteria 1774
101 Ga0307409_100801992 3300031995 Bacteria 949
102 Ga0307416_100009287 3300032002 Bacteria 6427
103 Ga0307416_100163009 3300032002 Bacteria 2063
104 Ga0307416_100506798 3300032002 Bacteria 1272
105 Ga0373945_0138149 3300035116 Bacteria 981
106 Ga0373935_0092698 3300035692 Bacteria 1980
107 Ga0373947_0012403 3300035725 Bacteria 4883
108 Ga0373925_0003972 3300037068 Bacteria 11278
109 Ga0395899_0140525 3300037312 Bacteria 1718
110 Ga0395898_0036799 3300037466 Bacteria 4858
111 Ga0395898_0094460 3300037466 Bacteria 2874
112 Ga0395898_0164415 3300037466 Bacteria 2122
113 Ga0395898_0296727 3300037466 Bacteria 1542
114 Ga0395905_0015783 3300037471 Bacteria 7175
115 Ga0395905_0215324 3300037471 Bacteria 1799
116 Ga0436364_0328211 3300037853 Bacteria 4093
117 Ga0395901_0120923 3300038443 Bacteria 2752
118 Ga0395901_0138435 3300038443 Bacteria 2558
119 Ga0395901_0509574 3300038443 Bacteria 1224
120 Ga0395901_0807135 3300038443 Bacteria 927
121 Ga0436365_0146774 3300039437 Bacteria 4696
122 Ga0436363_0131206 3300039450 Bacteria 1054
123 Ga0450906_016722 3300042145 Bacteria 1326
124 Ga0450918_009683 3300042531 Bacteria 1686
125 Ga0466966_0095110 3300044684 Bacteria 1846
126 Ga0466961_0068473 3300044693 Bacteria 2254
127 Ga0466963_0021142 3300044694 Bacteria 4101
128 Ga0466963_0059142 3300044694 Bacteria 2557
129 Ga0466971_0017012 3300044719 Bacteria 3215
130 Ga0466968_0003620 3300044735 Bacteria 5722
131 Ga0466958_0017486 3300045836 Bacteria 4146
132 Ga0466967_0009395 3300045976 Bacteria 7253
133 Ga0466967_0184871 3300045976 Bacteria 1968
134 Ga0466967_0294709 3300045976 Bacteria 1559
135 Ga0466967_0680252 3300045976 Bacteria 1018
136 Ga0495629_0000475 3300046459 Bacteria 33620
137 Ga0495582_0000428 3300046473 Bacteria 22994
138 Ga0495585_0158292 3300046492 Bacteria 1177
139 Ga0495665_0002597 3300046531 Bacteria 9746
140 Ga0495645_0238080 3300046543 Bacteria 1216
141 Ga0495647_0041494 3300046681 Bacteria 1752
142 Ga0495658_0000287 3300046683 Bacteria 28451
143 Ga0495613_0000457 3300046689 Bacteria 34959
144 Ga0495581_0000464 3300047315 Bacteria 20678
145 Ga0495614_0010305 3300048089 Bacteria 4122
146 Ga0496105_0084885 3300048908 Bacteria 2616
147 Ga0496106_0495537 3300048909 Bacteria 981
148 Ga0496109_0402285 3300048912 Bacteria 1293
149 Ga0496110_0049842 3300048913 Bacteria 3675
150 Ga0496112_0028646 3300048915 Bacteria 5378
151 Ga0496112_0035028 3300048915 Bacteria 4886
152 Ga0496112_0077614 3300048915 Bacteria 3285
153 Ga0501032_0071186 3300049569 Bacteria 2318
154 Ga0501032_0109739 3300049569 Bacteria 1826
155 Ga0501033_0067667 3300049570 Bacteria 2626
156 Ga0501037_0027985 3300049573 Bacteria 4164
157 Ga0501037_0182893 3300049573 Bacteria 1487
158 Ga0501038_0063466 3300049574 Bacteria 3152
159 Ga0501039_0125467 3300049575 Bacteria 2013
160 Ga0501039_0137444 3300049575 Bacteria 1919
161 Ga0501040_0180684 3300049576 Bacteria 1495
162 Ga0501041_0070098 3300049577 Bacteria 2151
163 Ga0501042_0032832 3300049578 Bacteria 3677
164 Ga0501042_0052535 3300049578 Bacteria 2906
165 Ga0501042_0155314 3300049578 Bacteria 1650
166 Ga0501046_0185597 3300049580 Bacteria 1553
167 Ga0501048_0056515 3300049582 Bacteria 2784
168 Ga0501048_0142061 3300049582 Bacteria 1697
169 Ga0501067_0236468 3300049583 Bacteria 1016
170 Ga0501068_0028565 3300049584 Bacteria 3299
171 Ga0501068_0321885 3300049584 Bacteria 991
172 Ga0501068_0343792 3300049584 Bacteria 958
173 Ga0501069_0038417 3300049585 Bacteria 2643
174 Ga0501069_0203920 3300049585 Bacteria 1146
175 Ga0501070_0409816 3300049586 Bacteria 1095
176 Ga0501071_0250216 3300049587 Bacteria 1337
177 Ga0501072_0147568 3300049588 Bacteria 1875
178 Ga0501072_0173841 3300049588 Bacteria 1718
179 Ga0501074_0046683 3300049590 Bacteria 3131
180 Ga0501074_0184988 3300049590 Bacteria 1486
181 Ga0501074_0253522 3300049590 Bacteria 1251
182 Ga0501075_0046189 3300049591 Bacteria 3271
183 Ga0501075_0063167 3300049591 Bacteria 2791
184 Ga0501075_0117411 3300049591 Bacteria 2022
185 Ga0501076_0066899 3300049592 Bacteria 2869
186 Ga0501076_0486813 3300049592 Bacteria 1016
187 Ga0501079_0038373 3300049741 Bacteria 3693
188 Ga0501079_0165726 3300049741 Bacteria 1723
189 Ga0501080_0055360 3300049742 Bacteria 3694
190 Ga0501081_0358129 3300049743 Bacteria 1076
191 Ga0501083_0335277 3300049744 Bacteria 983
192 Ga0501035_0009355 3300049822 Bacteria 9108
193 Ga0501035_0525940 3300049822 Bacteria 971
194 Ga0501044_0115043 3300049823 Bacteria 2695
195 Ga0501045_0051595 3300049824 Bacteria 3001
196 nmdc:mga05p37_496328_c1 3300050507 Bacteria 1402
197 nmdc:mga06r32_447601_c1 3300050510 Bacteria 1271
198 nmdc:mga08y16_104389_c1 3300050511 Bacteria 2950
199 nmdc:mga08y16_52855_c1 3300050511 Bacteria 4249
200 nmdc:mga0a205_45295_c1 3300050515 Bacteria 4241
201 Ga0495601_0213440 3300053077 Bacteria 1261
202 Ga0501084_0114899 3300054114 Bacteria 2263
203 Ga0501084_0375516 3300054114 Bacteria 1201
204 Ga0501082_0036217 3300060353 Bacteria 4251
205 Ga0501082_0308676 3300060353 Bacteria 1378
206 Ga0530510_0068810 3300061734 Bacteria 2568
207 Ga0530510_0079124 3300061734 Bacteria 2391
208 Ga0530510_0349479 3300061734 Bacteria 1111
209 Ga0530510_0405685 3300061734 Bacteria 1028
210 nmdc:mga06r32_270711_c1
211 JGI25406J46586_10007343
212 JGI25407J50210_10000810
213 JGI25407J50210_10002159
214 JGI25407J50210_10009997
215 Ga0070676_10190457
216 Ga0070670_100171185
217 Ga0070670_100220301
218 Ga0070692_10186116
219 Ga0070675_100100929
220 Ga0070675_100120309
221 Ga0070674_100042711
222 Ga0070673_100016723
223 Ga0070688_100086918
224 Ga0070659_100211463
225 Ga0070714_100056610
226 Ga0070694_100439040
227 Ga0070678_100475438
228 Ga0070706_100002108
229 Ga0070706_100047384
230 Ga0070706_100184709
231 Ga0070707_100000784
232 Ga0070707_100343745
233 Ga0070698_100003347
234 Ga0070698_100201930
235 Ga0070698_100372874
236 Ga0070699_100036170
237 Ga0070699_100117668
238 Ga0070699_100224465
239 Ga0070684_100090741
240 Ga0068857_100422743
241 Ga0068861_100451885
242 Ga0068870_10135469
243 Ga0081455_10055662
244 Ga0081455_10111853
245 Ga0081538_10000270
246 Ga0081538_10001027
247 Ga0081538_10007617
248 Ga0081538_10007718
249 Ga0081538_10024504
250 Ga0081538_10039259
251 Ga0081540_1002825
252 Ga0081540_1081650
253 Ga0081539_10000957
254 Ga0081539_10005390
255 Ga0070717_10376549
256 Ga0070712_100286353
257 Ga0075433_10130712
258 Ga0075434_100466116
259 Ga0111539_10028483
260 Ga0105247_10113119
261 Ga0105237_10539041
262 Ga0105239_11209799
263 Ga0105246_10169112
264 Ga0157373_10060538
265 Ga0157370_10114263
266 Ga0163162_10708418
267 Ga0157372_10900324
268 Ga0163163_10272044
269 Ga0157377_10299907
270 Ga0157377_11460883
271 Ga0157376_10714072
272 Ga0163161_10308051
273 Ga0213876_10057550
274 Ga0207682_10035097
275 Ga0207688_10072376
276 Ga0207643_10125800
277 Ga0207684_10310279
278 Ga0207671_10877434
279 Ga0207693_10254887
280 Ga0207662_10028761
281 Ga0207657_10138372
282 Ga0207646_10027842
283 Ga0207646_10060056
284 Ga0207650_10037527
285 Ga0207650_10611914
286 Ga0207659_10164218
287 Ga0207687_10158588
288 Ga0207664_10024983
289 Ga0207664_10095700
290 Ga0207670_10386527
291 Ga0207669_10008194
292 Ga0207669_10167453
293 Ga0207679_10081337
294 Ga0207677_10171745
295 Ga0207677_10480407
296 Ga0207708_10123248
297 Ga0207708_10177409
298 Ga0207702_10215119
299 Ga0207648_10121753
300 Ga0207676_10163817
301 Ga0207675_100115107
302 Ga0207675_100581673
303 Ga0207683_10162631
304 Ga0207428_10024189
305 Ga0307513_10002941
306 Ga0307408_100610485
307 Ga0307412_10597161
308 Ga0307409_100062650
309 Ga0307409_100203343
310 Ga0307409_100801992
311 Ga0307416_100009287
312 Ga0307416_100163009
313 Ga0307416_100506798
314 Ga0373945_0138149
315 Ga0373935_0092698
316 Ga0373947_0012403
317 Ga0373925_0003972
318 Ga0395899_0140525
319 Ga0395898_0036799
320 Ga0395898_0094460
321 Ga0395898_0164415
322 Ga0395898_0296727
323 Ga0395905_0015783
324 Ga0395905_0215324
325 Ga0436364_0328211
326 Ga0395901_0120923
327 Ga0395901_0138435
328 Ga0395901_0509574
329 Ga0395901_0807135
330 Ga0436365_0146774
331 Ga0436363_0131206
332 Ga0450906_016722
333 Ga0450918_009683
334 Ga0466966_0095110
335 Ga0466961_0068473
336 Ga0466963_0021142
337 Ga0466963_0059142
338 Ga0466971_0017012
339 Ga0466968_0003620
340 Ga0466958_0017486
341 Ga0466967_0009395
342 Ga0466967_0184871
343 Ga0466967_0294709
344 Ga0466967_0680252
345 Ga0495629_0000475
346 Ga0495582_0000428
347 Ga0495585_0158292
348 Ga0495665_0002597
349 Ga0495645_0238080
350 Ga0495647_0041494
351 Ga0495658_0000287
352 Ga0495613_0000457
353 Ga0495581_0000464
354 Ga0495614_0010305
355 Ga0496105_0084885
356 Ga0496106_0495537
357 Ga0496109_0402285
358 Ga0496110_0049842
359 Ga0496112_0028646
360 Ga0496112_0035028
361 Ga0496112_0077614
362 Ga0501032_0071186
363 Ga0501032_0109739
364 Ga0501033_0067667
365 Ga0501037_0027985
366 Ga0501037_0182893
367 Ga0501038_0063466
368 Ga0501039_0125467
369 Ga0501039_0137444
370 Ga0501040_0180684
371 Ga0501041_0070098
372 Ga0501042_0032832
373 Ga0501042_0052535
374 Ga0501042_0155314
375 Ga0501046_0185597
376 Ga0501048_0056515
377 Ga0501048_0142061
378 Ga0501067_0236468
379 Ga0501068_0028565
380 Ga0501068_0321885
381 Ga0501068_0343792
382 Ga0501069_0038417
383 Ga0501069_0203920
384 Ga0501070_0409816
385 Ga0501071_0250216
386 Ga0501072_0147568
387 Ga0501072_0173841
388 Ga0501074_0046683
389 Ga0501074_0184988
390 Ga0501074_0253522
391 Ga0501075_0046189
392 Ga0501075_0063167
393 Ga0501075_0117411
394 Ga0501076_0066899
395 Ga0501076_0486813
396 Ga0501079_0038373
397 Ga0501079_0165726
398 Ga0501080_0055360
399 Ga0501081_0358129
400 Ga0501083_0335277
401 Ga0501035_0009355
402 Ga0501035_0525940
403 Ga0501044_0115043
404 Ga0501045_0051595
405 nmdc:mga05p37_496328_c1
406 nmdc:mga06r32_447601_c1
407 nmdc:mga08y16_104389_c1
408 nmdc:mga08y16_52855_c1
409 nmdc:mga0a205_45295_c1
410 Ga0495601_0213440
411 Ga0501084_0114899
412 Ga0501084_0375516
413 Ga0501082_0036217
414 Ga0501082_0308676
415 Ga0530510_0068810
416 Ga0530510_0079124
417 Ga0530510_0349479
418 Ga0530510_0405685

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c89-assembly1.cif.gz_A ndm-1 beta-lactamase exhibits differential active site sequence requirements for the hydrolysis of penicillin versus carbapenem antibiotics 0.7215 27 65
6k1x-assembly1.cif.gz_A crystal structure of rhodothermus marinus substrate-binding protein at ph 6.0 0.6772 41 68
5wql-assembly2.cif.gz_C structure of a pdz-protease bound to a substrate-binding adaptor 0.6765 33 70
6jhk-assembly1.cif.gz_A crystal structure of bacillus subtilis rsbs 0.5927 27 86
5o34-assembly1.cif.gz_C thne from s.clavuligerus 0.5856 31 91
ID Description Score Start End Superfamily
1qo0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8456 42 67 3.40.50.2300
af_A0A1D6MI06_59_381_3.40.50.1110 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7954 38 66 3.40.50.1110
4g6vA00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.7383 33 65 3.40.1350.120
af_P0ADE6_23_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7334 27 62 3.30.70.100
af_Q9AWZ7_81_360_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.7048 33 66 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A2V9L0T3-F1-model_v4 Glutamate synthase 0.9414 35 108 GO:0016491
AF-A0A383AAV2-F1-model_v4 Uncharacterized protein 0.9314 41 111 GO:0016491
AF-A0A2V9M0H8-F1-model_v4 Glutamate synthase 0.9302 35 110 GO:0016491
AF-A0A383AAV2-F1-model_v4 Uncharacterized protein 0.9067 41 111 GO:0016491
AF-A0A382CRC1-F1-model_v4 Uncharacterized protein 0.9056 26 118 GO:0016491

Map