F319609

General Info

Members Datasets Scaffolds Average Seq Length
209 141 203 245

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0388000|Ga0501039_0388000_139_954
Length 271
Sequence VSWVTPARQVDIPPDRTARNNGRMTTRTAVVTGASSGIGAATARHLAAEGFHVFCAARREDRVAALAKEIDGTPVRCDVTSAAEVXXXXAQVGDTLDVLVNNAGGAFGADPVAEADADEWRAMYEVNVIGLMRVTKALLPALVASGAGVIVNVGSTAGRIAYEGGAGYTAAKHGTQVVSETLRLELFDQPVRVCEIAPGMVKTEEFATVRFDGDQEKADAVYAGVAEPLVADDVADAITWMVTRPSHVNIDELVIRPRAQAAQHKVHRVFD

Samples

Sample ID Description Type Environment
1 2643221604 Nocardioides sp. Root190 Isolate Unclassified
2 2643221617 Nocardioides sp. Root79 Isolate Unclassified
3 2643221620 Nocardioides sp. Root240 Isolate Unclassified
4 2738541305 Nocardioides sp. CF167 Isolate Unclassified
5 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
6 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
59 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
66 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
67 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
70 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
71 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
90 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
93 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
94 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
128 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
136 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
137 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 0
Isolates 2.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.4
Nodule 0
Rhizoplane 4.31
Rhizosphere 77.03
Stem 0
Stem Tuber 0
Unclassified 5.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007191 3300001979 Bacteria 4540
2 JGI24739J22299_10011476 3300001989 Bacteria 3271
3 JGI24739J22299_10044675 3300001989 Bacteria 1457
4 JGI24737J22298_10007472 3300001990 Bacteria 3688
5 Ga0070658_10007192 3300005327 Bacteria 8991
6 Ga0070683_100026632 3300005329 Bacteria 5209
7 Ga0068868_100474101 3300005338 Bacteria 1092
8 Ga0070660_100013597 3300005339 Bacteria 5846
9 Ga0070667_100152135 3300005367 Bacteria 2033
10 Ga0070714_100035376 3300005435 Bacteria 4186
11 Ga0070713_100361858 3300005436 Bacteria 1348
12 Ga0070708_100242761 3300005445 Bacteria 1691
13 Ga0070681_10047207 3300005458 Bacteria 4305
14 Ga0070681_10136559 3300005458 Bacteria 2383
15 Ga0070707_100008333 3300005468 Bacteria 9622
16 Ga0070698_100017467 3300005471 Bacteria 7561
17 Ga0070684_100221288 3300005535 Bacteria 1727
18 Ga0068856_100246217 3300005614 Bacteria 1803
19 Ga0068856_100756047 3300005614 Bacteria 992
20 Ga0068859_100745804 3300005617 Bacteria 1068
21 Ga0081539_10014503 3300005985 Bacteria 5823
22 Ga0075365_10005264 3300006038 Bacteria 6961
23 Ga0075365_10021104 3300006038 Bacteria 4056
24 Ga0075365_10116064 3300006038 Bacteria 1843
25 Ga0075365_10231076 3300006038 Bacteria 1298
26 Ga0075368_10019490 3300006042 Bacteria 2561
27 Ga0075363_100001504 3300006048 Bacteria 8899
28 Ga0075363_100039597 3300006048 Bacteria 2481
29 Ga0075364_10003228 3300006051 Bacteria 9234
30 Ga0075364_10028699 3300006051 Bacteria 3563
31 Ga0075364_10262597 3300006051 Bacteria 1174
32 Ga0070716_100255482 3300006173 Bacteria 1196
33 Ga0075362_10008769 3300006177 Bacteria 3885
34 Ga0075367_10009659 3300006178 Bacteria 5051
35 Ga0075367_10027161 3300006178 Bacteria 3253
36 Ga0075370_10004893 3300006353 Bacteria 6575
37 Ga0075370_10029406 3300006353 Bacteria 3061
38 Ga0075370_10076097 3300006353 Bacteria 1924
39 Ga0075428_100000031 3300006844 Bacteria 119070
40 Ga0075428_100084653 3300006844 Bacteria 3460
41 Ga0075434_100514008 3300006871 Bacteria 1218
42 Ga0097620_100745783 3300006931 Bacteria 1068
43 Ga0105240_10107506 3300009093 Bacteria 3382
44 Ga0111539_10180255 3300009094 Bacteria 2467
45 Ga0105238_10647625 3300009551 Bacteria 1066
46 Ga0105239_10345168 3300010375 Bacteria 1680
47 Ga0157369_10151004 3300013105 Bacteria 2455
48 Ga0157369_10721784 3300013105 Bacteria 1026
49 Ga0157372_10149966 3300013307 Bacteria 2690
50 Ga0157372_10206719 3300013307 Bacteria 2275
51 Ga0157372_10468393 3300013307 Bacteria 1468
52 Ga0157375_10842430 3300013308 Bacteria 1064
53 Ga0157380_10297595 3300014326 Bacteria 1485
54 Ga0182008_10215955 3300014497 Bacteria 980
55 Ga0157376_10321611 3300014969 Bacteria 1471
56 Ga0207647_10021789 3300025904 Bacteria 4268
57 Ga0207705_10017684 3300025909 Bacteria 5101
58 Ga0207695_10090389 3300025913 Bacteria 3077
59 Ga0207646_10053284 3300025922 Bacteria 3619
60 Ga0207664_10157788 3300025929 Bacteria 1933
61 Ga0207661_10019965 3300025944 Bacteria 5002
62 Ga0207712_10353346 3300025961 Bacteria 1222
63 Ga0207668_10309852 3300025972 Bacteria 1306
64 Ga0207640_10420371 3300025981 Bacteria 1094
65 Ga0207658_10088922 3300025986 Bacteria 2390
66 Ga0207702_10187006 3300026078 Bacteria 1911
67 Ga0207702_10503461 3300026078 Bacteria 1181
68 Ga0207702_10610276 3300026078 Bacteria 1071
69 Ga0207674_10469392 3300026116 Bacteria 1216
70 Ga0316181_1249334 3300030744 Bacteria 1142
71 Ga0373943_0040449 3300035170 Bacteria 2251
72 Ga0373925_0150660 3300037068 Bacteria 1826
73 Ga0395900_0055536 3300037418 Bacteria 4078
74 Ga0395900_0109132 3300037418 Bacteria 2843
75 Ga0395900_0713009 3300037418 Bacteria 936
76 Ga0395898_0221434 3300037466 Bacteria 1805
77 Ga0395898_0373976 3300037466 Bacteria 1359
78 Ga0395898_0873763 3300037466 Bacteria 838
79 Ga0395905_0071720 3300037471 Bacteria 3247
80 Ga0395901_0030044 3300038443 Bacteria 5598
81 Ga0400485_18044 3300038735 Bacteria 2638
82 Ga0400486_21904 3300038742 Bacteria 2689
83 Ga0400487_23069 3300039110 Bacteria 2695
84 Ga0436365_1256459 3300039437 Bacteria 8992
85 Ga0436362_0062781 3300039453 Bacteria 1648
86 Ga0451853_0897237 3300041512 Bacteria 1805
87 Ga0466969_0046203 3300044656 Bacteria 2159
88 Ga0466965_0026065 3300044683 Bacteria 2833
89 Ga0466965_0037704 3300044683 Bacteria 2374
90 Ga0466966_0018592 3300044684 Bacteria 4580
91 Ga0466961_0039358 3300044693 Bacteria 3031
92 Ga0466961_0083055 3300044693 Bacteria 2026
93 Ga0466961_0120658 3300044693 Bacteria 1646
94 Ga0466961_0177835 3300044693 Bacteria 1322
95 Ga0466963_0025002 3300044694 Bacteria 3805
96 Ga0466963_0201196 3300044694 Bacteria 1393
97 Ga0466968_0043021 3300044735 Bacteria 1911
98 Ga0466970_0004641 3300044765 Bacteria 6779
99 Ga0466970_0005375 3300044765 Bacteria 6354
100 Ga0466970_0014592 3300044765 Bacteria 4035
101 Ga0466970_0020337 3300044765 Bacteria 3448
102 Ga0466970_0027435 3300044765 Bacteria 2988
103 Ga0466970_0029692 3300044765 Bacteria 2880
104 Ga0466970_0094755 3300044765 Bacteria 1622
105 Ga0466957_0060856 3300044842 Bacteria 2316
106 Ga0466957_0134109 3300044842 Bacteria 1590
107 Ga0466957_0463273 3300044842 Bacteria 875
108 Ga0466960_0014641 3300044901 Bacteria 3364
109 Ga0466960_0050354 3300044901 Bacteria 2008
110 Ga0466959_0023649 3300045049 Bacteria 4548
111 Ga0466958_0056868 3300045836 Bacteria 2377
112 Ga0466967_0069746 3300045976 Bacteria 3142
113 Ga0466967_0084230 3300045976 Bacteria 2877
114 Ga0466967_0383005 3300045976 Bacteria 1366
115 Ga0466967_0459895 3300045976 Bacteria 1245
116 Ga0466967_0547000 3300045976 Bacteria 1139
117 Ga0466967_0561964 3300045976 Bacteria 1123
118 Ga0495653_0445018 3300046463 Bacteria 816
119 Ga0495662_0168895 3300046476 Bacteria 1078
120 Ga0495628_0275745 3300046516 Bacteria 1250
121 Ga0495630_0087469 3300046517 Bacteria 2353
122 Ga0495588_0051399 3300046674 Bacteria 2123
123 Ga0495674_0014347 3300047319 Bacteria 7420
124 Ga0495676_0138220 3300047321 Bacteria 1749
125 Ga0495684_0120239 3300047471 Bacteria 1979
126 Ga0496102_0658041 3300048905 Bacteria 971
127 Ga0496103_0005540 3300048906 Bacteria 7546
128 Ga0496105_0444311 3300048908 Bacteria 1024
129 Ga0496107_0287787 3300048910 Bacteria 1223
130 Ga0496108_0014049 3300048911 Bacteria 6533
131 Ga0496109_0190254 3300048912 Bacteria 1928
132 Ga0496110_0291408 3300048913 Bacteria 1486
133 Ga0496111_0055258 3300048914 Bacteria 2871
134 Ga0496113_0085286 3300048916 Bacteria 2426
135 Ga0496124_0071249 3300048927 Bacteria 2882
136 Ga0501031_0033935 3300049568 Bacteria 3330
137 Ga0501031_0034565 3300049568 Bacteria 3299
138 Ga0501032_0006755 3300049569 Bacteria 8423
139 Ga0501032_0160242 3300049569 Bacteria 1478
140 Ga0501033_0002002 3300049570 Bacteria 17744
141 Ga0501033_0104569 3300049570 Bacteria 2064
142 Ga0501036_0000419 3300049572 Bacteria 29976
143 Ga0501036_0013048 3300049572 Bacteria 6901
144 Ga0501036_0084632 3300049572 Bacteria 2681
145 Ga0501036_0566074 3300049572 Bacteria 944
146 Ga0501037_0006107 3300049573 Bacteria 8799
147 Ga0501037_0007112 3300049573 Bacteria 8180
148 Ga0501037_0384082 3300049573 Bacteria 965
149 Ga0501038_0002856 3300049574 Bacteria 16086
150 Ga0501038_0014502 3300049574 Bacteria 7182
151 Ga0501039_0036126 3300049575 Bacteria 3812
152 Ga0501039_0038633 3300049575 Bacteria 3686
153 Ga0501039_0242052 3300049575 Bacteria 1418
154 Ga0501039_0388000 3300049575 Bacteria 1097
155 Ga0501040_0026922 3300049576 Bacteria 3869
156 Ga0501041_0107677 3300049577 Bacteria 1728
157 Ga0501042_0000241 3300049578 Bacteria 26499
158 Ga0501043_0003399 3300049579 Bacteria 13086
159 Ga0501043_0055136 3300049579 Bacteria 3122
160 Ga0501046_0000770 3300049580 Bacteria 31019
161 Ga0501046_0010216 3300049580 Bacteria 8078
162 Ga0501047_0000974 3300049581 Bacteria 28835
163 Ga0501048_0003583 3300049582 Bacteria 11820
164 Ga0501067_0176297 3300049583 Bacteria 1190
165 Ga0501069_0091151 3300049585 Bacteria 1724
166 Ga0501069_0332509 3300049585 Bacteria 894
167 Ga0501070_0043993 3300049586 Bacteria 3716
168 Ga0501070_0348604 3300049586 Bacteria 1202
169 Ga0501071_0142040 3300049587 Bacteria 1788
170 Ga0501073_0048165 3300049589 Bacteria 2993
171 Ga0501074_0016970 3300049590 Bacteria 5282
172 Ga0501074_0067241 3300049590 Bacteria 2578
173 Ga0501074_0176886 3300049590 Bacteria 1523
174 Ga0501076_0109771 3300049592 Bacteria 2230
175 Ga0501077_0126048 3300049593 Bacteria 1623
176 Ga0501079_0288450 3300049741 Bacteria 1283
177 Ga0501080_0087289 3300049742 Bacteria 2898
178 Ga0501080_0226652 3300049742 Bacteria 1709
179 Ga0501035_0350879 3300049822 Bacteria 1234
180 Ga0501044_0063463 3300049823 Bacteria 3773
181 Ga0501044_0098797 3300049823 Bacteria 2938
182 Ga0501044_0125498 3300049823 Bacteria 2564
183 nmdc:mga03683_19540_c1 3300050489 Bacteria 2588
184 nmdc:mga03n38_31511_c1 3300050490 Bacteria 2238
185 nmdc:mga00v17_47326_c1 3300050491 Bacteria 2605
186 nmdc:mga00v17_54530_c1 3300050491 Bacteria 2439
187 nmdc:mga0yw44_113891_c1 3300050492 Bacteria 1735
188 nmdc:mga0yw44_24828_c1 3300050492 Bacteria 3398
189 nmdc:mga0yw44_284367_c1 3300050492 Bacteria 1106
190 nmdc:mga0yw44_569_c1 3300050492 Bacteria 13313
191 nmdc:mga06z11_28266_c1 3300050494 Bacteria 2690
192 nmdc:mga07m45_6177_c1 3300050496 Bacteria 6041
193 nmdc:mga07m45_63723_c1 3300050496 Bacteria 2091
194 nmdc:mga08y16_327902_c1 3300050511 Bacteria 1575
195 Ga0495601_0345651 3300053077 Bacteria 967
196 Ga0495612_0149554 3300053078 Bacteria 1016
197 Ga0495655_0055472 3300053083 Bacteria 1063
198 Ga0500641_0028219 3300053096 Bacteria 2191
199 Ga0501084_0081944 3300054114 Bacteria 2707
200 Ga0501084_0507948 3300054114 Bacteria 1019
201 Ga0590075_041980 3300059424 Bacteria 1169
202 Ga0501082_0342916 3300060353 Bacteria 1302
203 Ga0466962_0203527 3300061719 Bacteria 968

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050492 nmdc:mga0yw44_284367_c1 nmdc:mga0yw44_284367_c1_373_1071 213
2 3300005614 Ga0068856_100246217 Ga0068856_1002462172 215
3 3300009093 Ga0105240_10107506 Ga0105240_101075064 215
4 3300025913 Ga0207695_10090389 Ga0207695_100903894 215
5 3300026078 Ga0207702_10187006 Ga0207702_101870062 215
6 3300013308 Ga0157375_10842430 Ga0157375_108424302 216
7 3300044693 Ga0466961_0120658 Ga0466961_0120658_855_1607 216
8 3300037466 Ga0395898_0873763 Ga0395898_0873763_65_718 217
9 3300049573 Ga0501037_0384082 Ga0501037_0384082_39_695 217
10 3300006844 Ga0075428_100000031 Ga0075428_10000003134 219
11 3300044842 Ga0466957_0060856 Ga0466957_0060856_209_961 219
12 3300037466 Ga0395898_0221434 Ga0395898_0221434_545_1285 220
13 3300044683 Ga0466965_0026065 Ga0466965_0026065_465_1205 220
14 3300044765 Ga0466970_0014592 Ga0466970_0014592_1993_2745 220
15 3300006038 Ga0075365_10021104 Ga0075365_100211043 221
16 3300006042 Ga0075368_10019490 Ga0075368_100194903 221
17 3300006048 Ga0075363_100039597 Ga0075363_1000395973 221
18 3300006051 Ga0075364_10028699 Ga0075364_100286993 221
19 3300006177 Ga0075362_10008769 Ga0075362_100087693 221
20 3300006178 Ga0075367_10009659 Ga0075367_100096593 221
21 3300006353 Ga0075370_10029406 Ga0075370_100294063 221
22 3300037466 Ga0395898_0373976 Ga0395898_0373976_262_1011 221
23 3300038443 Ga0395901_0030044 Ga0395901_0030044_4379_5128 221
24 3300044693 Ga0466961_0083055 Ga0466961_0083055_1256_2002 221
25 3300044765 Ga0466970_0094755 Ga0466970_0094755_47_796 221
26 3300050489 nmdc:mga03683_19540_c1 nmdc:mga03683_19540_c1_1450_2253 221
27 3300050490 nmdc:mga03n38_31511_c1 nmdc:mga03n38_31511_c1_103_906 221
28 3300050491 nmdc:mga00v17_54530_c1 nmdc:mga00v17_54530_c1_668_1471 221
29 3300050492 nmdc:mga0yw44_24828_c1 nmdc:mga0yw44_24828_c1_1078_1881 221
30 3300050494 nmdc:mga06z11_28266_c1 nmdc:mga06z11_28266_c1_103_906 221
31 3300050496 nmdc:mga07m45_63723_c1 nmdc:mga07m45_63723_c1_912_1715 221
32 3300005435 Ga0070714_100035376 Ga0070714_1000353763 223
33 3300014497 Ga0182008_10215955 Ga0182008_102159552 223
34 3300025929 Ga0207664_10157788 Ga0207664_101577882 223
35 3300044901 Ga0466960_0014641 Ga0466960_0014641_884_1630 223
36 3300048910 Ga0496107_0287787 Ga0496107_0287787_208_957 223
37 3300048905 Ga0496102_0658041 Ga0496102_0658041_179_949 224
38 3300006038 Ga0075365_10116064 Ga0075365_101160643 225
39 3300006051 Ga0075364_10262597 Ga0075364_102625972 225
40 3300009551 Ga0105238_10647625 Ga0105238_106476252 225
41 3300013105 Ga0157369_10721784 Ga0157369_107217841 225
42 3300013307 Ga0157372_10468393 Ga0157372_104683932 225
43 3300049592 Ga0501076_0109771 Ga0501076_0109771_62_808 225
44 3300006038 Ga0075365_10005264 Ga0075365_100052646 226
45 3300026078 Ga0207702_10503461 Ga0207702_105034612 226
46 3300048906 Ga0496103_0005540 Ga0496103_0005540_2782_3531 226
47 3300048912 Ga0496109_0190254 Ga0496109_0190254_80_829 226
48 3300049583 Ga0501067_0176297 Ga0501067_0176297_33_782 226
49 3300049585 Ga0501069_0091151 Ga0501069_0091151_902_1651 226
50 3300050492 nmdc:mga0yw44_569_c1 nmdc:mga0yw44_569_c1_5954_6676 226
51 3300006038 Ga0075365_10231076 Ga0075365_102310762 227
52 3300006048 Ga0075363_100001504 Ga0075363_10000150410 227
53 3300006051 Ga0075364_10003228 Ga0075364_100032283 227
54 3300006353 Ga0075370_10004893 Ga0075370_100048934 227
55 3300044683 Ga0466965_0037704 Ga0466965_0037704_1535_2281 227
56 3300044765 Ga0466970_0020337 Ga0466970_0020337_967_1713 227
57 3300049586 Ga0501070_0348604 Ga0501070_0348604_381_1127 227
58 3300049741 Ga0501079_0288450 Ga0501079_0288450_435_1247 227
59 3300050491 nmdc:mga00v17_47326_c1 nmdc:mga00v17_47326_c1_1523_2335 227
60 3300050496 nmdc:mga07m45_6177_c1 nmdc:mga07m45_6177_c1_5019_5831 227
61 3300006353 Ga0075370_10076097 Ga0075370_100760973 231
62 3300053077 Ga0495601_0345651 Ga0495601_0345651_140_886 233
63 3300037418 Ga0395900_0055536 Ga0395900_0055536_1133_1855 235
64 3300005338 Ga0068868_100474101 Ga0068868_1004741012 236
65 3300001989 JGI24739J22299_10044675 JGI24739J22299_100446752 238
66 3300013105 Ga0157369_10151004 Ga0157369_101510042 238
67 3300041512 Ga0451853_0897237 Ga0451853_0897237_946_1701 238
68 3300049570 Ga0501033_0002002 Ga0501033_0002002_12528_13271 238
69 3300005471 Ga0070698_100017467 Ga0070698_1000174673 239
70 3300006844 Ga0075428_100084653 Ga0075428_1000846532 239
71 3300014969 Ga0157376_10321611 Ga0157376_103216112 239
72 3300025961 Ga0207712_10353346 Ga0207712_103533461 239
73 3300037418 Ga0395900_0109132 Ga0395900_0109132_2005_2748 239
74 3300046674 Ga0495588_0051399 Ga0495588_0051399_46_786 239
75 3300048913 Ga0496110_0291408 Ga0496110_0291408_592_1341 239
76 3300048914 Ga0496111_0055258 Ga0496111_0055258_2064_2813 239
77 3300048916 Ga0496113_0085286 Ga0496113_0085286_756_1505 239
78 3300049580 Ga0501046_0000770 Ga0501046_0000770_22387_23133 239
79 iso_pu_bacteria 2643221617 2644101444 241
80 iso_pu_bacteria 2643221620 2644118692 241
81 iso_pu_bacteria 2738541305 2738869909 241
82 iso_pu_bacteria 2816332119 2816423277 241
83 3300005458 Ga0070681_10047207 Ga0070681_100472073 242
84 3300005458 Ga0070681_10136559 Ga0070681_101365593 242
85 3300006871 Ga0075434_100514008 Ga0075434_1005140082 242
86 3300039437 Ga0436365_1256459 Ga0436365_1256459_6666_7397 242
87 3300039453 Ga0436362_0062781 Ga0436362_0062781_388_1119 242
88 3300006178 Ga0075367_10027161 Ga0075367_100271614 243
89 3300044684 Ga0466966_0018592 Ga0466966_0018592_3095_3859 243
90 3300044693 Ga0466961_0039358 Ga0466961_0039358_1480_2244 243
91 3300045049 Ga0466959_0023649 Ga0466959_0023649_802_1566 243
92 3300045836 Ga0466958_0056868 Ga0466958_0056868_877_1641 243
93 3300049572 Ga0501036_0566074 Ga0501036_0566074_101_859 243
94 3300005327 Ga0070658_10007192 Ga0070658_100071926 244
95 3300005339 Ga0070660_100013597 Ga0070660_1000135975 244
96 3300005436 Ga0070713_100361858 Ga0070713_1003618582 244
97 3300025909 Ga0207705_10017684 Ga0207705_100176844 244
98 3300035170 Ga0373943_0040449 Ga0373943_0040449_733_1494 244
99 3300037068 Ga0373925_0150660 Ga0373925_0150660_612_1373 244
100 3300038735 Ga0400485_18044 Ga0400485_18044_1382_2143 244
101 3300038742 Ga0400486_21904 Ga0400486_21904_1484_2245 244
102 3300039110 Ga0400487_23069 Ga0400487_23069_478_1239 244
103 3300044656 Ga0466969_0046203 Ga0466969_0046203_717_1463 244
104 3300044765 Ga0466970_0027435 Ga0466970_0027435_576_1322 244
105 3300046463 Ga0495653_0445018 Ga0495653_0445018_45_806 244
106 3300046476 Ga0495662_0168895 Ga0495662_0168895_192_953 244
107 3300046516 Ga0495628_0275745 Ga0495628_0275745_265_1026 244
108 3300046517 Ga0495630_0087469 Ga0495630_0087469_574_1335 244
109 3300047319 Ga0495674_0014347 Ga0495674_0014347_2581_3342 244
110 3300047321 Ga0495676_0138220 Ga0495676_0138220_243_1004 244
111 3300047471 Ga0495684_0120239 Ga0495684_0120239_1108_1869 244
112 3300048908 Ga0496105_0444311 Ga0496105_0444311_116_856 244
113 3300048911 Ga0496108_0014049 Ga0496108_0014049_4023_4775 244
114 iso_pu_bacteria 2643221604 2644033174 244
115 3300005329 Ga0070683_100026632 Ga0070683_1000266323 245
116 3300005535 Ga0070684_100221288 Ga0070684_1002212881 245
117 3300006173 Ga0070716_100255482 Ga0070716_1002554822 245
118 3300025944 Ga0207661_10019965 Ga0207661_100199653 245
119 3300044693 Ga0466961_0177835 Ga0466961_0177835_131_880 245
120 3300044694 Ga0466963_0201196 Ga0466963_0201196_442_1191 245
121 3300044765 Ga0466970_0004641 Ga0466970_0004641_4527_5276 245
122 3300044842 Ga0466957_0134109 Ga0466957_0134109_365_1114 245
123 3300045976 Ga0466967_0069746 Ga0466967_0069746_1981_2721 245
124 3300045976 Ga0466967_0084230 Ga0466967_0084230_1505_2254 245
125 3300045976 Ga0466967_0383005 Ga0466967_0383005_570_1313 245
126 3300045976 Ga0466967_0547000 Ga0466967_0547000_374_1114 245
127 3300049569 Ga0501032_0160242 Ga0501032_0160242_332_1105 245
128 3300049572 Ga0501036_0000419 Ga0501036_0000419_4465_5238 245
129 3300049573 Ga0501037_0006107 Ga0501037_0006107_7947_8720 245
130 3300049574 Ga0501038_0014502 Ga0501038_0014502_3036_3809 245
131 3300049575 Ga0501039_0242052 Ga0501039_0242052_531_1304 245
132 3300049578 Ga0501042_0000241 Ga0501042_0000241_1993_2766 245
133 3300049579 Ga0501043_0003399 Ga0501043_0003399_8178_8951 245
134 3300049581 Ga0501047_0000974 Ga0501047_0000974_3211_3984 245
135 3300049582 Ga0501048_0003583 Ga0501048_0003583_10550_11323 245
136 3300049590 Ga0501074_0016970 Ga0501074_0016970_1963_2736 245
137 3300049742 Ga0501080_0226652 Ga0501080_0226652_374_1147 245
138 3300049823 Ga0501044_0098797 Ga0501044_0098797_563_1336 245
139 3300049823 Ga0501044_0125498 Ga0501044_0125498_436_1209 245
140 3300061719 Ga0466962_0203527 Ga0466962_0203527_132_881 245
141 iso_pu_bacteria 2811994874 2812334600 245
142 3300005445 Ga0070708_100242761 Ga0070708_1002427612 246
143 3300005468 Ga0070707_100008333 Ga0070707_1000083336 246
144 3300013307 Ga0157372_10149966 Ga0157372_101499662 246
145 3300014326 Ga0157380_10297595 Ga0157380_102975951 246
146 3300025922 Ga0207646_10053284 Ga0207646_100532842 246
147 3300037418 Ga0395900_0713009 Ga0395900_0713009_134_877 246
148 3300044694 Ga0466963_0025002 Ga0466963_0025002_2100_2843 246
149 3300044735 Ga0466968_0043021 Ga0466968_0043021_902_1645 246
150 3300044842 Ga0466957_0463273 Ga0466957_0463273_10_759 246
151 3300044901 Ga0466960_0050354 Ga0466960_0050354_1050_1823 246
152 3300045976 Ga0466967_0561964 Ga0466967_0561964_225_968 246
153 3300049568 Ga0501031_0033935 Ga0501031_0033935_226_969 246
154 3300049569 Ga0501032_0006755 Ga0501032_0006755_6496_7239 246
155 3300049570 Ga0501033_0104569 Ga0501033_0104569_1013_1756 246
156 3300049572 Ga0501036_0013048 Ga0501036_0013048_1185_1928 246
157 3300049573 Ga0501037_0007112 Ga0501037_0007112_6791_7534 246
158 3300049574 Ga0501038_0002856 Ga0501038_0002856_2101_2844 246
159 3300049575 Ga0501039_0036126 Ga0501039_0036126_2019_2762 246
160 3300049575 Ga0501039_0388000 Ga0501039_0388000_139_954 246
161 3300049579 Ga0501043_0055136 Ga0501043_0055136_515_1258 246
162 3300049580 Ga0501046_0010216 Ga0501046_0010216_5826_6569 246
163 3300049585 Ga0501069_0332509 Ga0501069_0332509_71_814 246
164 3300049586 Ga0501070_0043993 Ga0501070_0043993_1051_1794 246
165 3300049589 Ga0501073_0048165 Ga0501073_0048165_159_902 246
166 3300049590 Ga0501074_0067241 Ga0501074_0067241_641_1384 246
167 3300049742 Ga0501080_0087289 Ga0501080_0087289_510_1253 246
168 3300049823 Ga0501044_0063463 Ga0501044_0063463_155_898 246
169 3300050492 nmdc:mga0yw44_113891_c1 nmdc:mga0yw44_113891_c1_660_1436 246
170 3300054114 Ga0501084_0507948 Ga0501084_0507948_203_949 246
171 3300059424 Ga0590075_041980 Ga0590075_041980_147_896 246
172 3300030744 Ga0316181_1249334 Ga0316181_12493342 247
173 3300037471 Ga0395905_0071720 Ga0395905_0071720_330_1079 247
174 3300044765 Ga0466970_0005375 Ga0466970_0005375_45_791 247
175 3300044765 Ga0466970_0029692 Ga0466970_0029692_1353_2102 247
176 3300053078 Ga0495612_0149554 Ga0495612_0149554_189_977 247
177 3300001979 JGI24740J21852_10007191 JGI24740J21852_100071914 248
178 3300001989 JGI24739J22299_10011476 JGI24739J22299_100114764 248
179 3300001990 JGI24737J22298_10007472 JGI24737J22298_100074724 248
180 3300005367 Ga0070667_100152135 Ga0070667_1001521352 248
181 3300005614 Ga0068856_100756047 Ga0068856_1007560471 248
182 3300005617 Ga0068859_100745804 Ga0068859_1007458042 248
183 3300005985 Ga0081539_10014503 Ga0081539_100145035 248
184 3300006931 Ga0097620_100745783 Ga0097620_1007457832 248
185 3300009094 Ga0111539_10180255 Ga0111539_101802553 248
186 3300010375 Ga0105239_10345168 Ga0105239_103451682 248
187 3300013307 Ga0157372_10206719 Ga0157372_102067193 248
188 3300025904 Ga0207647_10021789 Ga0207647_100217893 248
189 3300025972 Ga0207668_10309852 Ga0207668_103098522 248
190 3300025981 Ga0207640_10420371 Ga0207640_104203711 248
191 3300025986 Ga0207658_10088922 Ga0207658_100889223 248
192 3300026078 Ga0207702_10610276 Ga0207702_106102762 248
193 3300026116 Ga0207674_10469392 Ga0207674_104693922 248
194 3300045976 Ga0466967_0459895 Ga0466967_0459895_73_828 248
195 3300048927 Ga0496124_0071249 Ga0496124_0071249_1872_2651 248
196 3300049568 Ga0501031_0034565 Ga0501031_0034565_124_888 248
197 3300049572 Ga0501036_0084632 Ga0501036_0084632_1523_2287 248
198 3300049575 Ga0501039_0038633 Ga0501039_0038633_2692_3456 248
199 3300049576 Ga0501040_0026922 Ga0501040_0026922_1486_2250 248
200 3300049577 Ga0501041_0107677 Ga0501041_0107677_653_1417 248
201 3300049587 Ga0501071_0142040 Ga0501071_0142040_992_1756 248
202 3300049590 Ga0501074_0176886 Ga0501074_0176886_10_774 248
203 3300049593 Ga0501077_0126048 Ga0501077_0126048_661_1425 248
204 3300049822 Ga0501035_0350879 Ga0501035_0350879_68_832 248
205 3300050511 nmdc:mga08y16_327902_c1 nmdc:mga08y16_327902_c1_488_1252 248
206 3300053083 Ga0495655_0055472 Ga0495655_0055472_202_954 248
207 3300053096 Ga0500641_0028219 Ga0500641_0028219_986_1783 248
208 3300054114 Ga0501084_0081944 Ga0501084_0081944_370_1134 248
209 3300060353 Ga0501082_0342916 Ga0501082_0342916_367_1131 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

27

213

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

33

250

0.95

PF08659

KR

KR domain

27

183

0.84

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

29

165

0.76

PF23441

20

242

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ixj-assembly3.cif.gz_G-3 the crystal structure of sulfoacetaldehyde reductase from klebsiella oxytoca 0.9537 6 241
3rku-assembly1.cif.gz_D substrate fingerprint and the structure of nadp+ dependent serine dehydrogenase from saccharomyces cerevisiae complexed with nadp+ 0.952 5 246
2jap-assembly1.cif.gz_C clavulanic acid dehydrogenase: structural and biochemical analysis of the final step in the biosynthesis of the beta-lactamase inhibitor clavulanic acid 0.9355 6 239
3asv-assembly1.cif.gz_A the closed form of serine dehydrogenase complexed with nadp+ 0.9299 7 248
3rku-assembly1.cif.gz_D substrate fingerprint and the structure of nadp+ dependent serine dehydrogenase from saccharomyces cerevisiae complexed with nadp+ 0.9259 5 246
ID Description Score Start End Superfamily
af_P9WGR5_6_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9856 3 246 3.40.50.720
af_P9WGR5_6_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9776 3 246 3.40.50.720
6ixjD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9556 6 241 3.40.50.720
af_O15744_2_259_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9535 4 247 3.40.50.720
3rkuD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.952 5 246 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4S5AJD9-F1-model_v4 SDR family oxidoreductase 0.9978 5 246 GO:0016491
AF-A0A512HT34-F1-model_v4 Oxidoreductase 0.9955 6 248 GO:0016491
AF-A0A316TNT1-F1-model_v4 Oxidoreductase 0.9941 2 246 GO:0016491
AF-W4U9F0-F1-model_v4 deleted 0.9937 5 160
AF-A0A7Y9RVM8-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG 0.9936 6 246 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.57 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map