F319463

General Info

Members Datasets Scaffolds Average Seq Length
209 151 418 179

Family's Representative Sequence

Representative Sequence 3300046463|Ga0495653_0175404|Ga0495653_0175404_324_878
Length 184
Sequence MGETFWELRGLYGLMAEFEEPEQLLAAAERAYQAGYRKMDAYTPLPIEGLAEAIGFHRTWVSPLVLCGGLTGCVGGFTLLYWITTIAYAHNVGGRPFNSWPMYIPIMFECTVLLASLTAVVGMFALNGLPQPYHPVFNVPEFTARASRDRFFLCIEAVDPMFDRERTAAFLQQLNPEEVAEVDK

Samples

Sample ID Description Type Environment
1 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
58 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
89 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.74
Metatranscriptomes 5.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.48
Rhizosphere 99.04
Stem 0
Stem Tuber 0
Unclassified 11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495653_0175404 3300046463 Bacteria 1476
2 Ga0058861_11562399 3300004800 Bacteria 1158
3 Ga0070658_10011008 3300005327 Bacteria 7251
4 Ga0070690_100093160 3300005330 Bacteria 1987
5 Ga0070670_100020735 3300005331 Bacteria 5651
6 Ga0070666_10003598 3300005335 Bacteria 9394
7 Ga0068868_100150436 3300005338 Bacteria 1917
8 Ga0070675_100051347 3300005354 Bacteria 3388
9 Ga0070673_100576373 3300005364 Bacteria 1024
10 Ga0070688_100240229 3300005365 Bacteria 1285
11 Ga0070709_10017028 3300005434 Bacteria 4162
12 Ga0070714_100521591 3300005435 Bacteria 1135
13 Ga0070713_100026067 3300005436 Bacteria 4583
14 Ga0070713_100296006 3300005436 Unclassified 1489
15 Ga0070713_100440328 3300005436 Bacteria 1222
16 Ga0070710_10251532 3300005437 Bacteria 1136
17 Ga0070708_100051475 3300005445 Bacteria 3649
18 Ga0068867_100259659 3300005459 Bacteria 1416
19 Ga0070707_100322374 3300005468 Bacteria 1501
20 Ga0070684_100748332 3300005535 Bacteria 912
21 Ga0070697_100083334 3300005536 Bacteria 2637
22 Ga0070672_100450744 3300005543 Bacteria 1108
23 Ga0070665_100229004 3300005548 Bacteria 1858
24 Ga0068855_100018320 3300005563 Bacteria 8410
25 Ga0068855_100141843 3300005563 Bacteria 2738
26 Ga0068856_101476944 3300005614 Bacteria 694
27 Ga0068852_100432076 3300005616 Bacteria 1300
28 Ga0068859_100005154 3300005617 Bacteria 13269
29 Ga0068861_100061902 3300005719 Bacteria 2873
30 Ga0068861_100102245 3300005719 Bacteria 2281
31 Ga0068863_100128280 3300005841 Bacteria 2420
32 Ga0068863_100169897 3300005841 Bacteria 2091
33 Ga0068858_100008679 3300005842 Bacteria 9755
34 Ga0068860_100045632 3300005843 Unclassified 4179
35 Ga0081538_10028545 3300005981 Bacteria 3834
36 Ga0081540_1040331 3300005983 Unclassified 2435
37 Ga0081540_1116448 3300005983 Bacteria 1118
38 Ga0070717_10096715 3300006028 Bacteria 2501
39 Ga0070716_100638611 3300006173 Bacteria 806
40 Ga0070712_100377641 3300006175 Bacteria 1166
41 Ga0070712_100411528 3300006175 Bacteria 1119
42 Ga0097621_100463891 3300006237 Bacteria 1143
43 Ga0097621_100650891 3300006237 Bacteria 967
44 Ga0068871_100453784 3300006358 Bacteria 1149
45 Ga0068865_100092778 3300006881 Bacteria 2194
46 Ga0075436_100078354 3300006914 Bacteria 2289
47 Ga0097620_100005154 3300006931 Bacteria 13269
48 Ga0075435_100018398 3300007076 Bacteria 5313
49 Ga0105240_10013180 3300009093 Bacteria 11372
50 Ga0105245_10218934 3300009098 Unclassified 1836
51 Ga0105245_10977581 3300009098 Bacteria 890
52 Ga0105242_10008483 3300009176 Bacteria 7891
53 Ga0105248_10309124 3300009177 Bacteria 1780
54 Ga0105237_10018318 3300009545 Bacteria 7247
55 Ga0105237_10257480 3300009545 Bacteria 1747
56 Ga0105238_10713844 3300009551 Bacteria 1015
57 Ga0105238_11043805 3300009551 Bacteria 839
58 Ga0157370_10001450 3300013104 Bacteria 29357
59 Ga0157370_10304968 3300013104 Bacteria 1470
60 Ga0157370_10381031 3300013104 Bacteria 1299
61 Ga0157369_10066880 3300013105 Bacteria 3866
62 Ga0157369_11185003 3300013105 Bacteria 780
63 Ga0157374_10004870 3300013296 Bacteria 11261
64 Ga0157374_10220156 3300013296 Unclassified 1862
65 Ga0157378_10040893 3300013297 Bacteria 4112
66 Ga0157372_10101728 3300013307 Bacteria 3281
67 Ga0157372_10224037 3300013307 Bacteria 2180
68 Ga0157372_10863675 3300013307 Bacteria 1050
69 Ga0163163_10410810 3300014325 Bacteria 1412
70 Ga0157379_10056148 3300014968 Bacteria 3519
71 Ga0157379_11008093 3300014968 Bacteria 794
72 Ga0206349_1070763 3300020075 Bacteria 2281
73 Ga0206350_11532499 3300020080 Bacteria 2061
74 Ga0224712_10003094 3300022467 Bacteria 4248
75 Ga0224572_1026562 3300024225 Bacteria 1110
76 Ga0228598_1000409 3300024227 Bacteria 8673
77 Ga0228598_1011623 3300024227 Bacteria 1751
78 Ga0207680_10003199 3300025903 Bacteria 7697
79 Ga0207680_10443396 3300025903 Unclassified 921
80 Ga0207647_10027584 3300025904 Bacteria 3701
81 Ga0207699_10020544 3300025906 Bacteria 3542
82 Ga0207699_10140522 3300025906 Bacteria 1586
83 Ga0207705_10009120 3300025909 Bacteria 7232
84 Ga0207684_10367756 3300025910 Bacteria 1237
85 Ga0207707_11020987 3300025912 Bacteria 678
86 Ga0207695_10260962 3300025913 Bacteria 1630
87 Ga0207671_10079303 3300025914 Bacteria 2460
88 Ga0207663_10355768 3300025916 Unclassified 1110
89 Ga0207663_10485528 3300025916 Bacteria 958
90 Ga0207646_10446493 3300025922 Bacteria 1167
91 Ga0207650_10101286 3300025925 Bacteria 2217
92 Ga0207700_10300021 3300025928 Unclassified 1387
93 Ga0207700_11131634 3300025928 Unclassified 700
94 Ga0207664_10133689 3300025929 Bacteria 2091
95 Ga0207664_10139090 3300025929 Bacteria 2052
96 Ga0207686_10344391 3300025934 Bacteria 1120
97 Ga0207709_10097720 3300025935 Bacteria 1935
98 Ga0207711_10295114 3300025941 Bacteria 1494
99 Ga0207689_10000243 3300025942 Bacteria 48629
100 Ga0207661_10616839 3300025944 Unclassified 996
101 Ga0207667_10024810 3300025949 Bacteria 6575
102 Ga0207677_10276804 3300026023 Bacteria 1375
103 Ga0207703_10008529 3300026035 Bacteria 8092
104 Ga0207703_10786397 3300026035 Bacteria 908
105 Ga0207641_10090063 3300026088 Bacteria 2682
106 Ga0207641_10355007 3300026088 Unclassified 1398
107 Ga0207641_10366647 3300026088 Bacteria 1376
108 Ga0207648_10012550 3300026089 Bacteria 7927
109 Ga0207674_10955913 3300026116 Unclassified 825
110 Ga0207675_100084485 3300026118 Bacteria 2978
111 Ga0207675_100203232 3300026118 Bacteria 1903
112 Ga0207698_10443328 3300026142 Bacteria 1251
113 Ga0268265_10036157 3300028380 Bacteria 3616
114 Ga0268265_10893012 3300028380 Unclassified 872
115 Ga0268264_10140733 3300028381 Bacteria 2151
116 Ga0265338_10011971 3300028800 Bacteria 9939
117 Ga0265338_10038998 3300028800 Bacteria 4490
118 Ga0265338_10131968 3300028800 Bacteria 1970
119 Ga0265324_10122033 3300029957 Bacteria 885
120 Ga0265762_1004809 3300030760 Bacteria 2417
121 Ga0265760_10000642 3300031090 Bacteria 9911
122 Ga0265760_10008785 3300031090 Bacteria 2888
123 Ga0265760_10028321 3300031090 Bacteria 1644
124 Ga0265760_10057065 3300031090 Bacteria 1182
125 Ga0265760_10203691 3300031090 Bacteria 669
126 Ga0265760_10244547 3300031090 Unclassified 619
127 Ga0265325_10004785 3300031241 Bacteria 8482
128 Ga0265325_10011928 3300031241 Bacteria 4981
129 Ga0265325_10130473 3300031241 Unclassified 1204
130 Ga0265339_10281307 3300031249 Bacteria 797
131 Ga0265331_10045040 3300031250 Bacteria 2130
132 Ga0265331_10045350 3300031250 Bacteria 2122
133 Ga0265316_10017299 3300031344 Bacteria 6238
134 Ga0265316_10605036 3300031344 Unclassified 777
135 Ga0307408_100178935 3300031548 Bacteria 1699
136 Ga0265313_10011299 3300031595 Bacteria 5561
137 Ga0265313_10059376 3300031595 Unclassified 1799
138 Ga0265314_10001027 3300031711 Bacteria 32557
139 Ga0265314_10061531 3300031711 Bacteria 2555
140 Ga0265314_10196781 3300031711 Bacteria 1195
141 Ga0265342_10012381 3300031712 Bacteria 5781
142 Ga0307409_100413494 3300031995 Bacteria 1292
143 Ga0373934_0024041 3300035086 Bacteria 2356
144 Ga0373936_0087518 3300035113 Bacteria 1303
145 Ga0373953_0115815 3300035117 Bacteria 1136
146 Ga0373954_0253878 3300035118 Bacteria 866
147 Ga0373956_0016913 3300035119 Unclassified 3067
148 Ga0373956_0304009 3300035119 Bacteria 760
149 Ga0373955_0013533 3300035172 Bacteria 3948
150 Ga0373935_0175790 3300035692 Bacteria 1467
151 Ga0373927_0011353 3300035695 Bacteria 5930
152 Ga0373927_0261887 3300035695 Bacteria 1137
153 Ga0373933_0000341 3300035724 Bacteria 29999
154 Ga0373933_0180429 3300035724 Bacteria 1346
155 Ga0373947_0002695 3300035725 Bacteria 10658
156 Ga0373937_0002952 3300036401 Bacteria 14226
157 Ga0373937_0017747 3300036401 Bacteria 6348
158 Ga0373937_0542802 3300036401 Bacteria 1104
159 Ga0373925_0005288 3300037068 Bacteria 9635
160 Ga0395901_0506959 3300038443 Bacteria 1228
161 Ga0436365_1212111 3300039437 Bacteria 1070
162 Ga0436360_0387000 3300039438 Bacteria 701
163 Ga0436360_0658519 3300039438 Bacteria 969
164 Ga0451577_0014861 3300042876 Bacteria 7253
165 Ga0466969_0000001 3300044656 Bacteria 189617
166 Ga0453683_0018091 3300044673 Bacteria 4527
167 Ga0453684_0301093 3300044712 Bacteria 1822
168 Ga0451576_0964149 3300045051 Unclassified 894
169 Ga0495651_0002016 3300046462 Bacteria 15675
170 Ga0495580_0017716 3300046472 Bacteria 5317
171 Ga0495580_0034974 3300046472 Bacteria 3615
172 Ga0495582_0081506 3300046473 Bacteria 1797
173 Ga0495582_0092600 3300046473 Bacteria 1686
174 Ga0495585_0390656 3300046492 Unclassified 671
175 Ga0495630_0278401 3300046517 Bacteria 1278
176 Ga0495652_0023344 3300046529 Bacteria 5483
177 Ga0495652_0641822 3300046529 Bacteria 720
178 Ga0495587_0000213 3300046536 Bacteria 42986
179 Ga0495633_0204459 3300046558 Bacteria 906
180 Ga0495657_0147044 3300046675 Unclassified 1465
181 Ga0495599_0122265 3300046678 Bacteria 1618
182 Ga0495623_0135134 3300046679 Bacteria 1472
183 Ga0495658_0039776 3300046683 Bacteria 2611
184 Ga0495613_0007406 3300046689 Bacteria 8180
185 Ga0495624_0489861 3300046690 Unclassified 736
186 Ga0495604_0126471 3300047317 Unclassified 1842
187 Ga0495675_0001106 3300047444 Bacteria 16360
188 Ga0495684_0170317 3300047471 Bacteria 1620
189 Ga0495602_0000325 3300048088 Bacteria 43966
190 Ga0495602_0636503 3300048088 Bacteria 730
191 Ga0496112_0004726 3300048915 Bacteria 11609
192 Ga0501037_0301900 3300049573 Bacteria 1112
193 Ga0501043_0008651 3300049579 Bacteria 8022
194 Ga0501046_0026110 3300049580 Bacteria 4772
195 Ga0501047_0026622 3300049581 Bacteria 5565
196 Ga0501047_0037666 3300049581 Bacteria 4676
197 Ga0501047_0325272 3300049581 Bacteria 1377
198 Ga0501073_0028188 3300049589 Bacteria 4013
199 Ga0501216_027094 3300049660 Bacteria 1038
200 Ga0501080_0209961 3300049742 Bacteria 1784
201 Ga0501080_0529731 3300049742 Bacteria 1051
202 Ga0501083_0457801 3300049744 Bacteria 830
203 Ga0501035_0075489 3300049822 Bacteria 2981
204 Ga0501035_0629315 3300049822 Bacteria 872
205 Ga0501044_0064970 3300049823 Bacteria 3722
206 Ga0501044_0907454 3300049823 Bacteria 756
207 nmdc:mga08x19_7905_c1 3300050514 Bacteria 6318
208 Ga0495595_0164198 3300053084 Bacteria 1097
209 Ga0501082_0333767 3300060353 Bacteria 1321
210 Ga0495653_0175404
211 Ga0058861_11562399
212 Ga0070658_10011008
213 Ga0070690_100093160
214 Ga0070670_100020735
215 Ga0070666_10003598
216 Ga0068868_100150436
217 Ga0070675_100051347
218 Ga0070673_100576373
219 Ga0070688_100240229
220 Ga0070709_10017028
221 Ga0070714_100521591
222 Ga0070713_100026067
223 Ga0070713_100296006
224 Ga0070713_100440328
225 Ga0070710_10251532
226 Ga0070708_100051475
227 Ga0068867_100259659
228 Ga0070707_100322374
229 Ga0070684_100748332
230 Ga0070697_100083334
231 Ga0070672_100450744
232 Ga0070665_100229004
233 Ga0068855_100018320
234 Ga0068855_100141843
235 Ga0068856_101476944
236 Ga0068852_100432076
237 Ga0068859_100005154
238 Ga0068861_100061902
239 Ga0068861_100102245
240 Ga0068863_100128280
241 Ga0068863_100169897
242 Ga0068858_100008679
243 Ga0068860_100045632
244 Ga0081538_10028545
245 Ga0081540_1040331
246 Ga0081540_1116448
247 Ga0070717_10096715
248 Ga0070716_100638611
249 Ga0070712_100377641
250 Ga0070712_100411528
251 Ga0097621_100463891
252 Ga0097621_100650891
253 Ga0068871_100453784
254 Ga0068865_100092778
255 Ga0075436_100078354
256 Ga0097620_100005154
257 Ga0075435_100018398
258 Ga0105240_10013180
259 Ga0105245_10218934
260 Ga0105245_10977581
261 Ga0105242_10008483
262 Ga0105248_10309124
263 Ga0105237_10018318
264 Ga0105237_10257480
265 Ga0105238_10713844
266 Ga0105238_11043805
267 Ga0157370_10001450
268 Ga0157370_10304968
269 Ga0157370_10381031
270 Ga0157369_10066880
271 Ga0157369_11185003
272 Ga0157374_10004870
273 Ga0157374_10220156
274 Ga0157378_10040893
275 Ga0157372_10101728
276 Ga0157372_10224037
277 Ga0157372_10863675
278 Ga0163163_10410810
279 Ga0157379_10056148
280 Ga0157379_11008093
281 Ga0206349_1070763
282 Ga0206350_11532499
283 Ga0224712_10003094
284 Ga0224572_1026562
285 Ga0228598_1000409
286 Ga0228598_1011623
287 Ga0207680_10003199
288 Ga0207680_10443396
289 Ga0207647_10027584
290 Ga0207699_10020544
291 Ga0207699_10140522
292 Ga0207705_10009120
293 Ga0207684_10367756
294 Ga0207707_11020987
295 Ga0207695_10260962
296 Ga0207671_10079303
297 Ga0207663_10355768
298 Ga0207663_10485528
299 Ga0207646_10446493
300 Ga0207650_10101286
301 Ga0207700_10300021
302 Ga0207700_11131634
303 Ga0207664_10133689
304 Ga0207664_10139090
305 Ga0207686_10344391
306 Ga0207709_10097720
307 Ga0207711_10295114
308 Ga0207689_10000243
309 Ga0207661_10616839
310 Ga0207667_10024810
311 Ga0207677_10276804
312 Ga0207703_10008529
313 Ga0207703_10786397
314 Ga0207641_10090063
315 Ga0207641_10355007
316 Ga0207641_10366647
317 Ga0207648_10012550
318 Ga0207674_10955913
319 Ga0207675_100084485
320 Ga0207675_100203232
321 Ga0207698_10443328
322 Ga0268265_10036157
323 Ga0268265_10893012
324 Ga0268264_10140733
325 Ga0265338_10011971
326 Ga0265338_10038998
327 Ga0265338_10131968
328 Ga0265324_10122033
329 Ga0265762_1004809
330 Ga0265760_10000642
331 Ga0265760_10008785
332 Ga0265760_10028321
333 Ga0265760_10057065
334 Ga0265760_10203691
335 Ga0265760_10244547
336 Ga0265325_10004785
337 Ga0265325_10011928
338 Ga0265325_10130473
339 Ga0265339_10281307
340 Ga0265331_10045040
341 Ga0265331_10045350
342 Ga0265316_10017299
343 Ga0265316_10605036
344 Ga0307408_100178935
345 Ga0265313_10011299
346 Ga0265313_10059376
347 Ga0265314_10001027
348 Ga0265314_10061531
349 Ga0265314_10196781
350 Ga0265342_10012381
351 Ga0307409_100413494
352 Ga0373934_0024041
353 Ga0373936_0087518
354 Ga0373953_0115815
355 Ga0373954_0253878
356 Ga0373956_0016913
357 Ga0373956_0304009
358 Ga0373955_0013533
359 Ga0373935_0175790
360 Ga0373927_0011353
361 Ga0373927_0261887
362 Ga0373933_0000341
363 Ga0373933_0180429
364 Ga0373947_0002695
365 Ga0373937_0002952
366 Ga0373937_0017747
367 Ga0373937_0542802
368 Ga0373925_0005288
369 Ga0395901_0506959
370 Ga0436365_1212111
371 Ga0436360_0387000
372 Ga0436360_0658519
373 Ga0451577_0014861
374 Ga0466969_0000001
375 Ga0453683_0018091
376 Ga0453684_0301093
377 Ga0451576_0964149
378 Ga0495651_0002016
379 Ga0495580_0017716
380 Ga0495580_0034974
381 Ga0495582_0081506
382 Ga0495582_0092600
383 Ga0495585_0390656
384 Ga0495630_0278401
385 Ga0495652_0023344
386 Ga0495652_0641822
387 Ga0495587_0000213
388 Ga0495633_0204459
389 Ga0495657_0147044
390 Ga0495599_0122265
391 Ga0495623_0135134
392 Ga0495658_0039776
393 Ga0495613_0007406
394 Ga0495624_0489861
395 Ga0495604_0126471
396 Ga0495675_0001106
397 Ga0495684_0170317
398 Ga0495602_0000325
399 Ga0495602_0636503
400 Ga0496112_0004726
401 Ga0501037_0301900
402 Ga0501043_0008651
403 Ga0501046_0026110
404 Ga0501047_0026622
405 Ga0501047_0037666
406 Ga0501047_0325272
407 Ga0501073_0028188
408 Ga0501216_027094
409 Ga0501080_0209961
410 Ga0501080_0529731
411 Ga0501083_0457801
412 Ga0501035_0075489
413 Ga0501035_0629315
414 Ga0501044_0064970
415 Ga0501044_0907454
416 nmdc:mga08x19_7905_c1
417 Ga0495595_0164198
418 Ga0501082_0333767

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11821

ActD

Alternative complex III, ActD subunit

12

181

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_D cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.7655 10 182
6loe-assembly1.cif.gz_D cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.7581 10 182
6f0k-assembly1.cif.gz_D alternative complex iii 0.7117 10 178
6f0k-assembly1.cif.gz_D alternative complex iii 0.7016 10 178
6btm-assembly1.cif.gz_D structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.649 13 182
ID Description Score Start End Superfamily
af_Q9D8B4_18_127_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6275 57 129 1.10.10.1740
af_Q7JQF1_6_190_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5485 60 134 1.20.1070.10
af_Q9NAQ9_87_204_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4906 62 131 1.10.10.1740
af_Q7T376_1_103_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.4831 60 129 1.20.5.110
af_P29131_239_319_3.30.70.1070 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Sporulation related repeat 0.4755 134 182 3.30.70.1070
ID Description Score Start End GO Terms
AF-M6K509-F1-model_v4 PF11821 domain protein 0.8929 54 123 GO:0016020
AF-M6K509-F1-model_v4 PF11821 domain protein 0.8606 54 123 GO:0016020
AF-A0A2M9G325-F1-model_v4 DUF3341 domain-containing protein 0.8232 10 182 GO:0016020
AF-A0A1W9VMR4-F1-model_v4 Uncharacterized protein 0.8095 27 124 GO:0016020
AF-A0A257V3W0-F1-model_v4 DUF3341 domain-containing protein 0.8022 1 127 GO:0016020

Map