F319384

General Info

Members Datasets Scaffolds Average Seq Length
209 145 209 68

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0557392|Ga0436363_0557392_275_514
Length 79
Sequence VDEERFNISIRKFLKVVGVTSQREIESAVRAALSEGRLGASALDAVMTLEIPALGVRHVVDGRIDVGGDAGERRDDASP

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
46 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
47 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
81 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
84 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.39
Rhizosphere 93.3
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10341511 3300005327 Bacteria 1281
2 Ga0070683_100185727 3300005329 Bacteria 1974
3 Ga0070682_101430250 3300005337 Unclassified 592
4 Ga0070661_100101094 3300005344 Bacteria 2144
5 Ga0070659_100584283 3300005366 Bacteria 959
6 Ga0070659_101187606 3300005366 Unclassified 674
7 Ga0070709_10480591 3300005434 Bacteria 941
8 Ga0070709_11151437 3300005434 Bacteria 622
9 Ga0070714_101609185 3300005435 Unclassified 634
10 Ga0070714_101784088 3300005435 Bacteria 601
11 Ga0070713_100278110 3300005436 Bacteria 1535
12 Ga0070713_101073992 3300005436 Bacteria 778
13 Ga0070713_101489759 3300005436 Unclassified 656
14 Ga0070710_10280580 3300005437 Bacteria 1081
15 Ga0070711_100123499 3300005439 Bacteria 1919
16 Ga0070711_100156195 3300005439 Bacteria 1725
17 Ga0070711_100359841 3300005439 Bacteria 1172
18 Ga0070711_100513978 3300005439 Bacteria 989
19 Ga0070708_100185265 3300005445 Bacteria 1946
20 Ga0070708_100412198 3300005445 Unclassified 1274
21 Ga0070663_100463305 3300005455 Bacteria 1047
22 Ga0070678_101939247 3300005456 Bacteria 557
23 Ga0068867_100181424 3300005459 Unclassified 1674
24 Ga0070707_100227081 3300005468 Bacteria 1818
25 Ga0070698_100022829 3300005471 Bacteria 6541
26 Ga0070698_100085867 3300005471 Bacteria 3134
27 Ga0070698_100551709 3300005471 Bacteria 1092
28 Ga0070699_100129084 3300005518 Bacteria 2228
29 Ga0070684_100178293 3300005535 Bacteria 1932
30 Ga0070697_101261415 3300005536 Bacteria 659
31 Ga0068853_100374322 3300005539 Bacteria 1329
32 Ga0068853_101333668 3300005539 Bacteria 694
33 Ga0070696_101910463 3300005546 Bacteria 514
34 Ga0070693_100308153 3300005547 Bacteria 1070
35 Ga0068854_100033881 3300005578 Bacteria 3563
36 Ga0068852_100078306 3300005616 Bacteria 2924
37 Ga0068863_102505629 3300005841 Bacteria 525
38 Ga0081455_10171783 3300005937 Bacteria 1650
39 Ga0081540_1012402 3300005983 Bacteria 5619
40 Ga0070717_10040672 3300006028 Bacteria 3787
41 Ga0070717_10059976 3300006028 Bacteria 3149
42 Ga0070717_11334400 3300006028 Bacteria 652
43 Ga0070715_10734111 3300006163 Bacteria 593
44 Ga0070712_100030429 3300006175 Bacteria 3627
45 Ga0070712_100036369 3300006175 Bacteria 3350
46 Ga0070712_100070657 3300006175 Unclassified 2495
47 Ga0070712_100776824 3300006175 Bacteria 821
48 Ga0075435_100082061 3300007076 Bacteria 2649
49 Ga0105240_10451226 3300009093 Bacteria 1439
50 Ga0114129_11358515 3300009147 Bacteria 878
51 Ga0099796_10050668 3300010159 Bacteria 1440
52 Ga0157373_10665297 3300013100 Bacteria 761
53 Ga0157371_10164798 3300013102 Bacteria 1583
54 Ga0157370_10319853 3300013104 Bacteria 1431
55 Ga0157369_11574670 3300013105 Bacteria 668
56 Ga0163162_10799175 3300013306 Bacteria 1061
57 Ga0157372_11014709 3300013307 Bacteria 961
58 Ga0157380_10081194 3300014326 Bacteria 2651
59 Ga0182008_10654306 3300014497 Bacteria 595
60 Ga0157376_12766341 3300014969 Bacteria 530
61 Ga0206353_10020488 3300020082 Bacteria 678
62 Ga0213873_10010394 3300021358 Bacteria 1963
63 Ga0213873_10023808 3300021358 Bacteria 1464
64 Ga0213873_10184083 3300021358 Unclassified 642
65 Ga0213873_10282753 3300021358 Bacteria 532
66 Ga0213874_10066958 3300021377 Bacteria 1138
67 Ga0213871_10064971 3300021441 Bacteria 1022
68 Ga0207692_10383403 3300025898 Bacteria 873
69 Ga0207692_11035431 3300025898 Unclassified 543
70 Ga0207699_10313331 3300025906 Bacteria 1099
71 Ga0207699_10358837 3300025906 Bacteria 1030
72 Ga0207705_10121491 3300025909 Bacteria 1939
73 Ga0207693_10040998 3300025915 Bacteria 3646
74 Ga0207693_10887768 3300025915 Bacteria 684
75 Ga0207663_10161023 3300025916 Bacteria 1584
76 Ga0207663_10244083 3300025916 Bacteria 1319
77 Ga0207663_10248421 3300025916 Bacteria 1308
78 Ga0207649_10173196 3300025920 Bacteria 1505
79 Ga0207646_10259473 3300025922 Bacteria 1570
80 Ga0207700_10022271 3300025928 Bacteria 4345
81 Ga0207664_10830853 3300025929 Bacteria 831
82 Ga0207664_11266319 3300025929 Bacteria 656
83 Ga0207690_10339781 3300025932 Bacteria 1185
84 Ga0207706_10833306 3300025933 Unclassified 782
85 Ga0207706_11639718 3300025933 Bacteria 520
86 Ga0207669_11510096 3300025937 Bacteria 573
87 Ga0207661_10179836 3300025944 Bacteria 1847
88 Ga0207679_10190261 3300025945 Bacteria 1705
89 Ga0207640_10718716 3300025981 Bacteria 858
90 Ga0207640_11756847 3300025981 Bacteria 560
91 Ga0207639_10279728 3300026041 Bacteria 1467
92 Ga0207678_10411547 3300026067 Bacteria 1172
93 Ga0207648_11885210 3300026089 Bacteria 559
94 Ga0207698_10497078 3300026142 Bacteria 1186
95 Ga0265330_10425193 3300031235 Bacteria 563
96 Ga0265339_10303484 3300031249 Bacteria 761
97 Ga0265327_10025219 3300031251 Bacteria 3472
98 Ga0316579_10323444 3300031691 Bacteria 746
99 Ga0265314_10277791 3300031711 Bacteria 949
100 Ga0316576_10594240 3300031727 Bacteria 808
101 Ga0316578_10668191 3300031728 Bacteria 606
102 Ga0307405_10115328 3300031731 Bacteria 1828
103 Ga0307412_10084634 3300031911 Unclassified 2202
104 Ga0307412_10665581 3300031911 Bacteria 890
105 Ga0307409_101987296 3300031995 Bacteria 611
106 Ga0307416_102371594 3300032002 Bacteria 630
107 Ga0307414_11581199 3300032004 Bacteria 611
108 Ga0307414_11969588 3300032004 Bacteria 545
109 Ga0307411_11202748 3300032005 Bacteria 687
110 Ga0373934_0051327 3300035086 Bacteria 1635
111 Ga0373945_0304146 3300035116 Unclassified 684
112 Ga0373953_0003597 3300035117 Bacteria 4850
113 Ga0373954_0019164 3300035118 Bacteria 3085
114 Ga0373956_0077872 3300035119 Bacteria 1518
115 Ga0373955_0012299 3300035172 Bacteria 4112
116 Ga0316574_0413802 3300035398 Bacteria 848
117 Ga0373933_0176672 3300035724 Bacteria 1360
118 Ga0373937_0052505 3300036401 Bacteria 3737
119 Ga0316584_0279543 3300036712 Bacteria 1213
120 Ga0373925_1199751 3300037068 Unclassified 624
121 Ga0395905_0412626 3300037471 Bacteria 1246
122 Ga0436364_0651666 3300037853 Unclassified 1046
123 Ga0436365_0260502 3300039437 Bacteria 705
124 Ga0436365_0555388 3300039437 Bacteria 995
125 Ga0436360_0363624 3300039438 Bacteria 3396
126 Ga0436360_0417378 3300039438 Bacteria 638
127 Ga0436360_0461890 3300039438 Bacteria 2100
128 Ga0436360_0887229 3300039438 Bacteria 1044
129 Ga0436360_1011099 3300039438 Bacteria 679
130 Ga0436360_1109007 3300039438 Bacteria 899
131 Ga0436361_0006825 3300039447 Bacteria 530
132 Ga0436361_0044194 3300039447 Bacteria 1177
133 Ga0436361_0447720 3300039447 Bacteria 1130
134 Ga0436361_1177439 3300039447 Bacteria 688
135 Ga0436361_1195082 3300039447 Bacteria 734
136 Ga0436363_0297440 3300039450 Bacteria 1631
137 Ga0436363_0557392 3300039450 Bacteria 540
138 Ga0436363_0992595 3300039450 Bacteria 980
139 Ga0436363_1695831 3300039450 Bacteria 1027
140 Ga0436362_0065101 3300039453 Bacteria 825
141 Ga0436362_0292002 3300039453 Unclassified 769
142 Ga0436362_0328744 3300039453 Unclassified 640
143 Ga0436362_0580430 3300039453 Unclassified 847
144 Ga0436362_0729478 3300039453 Bacteria 632
145 Ga0436362_0826819 3300039453 Bacteria 3089
146 Ga0436362_0971396 3300039453 Bacteria 1074
147 Ga0436362_1034404 3300039453 Bacteria 1718
148 Ga0436362_1232189 3300039453 Bacteria 1313
149 Ga0451849_0338862 3300041505 Bacteria 522
150 Ga0466969_0481139 3300044656 Bacteria 566
151 Ga0466969_0536579 3300044656 Unclassified 535
152 Ga0453683_1083999 3300044673 Bacteria 534
153 Ga0466966_0205148 3300044684 Bacteria 1192
154 Ga0466966_0307338 3300044684 Bacteria 953
155 Ga0466961_0089857 3300044693 Bacteria 1940
156 Ga0466961_0964971 3300044693 Bacteria 507
157 Ga0466963_0042713 3300044694 Bacteria 2978
158 Ga0466968_0038775 3300044735 Bacteria 2003
159 Ga0466957_0075898 3300044842 Bacteria 2086
160 Ga0466959_0396330 3300045049 Bacteria 939
161 Ga0466958_0009322 3300045836 Bacteria 5469
162 Ga0466967_2136609 3300045976 Bacteria 556
163 Ga0495651_0406801 3300046462 Unclassified 887
164 Ga0495630_0457763 3300046517 Unclassified 978
165 Ga0495640_0264411 3300046533 Bacteria 1074
166 Ga0495667_0734251 3300046559 Unclassified 611
167 Ga0495625_0224225 3300046660 Bacteria 1230
168 Ga0495635_0577577 3300046663 Unclassified 735
169 Ga0495657_0724580 3300046675 Unclassified 571
170 Ga0495599_0585624 3300046678 Unclassified 651
171 Ga0495623_0376882 3300046679 Unclassified 768
172 Ga0495674_0263126 3300047319 Bacteria 1417
173 Ga0495674_1016852 3300047319 Unclassified 634
174 Ga0495672_0264541 3300047320 Bacteria 828
175 Ga0495684_0178260 3300047471 Bacteria 1576
176 Ga0496104_0014880 3300048907 Bacteria 7033
177 Ga0496104_0235530 3300048907 Bacteria 1743
178 Ga0496105_0118606 3300048908 Bacteria 2183
179 Ga0496114_1231323 3300048917 Bacteria 635
180 Ga0496115_0163993 3300048918 Bacteria 1837
181 Ga0501048_0386833 3300049582 Bacteria 999
182 Ga0501067_0323376 3300049583 Unclassified 859
183 Ga0501068_0814305 3300049584 Bacteria 613
184 Ga0501069_0336529 3300049585 Bacteria 888
185 Ga0501070_0008070 3300049586 Bacteria 8911
186 Ga0501070_0569918 3300049586 Bacteria 905
187 Ga0501071_0755483 3300049587 Bacteria 749
188 Ga0501072_1509137 3300049588 Bacteria 519
189 Ga0501076_0333897 3300049592 Bacteria 1244
190 Ga0501077_0949364 3300049593 Bacteria 553
191 Ga0501079_0506580 3300049741 Bacteria 949
192 Ga0501079_0778834 3300049741 Bacteria 753
193 Ga0501080_0214613 3300049742 Bacteria 1763
194 Ga0501080_0225418 3300049742 Bacteria 1714
195 Ga0501080_0801107 3300049742 Bacteria 826
196 Ga0501083_0099073 3300049744 Bacteria 1923
197 Ga0501083_0232624 3300049744 Unclassified 1200
198 Ga0501083_1032092 3300049744 Bacteria 535
199 Ga0501045_1122020 3300049824 Bacteria 575
200 nmdc:mga0n895_1781069_c1 3300050512 Bacteria 577
201 nmdc:mga0rr50_586726_c1 3300050513 Bacteria 950
202 Ga0495601_0089500 3300053077 Bacteria 1979
203 Ga0495595_0030275 3300053084 Bacteria 2427
204 Ga0495619_0314457 3300053085 Bacteria 1084
205 Ga0501084_1209641 3300054114 Bacteria 634
206 Ga0501084_1843024 3300054114 Unclassified 505
207 Ga0501082_0137833 3300060353 Unclassified 2117
208 Ga0501082_1275326 3300060353 Bacteria 642
209 Ga0530510_0419200 3300061734 Bacteria 1010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0778834 Ga0501079_0778834_552_737 61
2 3300005366 Ga0070659_101187606 Ga0070659_1011876062 63
3 3300009147 Ga0114129_11358515 Ga0114129_113585152 63
4 3300032004 Ga0307414_11581199 Ga0307414_115811992 63
5 3300049583 Ga0501067_0323376 Ga0501067_0323376_516_707 63
6 3300049585 Ga0501069_0336529 Ga0501069_0336529_454_645 63
7 3300049586 Ga0501070_0008070 Ga0501070_0008070_3929_4120 63
8 3300049742 Ga0501080_0801107 Ga0501080_0801107_483_674 63
9 3300049744 Ga0501083_0232624 Ga0501083_0232624_188_379 63
10 3300060353 Ga0501082_0137833 Ga0501082_0137833_1762_1953 63
11 3300005329 Ga0070683_100185727 Ga0070683_1001857272 66
12 3300005344 Ga0070661_100101094 Ga0070661_1001010943 66
13 3300005366 Ga0070659_100584283 Ga0070659_1005842832 66
14 3300005455 Ga0070663_100463305 Ga0070663_1004633052 66
15 3300005535 Ga0070684_100178293 Ga0070684_1001782932 66
16 3300005539 Ga0068853_101333668 Ga0068853_1013336681 66
17 3300005547 Ga0070693_100308153 Ga0070693_1003081532 66
18 3300005578 Ga0068854_100033881 Ga0068854_1000338814 66
19 3300005616 Ga0068852_100078306 Ga0068852_1000783062 66
20 3300013100 Ga0157373_10665297 Ga0157373_106652972 66
21 3300013102 Ga0157371_10164798 Ga0157371_101647983 66
22 3300013104 Ga0157370_10319853 Ga0157370_103198532 66
23 3300013105 Ga0157369_11574670 Ga0157369_115746701 66
24 3300013307 Ga0157372_11014709 Ga0157372_110147092 66
25 3300014969 Ga0157376_12766341 Ga0157376_127663411 66
26 3300020082 Ga0206353_10020488 Ga0206353_100204882 66
27 3300025920 Ga0207649_10173196 Ga0207649_101731962 66
28 3300025932 Ga0207690_10339781 Ga0207690_103397812 66
29 3300025933 Ga0207706_11639718 Ga0207706_116397181 66
30 3300025944 Ga0207661_10179836 Ga0207661_101798363 66
31 3300025945 Ga0207679_10190261 Ga0207679_101902612 66
32 3300025981 Ga0207640_10718716 Ga0207640_107187162 66
33 3300026067 Ga0207678_10411547 Ga0207678_104115472 66
34 3300026142 Ga0207698_10497078 Ga0207698_104970782 66
35 3300041505 Ga0451849_0338862 Ga0451849_0338862_19_219 66
36 3300037853 Ga0436364_0651666 Ga0436364_0651666_368_571 67
37 3300039450 Ga0436363_0557392 Ga0436363_0557392_275_514 67
38 3300005327 Ga0070658_10341511 Ga0070658_103415112 68
39 3300005337 Ga0070682_101430250 Ga0070682_1014302502 68
40 3300005434 Ga0070709_10480591 Ga0070709_104805913 68
41 3300005434 Ga0070709_11151437 Ga0070709_111514372 68
42 3300005435 Ga0070714_101609185 Ga0070714_1016091851 68
43 3300005435 Ga0070714_101784088 Ga0070714_1017840881 68
44 3300005436 Ga0070713_100278110 Ga0070713_1002781102 68
45 3300005436 Ga0070713_101073992 Ga0070713_1010739922 68
46 3300005436 Ga0070713_101489759 Ga0070713_1014897592 68
47 3300005437 Ga0070710_10280580 Ga0070710_102805802 68
48 3300005439 Ga0070711_100123499 Ga0070711_1001234992 68
49 3300005439 Ga0070711_100156195 Ga0070711_1001561952 68
50 3300005439 Ga0070711_100359841 Ga0070711_1003598412 68
51 3300005439 Ga0070711_100513978 Ga0070711_1005139782 68
52 3300005445 Ga0070708_100185265 Ga0070708_1001852653 68
53 3300005445 Ga0070708_100412198 Ga0070708_1004121982 68
54 3300005456 Ga0070678_101939247 Ga0070678_1019392472 68
55 3300005459 Ga0068867_100181424 Ga0068867_1001814243 68
56 3300005468 Ga0070707_100227081 Ga0070707_1002270812 68
57 3300005471 Ga0070698_100022829 Ga0070698_1000228297 68
58 3300005471 Ga0070698_100085867 Ga0070698_1000858673 68
59 3300005471 Ga0070698_100551709 Ga0070698_1005517091 68
60 3300005518 Ga0070699_100129084 Ga0070699_1001290842 68
61 3300005536 Ga0070697_101261415 Ga0070697_1012614151 68
62 3300005539 Ga0068853_100374322 Ga0068853_1003743222 68
63 3300005546 Ga0070696_101910463 Ga0070696_1019104632 68
64 3300005841 Ga0068863_102505629 Ga0068863_1025056291 68
65 3300005937 Ga0081455_10171783 Ga0081455_101717833 68
66 3300005983 Ga0081540_1012402 Ga0081540_10124028 68
67 3300006028 Ga0070717_10040672 Ga0070717_100406722 68
68 3300006028 Ga0070717_10059976 Ga0070717_100599763 68
69 3300006028 Ga0070717_11334400 Ga0070717_113344002 68
70 3300006163 Ga0070715_10734111 Ga0070715_107341112 68
71 3300006175 Ga0070712_100030429 Ga0070712_1000304292 68
72 3300006175 Ga0070712_100036369 Ga0070712_1000363692 68
73 3300006175 Ga0070712_100070657 Ga0070712_1000706575 68
74 3300006175 Ga0070712_100776824 Ga0070712_1007768242 68
75 3300007076 Ga0075435_100082061 Ga0075435_1000820611 68
76 3300009093 Ga0105240_10451226 Ga0105240_104512261 68
77 3300010159 Ga0099796_10050668 Ga0099796_100506683 68
78 3300013306 Ga0163162_10799175 Ga0163162_107991752 68
79 3300014326 Ga0157380_10081194 Ga0157380_100811943 68
80 3300014497 Ga0182008_10654306 Ga0182008_106543061 68
81 3300021358 Ga0213873_10010394 Ga0213873_100103942 68
82 3300021358 Ga0213873_10023808 Ga0213873_100238082 68
83 3300021358 Ga0213873_10184083 Ga0213873_101840832 68
84 3300021358 Ga0213873_10282753 Ga0213873_102827532 68
85 3300021377 Ga0213874_10066958 Ga0213874_100669582 68
86 3300021441 Ga0213871_10064971 Ga0213871_100649712 68
87 3300025898 Ga0207692_10383403 Ga0207692_103834032 68
88 3300025898 Ga0207692_11035431 Ga0207692_110354312 68
89 3300025906 Ga0207699_10313331 Ga0207699_103133311 68
90 3300025906 Ga0207699_10358837 Ga0207699_103588372 68
91 3300025909 Ga0207705_10121491 Ga0207705_101214913 68
92 3300025915 Ga0207693_10040998 Ga0207693_100409982 68
93 3300025915 Ga0207693_10887768 Ga0207693_108877682 68
94 3300025916 Ga0207663_10161023 Ga0207663_101610232 68
95 3300025916 Ga0207663_10244083 Ga0207663_102440832 68
96 3300025916 Ga0207663_10248421 Ga0207663_102484212 68
97 3300025922 Ga0207646_10259473 Ga0207646_102594732 68
98 3300025928 Ga0207700_10022271 Ga0207700_100222712 68
99 3300025929 Ga0207664_10830853 Ga0207664_108308532 68
100 3300025929 Ga0207664_11266319 Ga0207664_112663192 68
101 3300025933 Ga0207706_10833306 Ga0207706_108333062 68
102 3300025937 Ga0207669_11510096 Ga0207669_115100962 68
103 3300025981 Ga0207640_11756847 Ga0207640_117568472 68
104 3300026041 Ga0207639_10279728 Ga0207639_102797281 68
105 3300026089 Ga0207648_11885210 Ga0207648_118852101 68
106 3300031235 Ga0265330_10425193 Ga0265330_104251932 68
107 3300031249 Ga0265339_10303484 Ga0265339_103034841 68
108 3300031251 Ga0265327_10025219 Ga0265327_100252192 68
109 3300031691 Ga0316579_10323444 Ga0316579_103234442 68
110 3300031711 Ga0265314_10277791 Ga0265314_102777912 68
111 3300031727 Ga0316576_10594240 Ga0316576_105942402 68
112 3300031728 Ga0316578_10668191 Ga0316578_106681912 68
113 3300031731 Ga0307405_10115328 Ga0307405_101153283 68
114 3300031911 Ga0307412_10084634 Ga0307412_100846343 68
115 3300031911 Ga0307412_10665581 Ga0307412_106655812 68
116 3300031995 Ga0307409_101987296 Ga0307409_1019872962 68
117 3300032002 Ga0307416_102371594 Ga0307416_1023715942 68
118 3300032004 Ga0307414_11969588 Ga0307414_119695881 68
119 3300032005 Ga0307411_11202748 Ga0307411_112027482 68
120 3300035086 Ga0373934_0051327 Ga0373934_0051327_803_1009 68
121 3300035116 Ga0373945_0304146 Ga0373945_0304146_343_549 68
122 3300035117 Ga0373953_0003597 Ga0373953_0003597_2643_2849 68
123 3300035118 Ga0373954_0019164 Ga0373954_0019164_396_602 68
124 3300035119 Ga0373956_0077872 Ga0373956_0077872_528_734 68
125 3300035172 Ga0373955_0012299 Ga0373955_0012299_684_890 68
126 3300035398 Ga0316574_0413802 Ga0316574_0413802_576_782 68
127 3300035724 Ga0373933_0176672 Ga0373933_0176672_463_669 68
128 3300036401 Ga0373937_0052505 Ga0373937_0052505_2840_3046 68
129 3300036712 Ga0316584_0279543 Ga0316584_0279543_436_642 68
130 3300037068 Ga0373925_1199751 Ga0373925_1199751_185_391 68
131 3300037471 Ga0395905_0412626 Ga0395905_0412626_966_1172 68
132 3300039437 Ga0436365_0260502 Ga0436365_0260502_448_654 68
133 3300039437 Ga0436365_0555388 Ga0436365_0555388_108_335 68
134 3300039438 Ga0436360_0363624 Ga0436360_0363624_1710_1916 68
135 3300039438 Ga0436360_0417378 Ga0436360_0417378_161_367 68
136 3300039438 Ga0436360_0461890 Ga0436360_0461890_209_415 68
137 3300039438 Ga0436360_0887229 Ga0436360_0887229_154_360 68
138 3300039438 Ga0436360_1011099 Ga0436360_1011099_66_272 68
139 3300039438 Ga0436360_1109007 Ga0436360_1109007_252_458 68
140 3300039447 Ga0436361_0006825 Ga0436361_0006825_275_481 68
141 3300039447 Ga0436361_0044194 Ga0436361_0044194_255_461 68
142 3300039447 Ga0436361_0447720 Ga0436361_0447720_428_634 68
143 3300039447 Ga0436361_1177439 Ga0436361_1177439_344_550 68
144 3300039447 Ga0436361_1195082 Ga0436361_1195082_470_676 68
145 3300039450 Ga0436363_0297440 Ga0436363_0297440_716_922 68
146 3300039450 Ga0436363_0992595 Ga0436363_0992595_24_230 68
147 3300039450 Ga0436363_1695831 Ga0436363_1695831_575_781 68
148 3300039453 Ga0436362_0065101 Ga0436362_0065101_125_331 68
149 3300039453 Ga0436362_0292002 Ga0436362_0292002_223_429 68
150 3300039453 Ga0436362_0328744 Ga0436362_0328744_99_305 68
151 3300039453 Ga0436362_0580430 Ga0436362_0580430_315_521 68
152 3300039453 Ga0436362_0729478 Ga0436362_0729478_245_463 68
153 3300039453 Ga0436362_0826819 Ga0436362_0826819_637_843 68
154 3300039453 Ga0436362_0971396 Ga0436362_0971396_327_533 68
155 3300039453 Ga0436362_1034404 Ga0436362_1034404_1057_1278 68
156 3300039453 Ga0436362_1232189 Ga0436362_1232189_822_1028 68
157 3300044656 Ga0466969_0481139 Ga0466969_0481139_161_367 68
158 3300044656 Ga0466969_0536579 Ga0466969_0536579_180_386 68
159 3300044673 Ga0453683_1083999 Ga0453683_1083999_247_453 68
160 3300044684 Ga0466966_0205148 Ga0466966_0205148_257_463 68
161 3300044684 Ga0466966_0307338 Ga0466966_0307338_669_875 68
162 3300044693 Ga0466961_0089857 Ga0466961_0089857_826_1032 68
163 3300044693 Ga0466961_0964971 Ga0466961_0964971_37_243 68
164 3300044694 Ga0466963_0042713 Ga0466963_0042713_2443_2649 68
165 3300044735 Ga0466968_0038775 Ga0466968_0038775_1388_1594 68
166 3300044842 Ga0466957_0075898 Ga0466957_0075898_880_1086 68
167 3300045049 Ga0466959_0396330 Ga0466959_0396330_592_798 68
168 3300045836 Ga0466958_0009322 Ga0466958_0009322_1678_1884 68
169 3300045976 Ga0466967_2136609 Ga0466967_2136609_19_225 68
170 3300046462 Ga0495651_0406801 Ga0495651_0406801_595_801 68
171 3300046517 Ga0495630_0457763 Ga0495630_0457763_520_726 68
172 3300046533 Ga0495640_0264411 Ga0495640_0264411_499_705 68
173 3300046559 Ga0495667_0734251 Ga0495667_0734251_221_427 68
174 3300046660 Ga0495625_0224225 Ga0495625_0224225_592_798 68
175 3300046663 Ga0495635_0577577 Ga0495635_0577577_477_683 68
176 3300046675 Ga0495657_0724580 Ga0495657_0724580_108_314 68
177 3300046678 Ga0495599_0585624 Ga0495599_0585624_311_517 68
178 3300046679 Ga0495623_0376882 Ga0495623_0376882_182_388 68
179 3300047319 Ga0495674_0263126 Ga0495674_0263126_409_615 68
180 3300047319 Ga0495674_1016852 Ga0495674_1016852_241_447 68
181 3300047320 Ga0495672_0264541 Ga0495672_0264541_37_243 68
182 3300047471 Ga0495684_0178260 Ga0495684_0178260_567_773 68
183 3300048907 Ga0496104_0014880 Ga0496104_0014880_5961_6167 68
184 3300048907 Ga0496104_0235530 Ga0496104_0235530_161_370 68
185 3300048908 Ga0496105_0118606 Ga0496105_0118606_1648_1854 68
186 3300048917 Ga0496114_1231323 Ga0496114_1231323_391_597 68
187 3300048918 Ga0496115_0163993 Ga0496115_0163993_673_879 68
188 3300049582 Ga0501048_0386833 Ga0501048_0386833_591_797 68
189 3300049584 Ga0501068_0814305 Ga0501068_0814305_24_230 68
190 3300049586 Ga0501070_0569918 Ga0501070_0569918_94_300 68
191 3300049587 Ga0501071_0755483 Ga0501071_0755483_530_736 68
192 3300049588 Ga0501072_1509137 Ga0501072_1509137_243_449 68
193 3300049592 Ga0501076_0333897 Ga0501076_0333897_719_925 68
194 3300049593 Ga0501077_0949364 Ga0501077_0949364_220_426 68
195 3300049741 Ga0501079_0506580 Ga0501079_0506580_385_591 68
196 3300049742 Ga0501080_0214613 Ga0501080_0214613_563_769 68
197 3300049742 Ga0501080_0225418 Ga0501080_0225418_1435_1641 68
198 3300049744 Ga0501083_0099073 Ga0501083_0099073_1303_1509 68
199 3300049744 Ga0501083_1032092 Ga0501083_1032092_247_453 68
200 3300049824 Ga0501045_1122020 Ga0501045_1122020_217_423 68
201 3300050512 nmdc:mga0n895_1781069_c1 nmdc:mga0n895_1781069_c1_315_521 68
202 3300050513 nmdc:mga0rr50_586726_c1 nmdc:mga0rr50_586726_c1_469_675 68
203 3300053077 Ga0495601_0089500 Ga0495601_0089500_1135_1341 68
204 3300053084 Ga0495595_0030275 Ga0495595_0030275_910_1116 68
205 3300053085 Ga0495619_0314457 Ga0495619_0314457_564_770 68
206 3300054114 Ga0501084_1209641 Ga0501084_1209641_382_588 68
207 3300054114 Ga0501084_1843024 Ga0501084_1843024_34_240 68
208 3300060353 Ga0501082_1275326 Ga0501082_1275326_376_582 68
209 3300061734 Ga0530510_0419200 Ga0530510_0419200_551_757 68

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20104

DUF6494

Family of unknown function (DUF6494)

1

67

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3khd-assembly2.cif.gz_A crystal structure of pff1300w. 0.6736 22 68
3qv7-assembly1.cif.gz_B crystal structure of leishmania mexicana pyruvate kinase(lmpyk)in complex with ponceau s and acid blue 25. 0.6422 20 68
4h8p-assembly1.cif.gz_A neat5 domain of isdx2, a b. anthracis hemophore in complex with heme 0.6144 39 68
4v6u-assembly1.cif.gz_AR promiscuous behavior of proteins in archaeal ribosomes revealed by cryo-em: implications for evolution of eukaryotic ribosomes 0.597 38 65
5opt-assembly1.cif.gz_X structure of ksrp in context of trypanosoma cruzi 40s 0.5894 38 65
ID Description Score Start End Superfamily
af_Q54PQ7_387_619_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7563 43 66 3.90.70.10
af_A4IAQ4_310_451_3.40.1380.20 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;Pyruvate kinase, C-terminal domain 0.7324 20 65 3.40.1380.20
af_Q9W4C3_300_548_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7119 43 65 3.90.70.10
af_Q4VNC1_687_878_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7083 26 66 3.40.50.1000
af_Q9CTG6_714_897_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6505 26 67 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A1F4DUS3-F1-model_v4 Uncharacterized protein 1.001 1 68
AF-A0A2W4KF01-F1-model_v4 Uncharacterized protein 0.9974 1 68
AF-A0A2S6TBG6-F1-model_v4 Uncharacterized protein 0.997 1 68
AF-A0A7T8MIJ8-F1-model_v4 deleted 0.9964 1 68
AF-A0A2E6HMP5-F1-model_v4 Uncharacterized protein 0.9938 1 68

Feature Viewer

pLDDT pTM Quality
96.17 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map