F319396

General Info

Members Datasets Scaffolds Average Seq Length
209 168 194 166

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_0034636|Ga0451853_0034636_694_1275
Length 193
Sequence LDFGSCDWGFNYLDLGIWFLEFINIISMLLSQVVAAADNNAIGKNNKLLWTLPNDMKFFKNTTWGMPVIMGRKTYESLGKPLPGRTNIIITRKQDWQPQGVFVVHDIQEAMVAAGDTDAKEAFIIGGGEIYRQTLPITQRVYLTRVHTTLEGDTFFPDMNEADWQLLSQLDFNADEKHAYAYSFQVWQRKNIE

Samples

Sample ID Description Type Environment
1 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
2 2643221569 Achromobacter sp. Root565 Isolate Unclassified
3 2643221594 Achromobacter sp. Root170 Isolate Unclassified
4 2643221621 Achromobacter sp. Root83 Isolate Unclassified
5 2738541278 Niastella sp. CF465 Isolate Unclassified
6 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
7 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
8 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
9 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
10 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
11 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
12 2858950400 Achromobacter sp. K91 Isolate Unclassified
13 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
14 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
15 2941479691
16 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
66 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
78 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
79 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
80 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
83 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
84 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
85 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
86 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
87 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
90 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
91 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
92 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
93 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
114 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
115 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
116 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
117 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
118 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
119 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
138 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
139 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
152 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
153 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
154 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
155 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
156 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
157 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
158 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
159 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
160 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
161 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
162 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
163 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
164 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.82
Metatranscriptomes 0
Isolates 7.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.53
Nodule 0
Rhizoplane 2.87
Rhizosphere 62.2
Stem 0
Stem Tuber 0
Unclassified 24.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1006176 3300002738 Bacteria 1790
2 rootH1_10088033 3300003316 Bacteria 1999
3 rootL2_10161863 3300003322 Bacteria 2539
4 rootL2_10245613 3300003322 Bacteria 4291
5 rootH1_10002797 3300003323 Bacteria 12596
6 rootH1_10111784 3300003323 Bacteria 1166
7 Ga0070670_100157564 3300005331 Bacteria 1967
8 Ga0070670_100185321 3300005331 Bacteria 1807
9 Ga0070671_100120207 3300005355 Bacteria 2210
10 Ga0070674_100222421 3300005356 Bacteria 1469
11 Ga0070673_100535651 3300005364 Bacteria 1062
12 Ga0070713_100379814 3300005436 Bacteria 1316
13 Ga0070678_100094577 3300005456 Bacteria 2301
14 Ga0068853_100343936 3300005539 Bacteria 1386
15 Ga0068853_100483206 3300005539 Bacteria 1168
16 Ga0070672_100760564 3300005543 Bacteria 851
17 Ga0068857_100088367 3300005577 Bacteria 2772
18 Ga0068856_100209983 3300005614 Bacteria 1962
19 Ga0068859_100953095 3300005617 Bacteria 941
20 Ga0068851_10082300 3300005834 Bacteria 1683
21 Ga0075365_10529976 3300006038 Bacteria 833
22 Ga0070715_10166682 3300006163 Bacteria 1093
23 Ga0070716_100440299 3300006173 Bacteria 947
24 Ga0075366_10062101 3300006195 Bacteria 2221
25 Ga0097621_100219389 3300006237 Bacteria 1657
26 Ga0068871_100096289 3300006358 Bacteria 2472
27 Ga0097620_100952939 3300006931 Bacteria 941
28 Ga0105240_10088554 3300009093 Bacteria 3788
29 Ga0114129_10001943 3300009147 Bacteria 28301
30 Ga0105241_10022496 3300009174 Bacteria 4670
31 Ga0105242_10518661 3300009176 Bacteria 1137
32 Ga0105237_10084648 3300009545 Bacteria 3161
33 Ga0105239_10002914 3300010375 Bacteria 21377
34 Ga0105239_10636404 3300010375 Bacteria 1218
35 Ga0157371_10152961 3300013102 Bacteria 1646
36 Ga0157374_10176698 3300013296 Bacteria 2084
37 Ga0157374_11175913 3300013296 Bacteria 788
38 Ga0157375_10218480 3300013308 Bacteria 2064
39 Ga0157375_10479764 3300013308 Bacteria 1408
40 Ga0163163_10530693 3300014325 Unclassified 1239
41 Ga0157380_10007862 3300014326 Bacteria 7589
42 Ga0157380_10554397 3300014326 Bacteria 1128
43 Ga0157379_10182349 3300014968 Bacteria 1897
44 Ga0182006_1041370 3300015261 Bacteria 1809
45 Ga0163161_10038704 3300017792 Bacteria 3421
46 Ga0163161_10112573 3300017792 Bacteria 2036
47 Ga0209050_1005433 3300025298 Bacteria 8019
48 Ga0207685_10124147 3300025905 Bacteria 1137
49 Ga0207654_10328335 3300025911 Bacteria 1048
50 Ga0207646_10763308 3300025922 Bacteria 862
51 Ga0207650_10296882 3300025925 Bacteria 1319
52 Ga0207659_10789337 3300025926 Bacteria 816
53 Ga0207639_10404184 3300026041 Bacteria 1231
54 Ga0207678_10655225 3300026067 Bacteria 923
55 Ga0207702_10015389 3300026078 Bacteria 6339
56 Ga0207674_10050416 3300026116 Bacteria 4253
57 Ga0207675_101018191 3300026118 Unclassified 847
58 Ga0207683_10024062 3300026121 Bacteria 5241
59 Ga0207683_10295570 3300026121 Bacteria 1481
60 Ga0209371_1017763 3300027312 Bacteria 1831
61 Ga0268256_1019812 3300030500 Bacteria 1831
62 Ga0265339_10093403 3300031249 Bacteria 1574
63 Ga0265327_10056822 3300031251 Bacteria 2015
64 Ga0307513_10135420 3300031456 Bacteria 2400
65 Ga0307513_10193877 3300031456 Bacteria 1880
66 Ga0307513_10661090 3300031456 Bacteria 752
67 Ga0316579_10301550 3300031691 Bacteria 774
68 Ga0265314_10012145 3300031711 Bacteria 7053
69 Ga0316576_10121529 3300031727 Bacteria 1961
70 Ga0316576_10675028 3300031727 Unclassified 750
71 Ga0316577_10012248 3300031733 Bacteria 4671
72 Ga0307412_10000291 3300031911 Bacteria 31875
73 Ga0307409_101318965 3300031995 Unclassified 747
74 Ga0307414_10149613 3300032004 Bacteria 1840
75 Ga0316585_10104490 3300032137 Bacteria 930
76 Ga0373952_0000053 3300035092 Bacteria 14353
77 Ga0373961_0174936 3300035241 Bacteria 745
78 Ga0316582_0026741 3300036647 Bacteria 3476
79 Ga0316584_0011555 3300036712 Bacteria 6208
80 Ga0439436_0013938 3300041404 Bacteria 2429
81 Ga0439439_0014706 3300041406 Bacteria 1907
82 Ga0451795_0252109 3300041456 Bacteria 624
83 Ga0451807_0989023 3300041486 Bacteria 1281
84 Ga0451843_0122657 3300041509 Bacteria 661
85 Ga0451843_1671500 3300041509 Bacteria 653
86 Ga0451855_0320535 3300041511 Bacteria 708
87 Ga0451853_0034636 3300041512 Bacteria 1830
88 Ga0451853_0396800 3300041512 Bacteria 1503
89 Ga0451853_0540903 3300041512 Bacteria 2515
90 Ga0439431_0011042 3300041997 Bacteria 2058
91 Ga0439445_0050234 3300042004 Unclassified 1124
92 Ga0439449_0025843 3300042007 Bacteria 2193
93 Ga0439457_000392 3300042014 Bacteria 12386
94 Ga0466969_0001938 3300044656 Bacteria 11055
95 Ga0466972_0000013 3300044658 Bacteria 229345
96 Ga0466972_0172940 3300044658 Bacteria 1013
97 Ga0466965_0197199 3300044683 Bacteria 1067
98 Ga0466961_0162561 3300044693 Bacteria 1391
99 Ga0466968_0078380 3300044735 Bacteria 1448
100 Ga0466957_0000305 3300044842 Bacteria 24128
101 Ga0466959_0000017 3300045049 Bacteria 143170
102 Ga0495638_0552623 3300046460 Unclassified 572
103 Ga0495668_0002833 3300046616 Bacteria 13784
104 Ga0495600_0639883 3300046809 Bacteria 644
105 Ga0495581_0697931 3300047315 Bacteria 585
106 Ga0495674_0168818 3300047319 Bacteria 1827
107 Ga0495672_0070231 3300047320 Bacteria 1985
108 Ga0495684_0538652 3300047471 Bacteria 797
109 Ga0496101_0185926 3300048904 Bacteria 1602
110 Ga0496109_0729245 3300048912 Bacteria 929
111 Ga0496116_0005394 3300048919 Bacteria 11895
112 Ga0496116_0086332 3300048919 Bacteria 1925
113 Ga0496116_0168276 3300048919 Bacteria 1191
114 Ga0496117_0018155 3300048920 Bacteria 5842
115 Ga0496118_0002353 3300048921 Bacteria 25615
116 Ga0496118_0035766 3300048921 Bacteria 4026
117 Ga0496119_0184947 3300048922 Bacteria 1090
118 Ga0496119_0217442 3300048922 Bacteria 980
119 Ga0496120_0001590 3300048923 Bacteria 26409
120 Ga0496121_0000137 3300048924 Bacteria 164043
121 Ga0496121_0014228 3300048924 Bacteria 8462
122 Ga0496121_0028444 3300048924 Bacteria 5202
123 Ga0496121_0227737 3300048924 Bacteria 1308
124 Ga0496122_0000102 3300048925 Bacteria 197296
125 Ga0496123_0000110 3300048926 Bacteria 165766
126 Ga0496123_0070616 3300048926 Bacteria 2184
127 Ga0496124_0000013 3300048927 Bacteria 484884
128 Ga0496124_0020116 3300048927 Bacteria 6180
129 Ga0496124_0219660 3300048927 Bacteria 1430
130 Ga0496125_0000023 3300048928 Bacteria 449042
131 Ga0496125_0026892 3300048928 Bacteria 5226
132 Ga0496125_0030599 3300048928 Bacteria 4812
133 Ga0496126_0455869 3300048929 Bacteria 1028
134 Ga0496126_0925073 3300048929 Bacteria 659
135 Ga0501033_0055816 3300049570 Bacteria 2920
136 Ga0501034_0000115 3300049571 Bacteria 146825
137 Ga0501034_0011886 3300049571 Bacteria 9006
138 Ga0501034_0946574 3300049571 Bacteria 747
139 Ga0501036_0009531 3300049572 Bacteria 7986
140 Ga0501037_0652656 3300049573 Bacteria 703
141 Ga0501039_0008666 3300049575 Bacteria 7748
142 Ga0501040_0030676 3300049576 Bacteria 3632
143 Ga0501041_0002567 3300049577 Bacteria 10350
144 Ga0501042_0142934 3300049578 Bacteria 1725
145 Ga0501043_0158423 3300049579 Bacteria 1770
146 Ga0501046_0384753 3300049580 Bacteria 1015
147 Ga0501047_0051110 3300049581 Bacteria 3992
148 Ga0501047_0142967 3300049581 Bacteria 2270
149 Ga0501048_0008525 3300049582 Bacteria 7750
150 Ga0501048_0290537 3300049582 Bacteria 1163
151 Ga0501068_0205682 3300049584 Bacteria 1249
152 Ga0501074_0207777 3300049590 Bacteria 1395
153 Ga0501075_0000301 3300049591 Bacteria 27561
154 Ga0501076_0000098 3300049592 Bacteria 47158
155 Ga0501077_0323910 3300049593 Bacteria 982
156 Ga0501257_012912 3300049686 Bacteria 1914
157 Ga0501219_000292 3300049703 Bacteria 8850
158 Ga0501225_0002522 3300049705 Bacteria 5664
159 Ga0501225_0028679 3300049705 Bacteria 1529
160 Ga0501079_0010818 3300049741 Bacteria 6949
161 Ga0501080_0001504 3300049742 Bacteria 19672
162 Ga0501081_0007806 3300049743 Bacteria 6936
163 Ga0501083_0067795 3300049744 Bacteria 2375
164 Ga0501241_026735 3300049758 Bacteria 1077
165 Ga0501035_0040004 3300049822 Bacteria 4239
166 Ga0501035_0235851 3300049822 Bacteria 1558
167 Ga0501035_1009823 3300049822 Bacteria 654
168 Ga0501044_0009439 3300049823 Bacteria 10627
169 Ga0501044_0526242 3300049823 Bacteria 1082
170 Ga0501045_0003259 3300049824 Bacteria 11087
171 Ga0501284_00041 3300050005 Bacteria 50589
172 nmdc:mga0k408_39157_c1 3300050493 Bacteria 2722
173 nmdc:mga0k408_658730_c1 3300050493 Bacteria 615
174 nmdc:mga05p37_1237_c1 3300050507 Bacteria 29632
175 Ga0500578_0000155 3300053086 Bacteria 80380
176 Ga0500578_0014515 3300053086 Bacteria 5065
177 Ga0500578_0271595 3300053086 Unclassified 1014
178 Ga0500646_0022836 3300053090 Bacteria 1674
179 Ga0500651_0283957 3300053093 Bacteria 954
180 Ga0500594_0030675 3300053118 Bacteria 1413
181 Ga0500652_006563 3300053131 Bacteria 3755
182 Ga0500658_0215026 3300053134 Bacteria 881
183 Ga0500564_033785 3300053138 Bacteria 2361
184 Ga0500573_0052070 3300053140 Bacteria 2354
185 Ga0500588_0142821 3300053146 Bacteria 861
186 Ga0500589_051309 3300053147 Bacteria 1913
187 Ga0500590_245754 3300053148 Bacteria 716
188 Ga0500622_0013908 3300053156 Bacteria 4331
189 Ga0500639_054721 3300053163 Bacteria 2072
190 Ga0500645_022740 3300053730 Bacteria 1925
191 Ga0501084_0036107 3300054114 Bacteria 4129
192 Ga0500661_066516 3300055283 Bacteria 656
193 Ga0501082_0021308 3300060353 Bacteria 5591
194 Ga0530510_0001520 3300061734 Bacteria 15616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047315 Ga0495581_0697931 Ga0495581_0697931_55_480 138
2 3300005436 Ga0070713_100379814 Ga0070713_1003798141 156
3 3300025905 Ga0207685_10124147 Ga0207685_101241472 156
4 iso_pu_bacteria 2599185292 2599905443 157
5 iso_pu_bacteria 2643221569 2643858808 157
6 iso_pu_bacteria 2643221594 2643982028 157
7 iso_pu_bacteria 2643221621 2644122646 157
8 iso_pu_bacteria 2808606395 2809034131 157
9 iso_pu_bacteria 2858950400 2858954966 157
10 iso_pu_bacteria 2941479691 2941479930 157
11 3300031911 Ga0307412_10000291 Ga0307412_100002912 158
12 3300048904 Ga0496101_0185926 Ga0496101_0185926_341_823 158
13 3300048919 Ga0496116_0086332 Ga0496116_0086332_1036_1518 158
14 3300048921 Ga0496118_0035766 Ga0496118_0035766_2508_2990 158
15 3300048922 Ga0496119_0217442 Ga0496119_0217442_394_876 158
16 3300048923 Ga0496120_0001590 Ga0496120_0001590_5706_6188 158
17 3300048926 Ga0496123_0070616 Ga0496123_0070616_1016_1498 158
18 3300048927 Ga0496124_0020116 Ga0496124_0020116_1372_1854 158
19 3300048929 Ga0496126_0455869 Ga0496126_0455869_248_730 158
20 iso_pu_bacteria 2765235802 2765464684 158
21 iso_pu_bacteria 2775506902 2776270678 158
22 iso_pu_bacteria 2775506904 2776280499 158
23 iso_pu_bacteria 2839993093 2839996973 158
24 iso_pu_bacteria 2904578770 2904580678 158
25 iso_pu_bacteria 2919119836 2919121608 158
26 3300015261 Ga0182006_1041370 Ga0182006_10413702 159
27 3300025298 Ga0209050_1005433 Ga0209050_10054334 159
28 3300027312 Ga0209371_1017763 Ga0209371_10177632 159
29 3300030500 Ga0268256_1019812 Ga0268256_10198122 159
30 3300048920 Ga0496117_0018155 Ga0496117_0018155_3157_3642 159
31 3300048921 Ga0496118_0002353 Ga0496118_0002353_17407_17892 159
32 3300048922 Ga0496119_0184947 Ga0496119_0184947_31_516 159
33 3300048924 Ga0496121_0000137 Ga0496121_0000137_150252_150737 159
34 3300048928 Ga0496125_0000023 Ga0496125_0000023_445243_445728 159
35 3300048928 Ga0496125_0030599 Ga0496125_0030599_1655_2140 159
36 3300053146 Ga0500588_0142821 Ga0500588_0142821_255_740 159
37 3300050493 nmdc:mga0k408_658730_c1 nmdc:mga0k408_658730_c1_13_495 160
38 iso_pu_bacteria 2857537821 2857539965 160
39 3300013102 Ga0157371_10152961 Ga0157371_101529612 161
40 3300032004 Ga0307414_10149613 Ga0307414_101496132 161
41 3300035092 Ga0373952_0000053 Ga0373952_0000053_7286_7786 161
42 3300035241 Ga0373961_0174936 Ga0373961_0174936_155_655 161
43 3300048919 Ga0496116_0005394 Ga0496116_0005394_7405_7896 161
44 3300048919 Ga0496116_0168276 Ga0496116_0168276_263_754 161
45 3300048924 Ga0496121_0028444 Ga0496121_0028444_602_1093 161
46 3300048925 Ga0496122_0000102 Ga0496122_0000102_145920_146411 161
47 3300048926 Ga0496123_0000110 Ga0496123_0000110_82735_83226 161
48 3300048927 Ga0496124_0219660 Ga0496124_0219660_844_1335 161
49 3300048928 Ga0496125_0026892 Ga0496125_0026892_4119_4610 161
50 3300048929 Ga0496126_0925073 Ga0496126_0925073_58_549 161
51 3300053086 Ga0500578_0271595 Ga0500578_0271595_13_498 161
52 3300006038 Ga0075365_10529976 Ga0075365_105299762 162
53 3300041997 Ga0439431_0011042 Ga0439431_0011042_369_860 162
54 3300042004 Ga0439445_0050234 Ga0439445_0050234_426_917 162
55 3300048924 Ga0496121_0014228 Ga0496121_0014228_3192_3719 162
56 3300048924 Ga0496121_0227737 Ga0496121_0227737_294_812 162
57 3300048927 Ga0496124_0000013 Ga0496124_0000013_61460_61978 162
58 3300049570 Ga0501033_0055816 Ga0501033_0055816_2365_2868 162
59 3300049571 Ga0501034_0011886 Ga0501034_0011886_5775_6323 162
60 3300049571 Ga0501034_0946574 Ga0501034_0946574_231_722 162
61 3300049572 Ga0501036_0009531 Ga0501036_0009531_4794_5297 162
62 3300049573 Ga0501037_0652656 Ga0501037_0652656_86_634 162
63 3300049575 Ga0501039_0008666 Ga0501039_0008666_4906_5409 162
64 3300049576 Ga0501040_0030676 Ga0501040_0030676_2304_2807 162
65 3300049577 Ga0501041_0002567 Ga0501041_0002567_4062_4565 162
66 3300049578 Ga0501042_0142934 Ga0501042_0142934_35_538 162
67 3300049580 Ga0501046_0384753 Ga0501046_0384753_256_759 162
68 3300049581 Ga0501047_0142967 Ga0501047_0142967_664_1212 162
69 3300049582 Ga0501048_0008525 Ga0501048_0008525_5893_6396 162
70 3300049584 Ga0501068_0205682 Ga0501068_0205682_44_547 162
71 3300049590 Ga0501074_0207777 Ga0501074_0207777_750_1253 162
72 3300049591 Ga0501075_0000301 Ga0501075_0000301_26965_27468 162
73 3300049592 Ga0501076_0000098 Ga0501076_0000098_42142_42645 162
74 3300049593 Ga0501077_0323910 Ga0501077_0323910_324_827 162
75 3300049741 Ga0501079_0010818 Ga0501079_0010818_3588_4091 162
76 3300049742 Ga0501080_0001504 Ga0501080_0001504_14005_14508 162
77 3300049743 Ga0501081_0007806 Ga0501081_0007806_3975_4478 162
78 3300049744 Ga0501083_0067795 Ga0501083_0067795_1744_2247 162
79 3300049822 Ga0501035_0040004 Ga0501035_0040004_540_1088 162
80 3300049822 Ga0501035_0235851 Ga0501035_0235851_989_1492 162
81 3300049823 Ga0501044_0009439 Ga0501044_0009439_5270_5818 162
82 3300049823 Ga0501044_0526242 Ga0501044_0526242_64_567 162
83 3300049824 Ga0501045_0003259 Ga0501045_0003259_1822_2325 162
84 3300053138 Ga0500564_033785 Ga0500564_033785_1324_1851 162
85 3300054114 Ga0501084_0036107 Ga0501084_0036107_2131_2634 162
86 3300060353 Ga0501082_0021308 Ga0501082_0021308_98_601 162
87 3300061734 Ga0530510_0001520 Ga0530510_0001520_11398_11901 162
88 iso_pu_bacteria 2738541278 2738726272 162
89 3300003316 rootH1_10088033 rootH1_100880332 163
90 3300005617 Ga0068859_100953095 Ga0068859_1009530952 163
91 3300006173 Ga0070716_100440299 Ga0070716_1004402992 163
92 3300006931 Ga0097620_100952939 Ga0097620_1009529392 163
93 3300026118 Ga0207675_101018191 Ga0207675_1010181911 163
94 3300031249 Ga0265339_10093403 Ga0265339_100934031 163
95 3300031727 Ga0316576_10675028 Ga0316576_106750282 163
96 3300031995 Ga0307409_101318965 Ga0307409_1013189652 163
97 3300041456 Ga0451795_0252109 Ga0451795_0252109_111_602 163
98 3300041509 Ga0451843_1671500 Ga0451843_1671500_61_552 163
99 3300041511 Ga0451855_0320535 Ga0451855_0320535_124_615 163
100 3300041512 Ga0451853_0396800 Ga0451853_0396800_652_1143 163
101 3300041512 Ga0451853_0540903 Ga0451853_0540903_716_1207 163
102 3300049703 Ga0501219_000292 Ga0501219_000292_7197_7694 163
103 3300049705 Ga0501225_0028679 Ga0501225_0028679_82_579 163
104 3300049758 Ga0501241_026735 Ga0501241_026735_71_568 163
105 3300050005 Ga0501284_00041 Ga0501284_00041_17176_17673 163
106 3300053730 Ga0500645_022740 Ga0500645_022740_674_1165 163
107 3300003322 rootL2_10245613 rootL2_102456132 164
108 3300009093 Ga0105240_10088554 Ga0105240_100885541 164
109 3300009147 Ga0114129_10001943 Ga0114129_100019434 164
110 3300010375 Ga0105239_10002914 Ga0105239_1000291420 164
111 3300031456 Ga0307513_10193877 Ga0307513_101938773 164
112 3300031691 Ga0316579_10301550 Ga0316579_103015502 164
113 3300031727 Ga0316576_10121529 Ga0316576_101215293 164
114 3300031733 Ga0316577_10012248 Ga0316577_100122484 164
115 3300032137 Ga0316585_10104490 Ga0316585_101044902 164
116 3300036647 Ga0316582_0026741 Ga0316582_0026741_190_687 164
117 3300036712 Ga0316584_0011555 Ga0316584_0011555_5126_5623 164
118 3300044693 Ga0466961_0162561 Ga0466961_0162561_271_765 164
119 3300044735 Ga0466968_0078380 Ga0466968_0078380_289_783 164
120 3300045049 Ga0466959_0000017 Ga0466959_0000017_141735_142229 164
121 3300046460 Ga0495638_0552623 Ga0495638_0552623_51_545 164
122 3300046616 Ga0495668_0002833 Ga0495668_0002833_12112_12606 164
123 3300049822 Ga0501035_1009823 Ga0501035_1009823_33_527 164
124 3300050507 nmdc:mga05p37_1237_c1 nmdc:mga05p37_1237_c1_26399_26893 164
125 3300053093 Ga0500651_0283957 Ga0500651_0283957_310_804 164
126 3300053118 Ga0500594_0030675 Ga0500594_0030675_727_1221 164
127 3300006195 Ga0075366_10062101 Ga0075366_100621012 165
128 3300006237 Ga0097621_100219389 Ga0097621_1002193892 165
129 3300006358 Ga0068871_100096289 Ga0068871_1000962893 165
130 3300010375 Ga0105239_10636404 Ga0105239_106364042 165
131 3300013296 Ga0157374_11175913 Ga0157374_111759131 165
132 3300013308 Ga0157375_10479764 Ga0157375_104797642 165
133 3300014968 Ga0157379_10182349 Ga0157379_101823493 165
134 3300017792 Ga0163161_10038704 Ga0163161_100387042 165
135 3300026121 Ga0207683_10295570 Ga0207683_102955702 165
136 3300031251 Ga0265327_10056822 Ga0265327_100568221 165
137 3300048912 Ga0496109_0729245 Ga0496109_0729245_201_698 165
138 3300049571 Ga0501034_0000115 Ga0501034_0000115_113266_113766 165
139 3300049582 Ga0501048_0290537 Ga0501048_0290537_501_998 165
140 3300053148 Ga0500590_245754 Ga0500590_245754_31_558 165
141 3300002738 JGI25154J39366_1006176 JGI25154J39366_10061762 166
142 3300003322 rootL2_10161863 rootL2_101618632 166
143 3300003323 rootH1_10002797 rootH1_1000279712 166
144 3300003323 rootH1_10111784 rootH1_101117842 166
145 3300005331 Ga0070670_100157564 Ga0070670_1001575642 166
146 3300005331 Ga0070670_100185321 Ga0070670_1001853212 166
147 3300005355 Ga0070671_100120207 Ga0070671_1001202072 166
148 3300005356 Ga0070674_100222421 Ga0070674_1002224212 166
149 3300005364 Ga0070673_100535651 Ga0070673_1005356512 166
150 3300005456 Ga0070678_100094577 Ga0070678_1000945772 166
151 3300005539 Ga0068853_100343936 Ga0068853_1003439362 166
152 3300005539 Ga0068853_100483206 Ga0068853_1004832061 166
153 3300005543 Ga0070672_100760564 Ga0070672_1007605641 166
154 3300005577 Ga0068857_100088367 Ga0068857_1000883673 166
155 3300005614 Ga0068856_100209983 Ga0068856_1002099831 166
156 3300005834 Ga0068851_10082300 Ga0068851_100823001 166
157 3300006163 Ga0070715_10166682 Ga0070715_101666822 166
158 3300009174 Ga0105241_10022496 Ga0105241_100224965 166
159 3300009176 Ga0105242_10518661 Ga0105242_105186612 166
160 3300009545 Ga0105237_10084648 Ga0105237_100846483 166
161 3300013296 Ga0157374_10176698 Ga0157374_101766982 166
162 3300013308 Ga0157375_10218480 Ga0157375_102184802 166
163 3300014325 Ga0163163_10530693 Ga0163163_105306932 166
164 3300014326 Ga0157380_10007862 Ga0157380_100078627 166
165 3300014326 Ga0157380_10554397 Ga0157380_105543971 166
166 3300017792 Ga0163161_10112573 Ga0163161_101125732 166
167 3300025911 Ga0207654_10328335 Ga0207654_103283352 166
168 3300025922 Ga0207646_10763308 Ga0207646_107633082 166
169 3300025925 Ga0207650_10296882 Ga0207650_102968822 166
170 3300025926 Ga0207659_10789337 Ga0207659_107893371 166
171 3300026041 Ga0207639_10404184 Ga0207639_104041842 166
172 3300026067 Ga0207678_10655225 Ga0207678_106552252 166
173 3300026078 Ga0207702_10015389 Ga0207702_100153892 166
174 3300026116 Ga0207674_10050416 Ga0207674_100504164 166
175 3300026121 Ga0207683_10024062 Ga0207683_100240622 166
176 3300031456 Ga0307513_10135420 Ga0307513_101354202 166
177 3300031456 Ga0307513_10661090 Ga0307513_106610901 166
178 3300031711 Ga0265314_10012145 Ga0265314_100121453 166
179 3300041404 Ga0439436_0013938 Ga0439436_0013938_1646_2164 166
180 3300041406 Ga0439439_0014706 Ga0439439_0014706_506_1024 166
181 3300041486 Ga0451807_0989023 Ga0451807_0989023_50_550 166
182 3300041509 Ga0451843_0122657 Ga0451843_0122657_96_596 166
183 3300041512 Ga0451853_0034636 Ga0451853_0034636_694_1275 166
184 3300042007 Ga0439449_0025843 Ga0439449_0025843_102_620 166
185 3300042014 Ga0439457_000392 Ga0439457_000392_11681_12199 166
186 3300044656 Ga0466969_0001938 Ga0466969_0001938_9327_9827 166
187 3300044658 Ga0466972_0000013 Ga0466972_0000013_180231_180731 166
188 3300044658 Ga0466972_0172940 Ga0466972_0172940_25_525 166
189 3300044683 Ga0466965_0197199 Ga0466965_0197199_270_773 166
190 3300044842 Ga0466957_0000305 Ga0466957_0000305_16198_16752 166
191 3300046809 Ga0495600_0639883 Ga0495600_0639883_52_561 166
192 3300047319 Ga0495674_0168818 Ga0495674_0168818_277_786 166
193 3300047320 Ga0495672_0070231 Ga0495672_0070231_1463_1963 166
194 3300047471 Ga0495684_0538652 Ga0495684_0538652_103_612 166
195 3300049579 Ga0501043_0158423 Ga0501043_0158423_48_548 166
196 3300049581 Ga0501047_0051110 Ga0501047_0051110_3420_3920 166
197 3300049686 Ga0501257_012912 Ga0501257_012912_636_1136 166
198 3300049705 Ga0501225_0002522 Ga0501225_0002522_3482_3985 166
199 3300050493 nmdc:mga0k408_39157_c1 nmdc:mga0k408_39157_c1_827_1327 166
200 3300053086 Ga0500578_0000155 Ga0500578_0000155_75857_76357 166
201 3300053086 Ga0500578_0014515 Ga0500578_0014515_2724_3224 166
202 3300053090 Ga0500646_0022836 Ga0500646_0022836_753_1253 166
203 3300053131 Ga0500652_006563 Ga0500652_006563_1849_2358 166
204 3300053134 Ga0500658_0215026 Ga0500658_0215026_199_699 166
205 3300053140 Ga0500573_0052070 Ga0500573_0052070_570_1073 166
206 3300053147 Ga0500589_051309 Ga0500589_051309_229_804 166
207 3300053156 Ga0500622_0013908 Ga0500622_0013908_2758_3261 166
208 3300053163 Ga0500639_054721 Ga0500639_054721_1488_1991 166
209 3300055283 Ga0500661_066516 Ga0500661_066516_119_619 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00186

DHFR_1

Dihydrofolate reductase

29

189

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tj3-assembly1.cif.gz_A crystal structure of a dihydrofolate reductase fola from stenotrophomonas maltophilia bound to nadp and p218 0.9705 1 162
5w3q-assembly1.cif.gz_A l28f e.coli dhfr in complex with nadph 0.9692 2 162
4p66-assembly1.cif.gz_A electrostatics of active site microenvironments of e. coli dhfr 0.968 2 162
7mym-assembly1.cif.gz_A crystal structure of escherichia coli dihydrofolate reductase in complex with trimethoprim and nadph 0.9664 2 161
6xg4-assembly1.cif.gz_A x-ray structure of escherichia coli dihydrofolate reductase l28r mutant in complex with trimethoprim 0.9659 2 162
ID Description Score Start End Superfamily
4or7A00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9639 2 165 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9629 1 161 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.957 1 161 3.40.430.10
4fghA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9519 1 165 3.40.430.10
3fl9F00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9412 1 165 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A5C9BW39-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9894 1 163 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A7C4U7N7-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.989 1 139 GO:0004146
GO:0005829
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A059X9B6-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9889 1 162 GO:0004146
GO:0005829
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A1Q3TYN5-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9876 2 162 GO:0004146
GO:0005829
GO:0006730
GO:0016301
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A838F8B1-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9868 2 162 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661

Feature Viewer

pLDDT pTM Quality
94.09 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map