F319245

General Info

Members Datasets Scaffolds Average Seq Length
209 153 203 375

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10004931|Ga0265316_1000493117
Length 403
Sequence MLLNIFIVILWSLAGAALGFVTLKIYYNVKRTKAKKEPKLNGYKGVKSKMKIMTVVGTRPEVIRLSKIIGKLDTICEKHIVVHTGQNYDDNLNKVFFDELEIRPVDYALETKGNTTMTQLSNMFQLLEHTMKTDRPDRVLILGDTNSCFATAYTAKRMGIPVYHMEAGNRCFDPYMPEELNRRAIDSMADIHMPYTELARRNLLEMGIPDNKIFVTGNPINEVLHSLIFSKTAFLHQGDVRPFVLVTAHREENVDNQERLTALLNSCRDVSQQLAYKVYFSRHPRTKARMEQWKLSEEGIEFHEPIGLHDFVIKERQSKCILTDSGTVQEEACIWGIPCVTLRDNTERPETIECGANILSGIRSDDVVRSVKLAIANKGNWTPPAEYKIKNVSDIVVNIVTGY

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
3 2643221662 Devosia sp. Root413D1 Isolate Unclassified
4 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
5 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
6 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
148 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
149 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
153 8054795415 Paenibacillus periandrae PM10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 0
Isolates 2.87

Biome Distribution

Category Percentage (%)
Aerial Root 0.96
Bulb 0
Endosphere 4.78
Nodule 0.48
Rhizoplane 0.96
Rhizosphere 89.95
Stem 0
Stem Tuber 0
Unclassified 2.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1576874 2162886007 Bacteria 20464
2 rootH1_10096404 3300003316 Bacteria 6064
3 rootH2_10093371 3300003320 Bacteria 5011
4 Ga0055536_1000027 3300003781 Bacteria 164595
5 Ga0055530_10000079 3300003791 Bacteria 83270
6 Ga0055531_10033743 3300003794 Bacteria 1640
7 Ga0065714_10065942 3300005288 Bacteria 8016
8 Ga0065712_10001709 3300005290 Bacteria 5875
9 Ga0065712_10072570 3300005290 Bacteria 4700
10 Ga0065707_10141659 3300005295 Bacteria 1764
11 Ga0070658_10000014 3300005327 Bacteria 244978
12 Ga0070683_100004347 3300005329 Bacteria 11654
13 Ga0070670_100000434 3300005331 Bacteria 34217
14 Ga0070670_100011190 3300005331 Bacteria 7668
15 Ga0070670_100025938 3300005331 Bacteria 5043
16 Ga0070670_100058403 3300005331 Bacteria 3312
17 Ga0070677_10001670 3300005333 Bacteria 7011
18 Ga0068869_100069538 3300005334 Bacteria 2603
19 Ga0070666_10025863 3300005335 Bacteria 3829
20 Ga0068868_100004395 3300005338 Bacteria 9882
21 Ga0068868_100034896 3300005338 Bacteria 3885
22 Ga0070660_100366323 3300005339 Bacteria 1188
23 Ga0070689_100292652 3300005340 Bacteria 1353
24 Ga0070691_10120675 3300005341 Bacteria 1320
25 Ga0070661_100004193 3300005344 Bacteria 9951
26 Ga0070669_100000488 3300005353 Bacteria 30076
27 Ga0070669_100018488 3300005353 Bacteria 4980
28 Ga0070675_100005285 3300005354 Bacteria 9862
29 Ga0070671_100000741 3300005355 Bacteria 23351
30 Ga0070671_100037979 3300005355 Bacteria 3996
31 Ga0070674_100001811 3300005356 Bacteria 11602
32 Ga0070673_100003103 3300005364 Bacteria 10290
33 Ga0070673_100040250 3300005364 Bacteria 3584
34 Ga0070688_100015232 3300005365 Bacteria 4369
35 Ga0070688_100125483 3300005365 Bacteria 1724
36 Ga0070659_100004977 3300005366 Bacteria 9510
37 Ga0070667_100374609 3300005367 Bacteria 1292
38 Ga0070700_100065734 3300005441 Bacteria 2300
39 Ga0070662_100011959 3300005457 Bacteria 5740
40 Ga0068867_100023715 3300005459 Bacteria 4394
41 Ga0068867_100198381 3300005459 Bacteria 1605
42 Ga0070697_100342056 3300005536 Bacteria 1291
43 Ga0070672_100002082 3300005543 Bacteria 12602
44 Ga0070672_100033145 3300005543 Bacteria 3908
45 Ga0070672_100081712 3300005543 Bacteria 2591
46 Ga0070686_100099658 3300005544 Bacteria 1960
47 Ga0070665_100029579 3300005548 Bacteria 5514
48 Ga0070664_100000338 3300005564 Bacteria 34161
49 Ga0070664_100003248 3300005564 Bacteria 13136
50 Ga0070702_100007500 3300005615 Bacteria 5226
51 Ga0068852_100001391 3300005616 Bacteria 16274
52 Ga0068852_100072296 3300005616 Bacteria 3031
53 Ga0068859_100024527 3300005617 Bacteria 6050
54 Ga0068859_100266486 3300005617 Bacteria 1805
55 Ga0068864_100010168 3300005618 Bacteria 7768
56 Ga0068864_100035419 3300005618 Bacteria 4249
57 Ga0068861_100128936 3300005719 Bacteria 2051
58 Ga0068870_10137692 3300005840 Bacteria 1425
59 Ga0068871_100005926 3300006358 Bacteria 8602
60 Ga0068865_100057400 3300006881 Bacteria 2715
61 Ga0068865_100266104 3300006881 Bacteria 1359
62 Ga0097620_100024527 3300006931 Bacteria 6050
63 Ga0097620_100266475 3300006931 Bacteria 1805
64 Ga0105244_10038507 3300009036 Bacteria 2493
65 Ga0105250_10000586 3300009092 Bacteria 23882
66 Ga0111539_10032561 3300009094 Bacteria 6330
67 Ga0111539_10136945 3300009094 Bacteria 2867
68 Ga0105245_10160177 3300009098 Bacteria 2135
69 Ga0114129_10070057 3300009147 Bacteria 4889
70 Ga0105243_10016341 3300009148 Bacteria 5615
71 Ga0105248_10022702 3300009177 Bacteria 6963
72 Ga0105248_10448907 3300009177 Bacteria 1453
73 Ga0105249_10140374 3300009553 Bacteria 2316
74 Ga0105246_10009559 3300011119 Bacteria 5975
75 Ga0157370_10001276 3300013104 Bacteria 31520
76 Ga0157378_10001742 3300013297 Bacteria 19508
77 Ga0157378_10005435 3300013297 Bacteria 11168
78 Ga0163162_10010059 3300013306 Bacteria 9197
79 Ga0157375_10004030 3300013308 Bacteria 12744
80 Ga0157375_10027305 3300013308 Bacteria 5335
81 Ga0157380_10048303 3300014326 Bacteria 3351
82 Ga0157376_10003364 3300014969 Bacteria 11007
83 Ga0163161_10024590 3300017792 Bacteria 4257
84 Ga0209676_1000087 3300025292 Bacteria 263734
85 Ga0209050_1000083 3300025298 Bacteria 263734
86 Ga0209051_1002598 3300025303 Bacteria 12710
87 Ga0209257_1009904 3300025304 Bacteria 4966
88 Ga0207697_10023409 3300025315 Bacteria 2529
89 Ga0207656_10029927 3300025321 Bacteria 2246
90 Ga0207696_1000606 3300025711 Bacteria 26792
91 Ga0207655_1052081 3300025728 Bacteria 1649
92 Ga0207682_10000259 3300025893 Bacteria 23848
93 Ga0207642_10044038 3300025899 Bacteria 1973
94 Ga0207688_10072106 3300025901 Bacteria 1962
95 Ga0207643_10001969 3300025908 Bacteria 11336
96 Ga0207705_10000043 3300025909 Bacteria 181491
97 Ga0207662_10035789 3300025918 Bacteria 2901
98 Ga0207649_10002853 3300025920 Bacteria 9534
99 Ga0207649_10008809 3300025920 Bacteria 5507
100 Ga0207681_10004854 3300025923 Bacteria 8262
101 Ga0207650_10001458 3300025925 Bacteria 17032
102 Ga0207650_10004357 3300025925 Bacteria 9668
103 Ga0207650_10006992 3300025925 Bacteria 7697
104 Ga0207650_10011791 3300025925 Bacteria 6026
105 Ga0207659_10000903 3300025926 Bacteria 17670
106 Ga0207659_10006943 3300025926 Bacteria 6955
107 Ga0207659_10017808 3300025926 Bacteria 4647
108 Ga0207687_10030088 3300025927 Bacteria 3658
109 Ga0207644_10002429 3300025931 Bacteria 12004
110 Ga0207644_10060385 3300025931 Bacteria 2743
111 Ga0207690_10005066 3300025932 Bacteria 7782
112 Ga0207706_10046438 3300025933 Bacteria 3845
113 Ga0207706_10071293 3300025933 Bacteria 3056
114 Ga0207686_10051765 3300025934 Bacteria 2559
115 Ga0207670_10110373 3300025936 Bacteria 1981
116 Ga0207691_10004388 3300025940 Bacteria 13675
117 Ga0207679_10000069 3300025945 Bacteria 93919
118 Ga0207679_10001971 3300025945 Bacteria 12723
119 Ga0207651_10004584 3300025960 Bacteria 6998
120 Ga0207651_10008356 3300025960 Bacteria 5587
121 Ga0207712_10075010 3300025961 Bacteria 2444
122 Ga0207658_10071605 3300025986 Bacteria 2625
123 Ga0207677_10001396 3300026023 Bacteria 12906
124 Ga0207677_10109968 3300026023 Bacteria 2050
125 Ga0207708_10061116 3300026075 Bacteria 2876
126 Ga0207641_10020190 3300026088 Bacteria 5469
127 Ga0207648_10003228 3300026089 Bacteria 17167
128 Ga0207648_10003241 3300026089 Bacteria 17123
129 Ga0207676_10001531 3300026095 Bacteria 17067
130 Ga0207676_10004427 3300026095 Bacteria 9931
131 Ga0207674_10160015 3300026116 Bacteria 2206
132 Ga0207683_10000601 3300026121 Bacteria 33201
133 Ga0207698_10002148 3300026142 Bacteria 11646
134 Ga0265316_10004931 3300031344 Unclassified 13126
135 Ga0307408_100046698 3300031548 Bacteria 3098
136 Ga0265314_10025786 3300031711 Bacteria 4427
137 Ga0265342_10024729 3300031712 Unclassified 3787
138 Ga0307414_10000380 3300032004 Bacteria 24231
139 Ga0307510_10040784 3300033180 Bacteria 5089
140 Ga0395899_0000246 3300037312 Bacteria 72297
141 Ga0451577_0000357 3300042876 Bacteria 85114
142 Ga0451577_0001712 3300042876 Bacteria 28299
143 Ga0451577_0019219 3300042876 Bacteria 6284
144 Ga0451577_0042557 3300042876 Bacteria 4073
145 Ga0453683_0000134 3300044673 Bacteria 108503
146 Ga0453683_0004283 3300044673 Bacteria 10175
147 Ga0453683_0015242 3300044673 Bacteria 4981
148 Ga0453683_0020256 3300044673 Bacteria 4251
149 Ga0453684_0000043 3300044712 Archaea 642274
150 Ga0453684_0000329 3300044712 Bacteria 198284
151 Ga0453684_0001103 3300044712 Bacteria 84832
152 Ga0453684_0036693 3300044712 Bacteria 6750
153 Ga0453684_0120568 3300044712 Bacteria 3167
154 Ga0451576_0000392 3300045051 Bacteria 101819
155 Ga0451576_0120603 3300045051 Bacteria 2730
156 Ga0495627_000245 3300046453 Bacteria 57165
157 Ga0495585_0002038 3300046492 Bacteria 14899
158 Ga0495585_0021955 3300046492 Bacteria 3664
159 Ga0495606_0013179 3300046507 Bacteria 6559
160 Ga0495616_0000362 3300046513 Bacteria 35718
161 Ga0495616_0008321 3300046513 Bacteria 6152
162 Ga0495631_0010108 3300046518 Bacteria 4686
163 Ga0495643_0015486 3300046522 Bacteria 4505
164 Ga0495644_0004276 3300046523 Bacteria 5608
165 Ga0495666_0036588 3300046526 Bacteria 2391
166 Ga0495642_0000058 3300046528 Bacteria 66850
167 Ga0495611_0025832 3300046648 Bacteria 2561
168 Ga0495625_0015565 3300046660 Bacteria 6019
169 Ga0495661_0016465 3300046665 Bacteria 4901
170 Ga0495670_0000221 3300046691 Bacteria 25910
171 Ga0495671_0000405 3300046692 Bacteria 34951
172 Ga0495676_0032467 3300047321 Bacteria 4406
173 Ga0495683_0001293 3300047323 Bacteria 16913
174 Ga0495681_0000247 3300047470 Bacteria 44236
175 Ga0496108_0003099 3300048911 Bacteria 13361
176 Ga0496110_0033212 3300048913 Bacteria 4462
177 Ga0496125_0006853 3300048928 Bacteria 12216
178 Ga0501039_0245571 3300049575 Bacteria 1408
179 Ga0501040_0033595 3300049576 Bacteria 3476
180 Ga0501040_0074240 3300049576 Bacteria 2350
181 Ga0501041_0057397 3300049577 Bacteria 2381
182 Ga0501068_0046583 3300049584 Bacteria 2615
183 Ga0501068_0200140 3300049584 Bacteria 1267
184 Ga0501071_0045516 3300049587 Bacteria 3150
185 Ga0501075_0005289 3300049591 Bacteria 8822
186 Ga0501079_0103414 3300049741 Bacteria 2209
187 Ga0501079_0158791 3300049741 Bacteria 1762
188 Ga0501080_0081244 3300049742 Bacteria 3012
189 Ga0501080_0120497 3300049742 Bacteria 2431
190 Ga0501081_0000458 3300049743 Bacteria 22610
191 nmdc:mga05p37_123917_c1 3300050507 Unclassified 3174
192 nmdc:mga08y16_102902_c1 3300050511 Bacteria 2973
193 nmdc:mga08y16_259102_c1 3300050511 Bacteria 1796
194 nmdc:mga08y16_50404_c1 3300050511 Bacteria 4356
195 nmdc:mga08y16_78644_c1 3300050511 Bacteria 3438
196 nmdc:mga0n895_162062_c1 3300050512 Bacteria 2268
197 Ga0500628_000234 3300053129 Bacteria 10704
198 Ga0500559_0019526 3300053136 Bacteria 2863
199 Ga0500622_0095358 3300053156 Bacteria 1471
200 Ga0501084_0090825 3300054114 Bacteria 2564
201 Ga0501082_0013770 3300060353 Bacteria 6954
202 Ga0501082_0022575 3300060353 Bacteria 5420
203 Ga0530510_0059280 3300061734 Bacteria 2769

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_259102_c1 nmdc:mga08y16_259102_c1_25_969 311
2 3300025711 Ga0207696_1000606 Ga0207696_100060620 325
3 3300025728 Ga0207655_1052081 Ga0207655_10520812 325
4 3300009036 Ga0105244_10038507 Ga0105244_100385072 326
5 3300009092 Ga0105250_10000586 Ga0105250_100005866 326
6 3300044712 Ga0453684_0000043 Ga0453684_0000043_621895_623001 344
7 3300005331 Ga0070670_100011190 Ga0070670_1000111902 352
8 3300025925 Ga0207650_10006992 Ga0207650_100069922 352
9 3300005340 Ga0070689_100292652 Ga0070689_1002926521 353
10 3300005365 Ga0070688_100015232 Ga0070688_1000152322 353
11 3300005441 Ga0070700_100065734 Ga0070700_1000657342 353
12 3300005536 Ga0070697_100342056 Ga0070697_1003420562 353
13 3300005617 Ga0068859_100266486 Ga0068859_1002664862 353
14 3300006931 Ga0097620_100266475 Ga0097620_1002664752 353
15 3300025936 Ga0207670_10110373 Ga0207670_101103732 353
16 3300026075 Ga0207708_10061116 Ga0207708_100611162 353
17 3300031344 Ga0265316_10004931 Ga0265316_1000493117 356
18 3300031712 Ga0265342_10024729 Ga0265342_100247293 356
19 3300009147 Ga0114129_10070057 Ga0114129_100700572 358
20 3300050507 nmdc:mga05p37_123917_c1 nmdc:mga05p37_123917_c1_1073_2155 358
21 3300050512 nmdc:mga0n895_162062_c1 nmdc:mga0n895_162062_c1_1111_2202 361
22 3300009094 Ga0111539_10136945 Ga0111539_101369452 369
23 3300049576 Ga0501040_0033595 Ga0501040_0033595_1104_2273 369
24 3300049577 Ga0501041_0057397 Ga0501041_0057397_514_1683 369
25 3300049584 Ga0501068_0200140 Ga0501068_0200140_80_1249 369
26 3300049587 Ga0501071_0045516 Ga0501071_0045516_172_1341 369
27 3300049741 Ga0501079_0103414 Ga0501079_0103414_830_1999 369
28 3300049742 Ga0501080_0081244 Ga0501080_0081244_493_1662 369
29 3300050511 nmdc:mga08y16_78644_c1 nmdc:mga08y16_78644_c1_1526_2638 369
30 3300054114 Ga0501084_0090825 Ga0501084_0090825_1291_2460 369
31 3300060353 Ga0501082_0022575 Ga0501082_0022575_461_1630 369
32 3300025899 Ga0207642_10044038 Ga0207642_100440382 370
33 3300046660 Ga0495625_0015565 Ga0495625_0015565_3962_5074 370
34 3300050511 nmdc:mga08y16_102902_c1 nmdc:mga08y16_102902_c1_610_1725 370
35 iso_pu_bacteria 8054795415 8054802160 370
36 3300005290 Ga0065712_10001709 Ga0065712_100017093 372
37 3300009177 Ga0105248_10448907 Ga0105248_104489072 372
38 3300025933 Ga0207706_10046438 Ga0207706_100464384 372
39 3300046526 Ga0495666_0036588 Ga0495666_0036588_510_1643 372
40 3300048913 Ga0496110_0033212 Ga0496110_0033212_3272_4390 372
41 3300005290 Ga0065712_10072570 Ga0065712_100725703 373
42 3300005327 Ga0070658_10000014 Ga0070658_10000014139 373
43 3300005329 Ga0070683_100004347 Ga0070683_1000043478 373
44 3300005331 Ga0070670_100000434 Ga0070670_1000004348 373
45 3300005335 Ga0070666_10025863 Ga0070666_100258632 373
46 3300005338 Ga0068868_100004395 Ga0068868_1000043952 373
47 3300005339 Ga0070660_100366323 Ga0070660_1003663231 373
48 3300005344 Ga0070661_100004193 Ga0070661_1000041933 373
49 3300005355 Ga0070671_100000741 Ga0070671_10000074114 373
50 3300005364 Ga0070673_100003103 Ga0070673_1000031034 373
51 3300005366 Ga0070659_100004977 Ga0070659_1000049774 373
52 3300005367 Ga0070667_100374609 Ga0070667_1003746091 373
53 3300005459 Ga0068867_100023715 Ga0068867_1000237153 373
54 3300005543 Ga0070672_100002082 Ga0070672_10000208210 373
55 3300005564 Ga0070664_100000338 Ga0070664_10000033830 373
56 3300005564 Ga0070664_100003248 Ga0070664_1000032487 373
57 3300005616 Ga0068852_100001391 Ga0068852_1000013913 373
58 3300005618 Ga0068864_100010168 Ga0068864_1000101684 373
59 3300005840 Ga0068870_10137692 Ga0068870_101376922 373
60 3300006358 Ga0068871_100005926 Ga0068871_1000059266 373
61 3300006881 Ga0068865_100266104 Ga0068865_1002661041 373
62 3300009177 Ga0105248_10022702 Ga0105248_100227026 373
63 3300013297 Ga0157378_10005435 Ga0157378_100054352 373
64 3300013306 Ga0163162_10010059 Ga0163162_100100592 373
65 3300013308 Ga0157375_10004030 Ga0157375_1000403010 373
66 3300014969 Ga0157376_10003364 Ga0157376_100033649 373
67 3300025321 Ga0207656_10029927 Ga0207656_100299272 373
68 3300025909 Ga0207705_10000043 Ga0207705_10000043181 373
69 3300025920 Ga0207649_10002853 Ga0207649_100028532 373
70 3300025925 Ga0207650_10004357 Ga0207650_100043574 373
71 3300025926 Ga0207659_10006943 Ga0207659_100069434 373
72 3300025940 Ga0207691_10004388 Ga0207691_1000438811 373
73 3300025945 Ga0207679_10000069 Ga0207679_100000694 373
74 3300025945 Ga0207679_10001971 Ga0207679_100019717 373
75 3300025960 Ga0207651_10008356 Ga0207651_100083566 373
76 3300026023 Ga0207677_10001396 Ga0207677_100013966 373
77 3300026089 Ga0207648_10003228 Ga0207648_1000322813 373
78 3300026095 Ga0207676_10004427 Ga0207676_100044274 373
79 3300026121 Ga0207683_10000601 Ga0207683_1000060111 373
80 3300026142 Ga0207698_10002148 Ga0207698_100021486 373
81 3300033180 Ga0307510_10040784 Ga0307510_100407844 373
82 3300048911 Ga0496108_0003099 Ga0496108_0003099_3648_4772 373
83 3300053129 Ga0500628_000234 Ga0500628_000234_5300_6424 373
84 3300053136 Ga0500559_0019526 Ga0500559_0019526_1334_2458 373
85 iso_pu_bacteria 2643221662 2644348310 373
86 3300011119 Ga0105246_10009559 Ga0105246_100095592 374
87 3300025920 Ga0207649_10008809 Ga0207649_100088093 374
88 3300025932 Ga0207690_10005066 Ga0207690_100050663 374
89 3300049576 Ga0501040_0074240 Ga0501040_0074240_76_1203 374
90 3300049584 Ga0501068_0046583 Ga0501068_0046583_1044_2171 374
91 3300049591 Ga0501075_0005289 Ga0501075_0005289_7363_8490 374
92 3300049741 Ga0501079_0158791 Ga0501079_0158791_217_1344 374
93 3300049742 Ga0501080_0120497 Ga0501080_0120497_136_1263 374
94 3300049743 Ga0501081_0000458 Ga0501081_0000458_8578_9705 374
95 3300060353 Ga0501082_0013770 Ga0501082_0013770_4875_6002 374
96 3300061734 Ga0530510_0059280 Ga0530510_0059280_514_1641 374
97 iso_pu_bacteria 2728369107 2729199959 374
98 3300005331 Ga0070670_100025938 Ga0070670_1000259382 375
99 3300005331 Ga0070670_100058403 Ga0070670_1000584032 375
100 3300005333 Ga0070677_10001670 Ga0070677_100016704 375
101 3300005334 Ga0068869_100069538 Ga0068869_1000695383 375
102 3300005338 Ga0068868_100034896 Ga0068868_1000348963 375
103 3300005353 Ga0070669_100000488 Ga0070669_1000004884 375
104 3300005353 Ga0070669_100018488 Ga0070669_1000184883 375
105 3300005354 Ga0070675_100005285 Ga0070675_1000052856 375
106 3300005355 Ga0070671_100037979 Ga0070671_1000379793 375
107 3300005356 Ga0070674_100001811 Ga0070674_1000018113 375
108 3300005364 Ga0070673_100040250 Ga0070673_1000402503 375
109 3300005365 Ga0070688_100125483 Ga0070688_1001254832 375
110 3300005457 Ga0070662_100011959 Ga0070662_1000119592 375
111 3300005459 Ga0068867_100198381 Ga0068867_1001983812 375
112 3300005543 Ga0070672_100033145 Ga0070672_1000331453 375
113 3300005543 Ga0070672_100081712 Ga0070672_1000817123 375
114 3300005548 Ga0070665_100029579 Ga0070665_1000295792 375
115 3300005615 Ga0070702_100007500 Ga0070702_1000075002 375
116 3300005617 Ga0068859_100024527 Ga0068859_1000245274 375
117 3300005618 Ga0068864_100035419 Ga0068864_1000354194 375
118 3300005719 Ga0068861_100128936 Ga0068861_1001289362 375
119 3300006881 Ga0068865_100057400 Ga0068865_1000574003 375
120 3300006931 Ga0097620_100024527 Ga0097620_1000245274 375
121 3300009094 Ga0111539_10032561 Ga0111539_100325613 375
122 3300009098 Ga0105245_10160177 Ga0105245_101601772 375
123 3300009148 Ga0105243_10016341 Ga0105243_100163412 375
124 3300009553 Ga0105249_10140374 Ga0105249_101403742 375
125 3300013297 Ga0157378_10001742 Ga0157378_1000174210 375
126 3300013308 Ga0157375_10027305 Ga0157375_100273052 375
127 3300014326 Ga0157380_10048303 Ga0157380_100483032 375
128 3300017792 Ga0163161_10024590 Ga0163161_100245903 375
129 3300025315 Ga0207697_10023409 Ga0207697_100234092 375
130 3300025893 Ga0207682_10000259 Ga0207682_100002595 375
131 3300025901 Ga0207688_10072106 Ga0207688_100721062 375
132 3300025908 Ga0207643_10001969 Ga0207643_100019693 375
133 3300025918 Ga0207662_10035789 Ga0207662_100357892 375
134 3300025923 Ga0207681_10004854 Ga0207681_100048546 375
135 3300025925 Ga0207650_10001458 Ga0207650_100014584 375
136 3300025925 Ga0207650_10011791 Ga0207650_100117912 375
137 3300025926 Ga0207659_10000903 Ga0207659_1000090313 375
138 3300025926 Ga0207659_10017808 Ga0207659_100178083 375
139 3300025927 Ga0207687_10030088 Ga0207687_100300882 375
140 3300025931 Ga0207644_10002429 Ga0207644_100024294 375
141 3300025931 Ga0207644_10060385 Ga0207644_100603852 375
142 3300025933 Ga0207706_10071293 Ga0207706_100712933 375
143 3300025934 Ga0207686_10051765 Ga0207686_100517653 375
144 3300025960 Ga0207651_10004584 Ga0207651_100045842 375
145 3300025961 Ga0207712_10075010 Ga0207712_100750101 375
146 3300025986 Ga0207658_10071605 Ga0207658_100716053 375
147 3300026023 Ga0207677_10109968 Ga0207677_101099682 375
148 3300026088 Ga0207641_10020190 Ga0207641_100201904 375
149 3300026089 Ga0207648_10003241 Ga0207648_1000324115 375
150 3300026095 Ga0207676_10001531 Ga0207676_100015314 375
151 3300026116 Ga0207674_10160015 Ga0207674_101600151 375
152 3300042876 Ga0451577_0000357 Ga0451577_0000357_56108_57238 375
153 3300044712 Ga0453684_0001103 Ga0453684_0001103_55797_56927 375
154 iso_pu_bacteria 2984572630 2984574919 375
155 iso_pu_bacteria 2984606641 2984608371 375
156 3300005295 Ga0065707_10141659 Ga0065707_101416591 376
157 3300005616 Ga0068852_100072296 Ga0068852_1000722962 376
158 3300037312 Ga0395899_0000246 Ga0395899_0000246_29088_30218 376
159 3300042876 Ga0451577_0019219 Ga0451577_0019219_1494_2639 376
160 3300042876 Ga0451577_0042557 Ga0451577_0042557_2132_3262 376
161 3300044673 Ga0453683_0000134 Ga0453683_0000134_13518_14663 376
162 3300044673 Ga0453683_0020256 Ga0453683_0020256_75_1205 376
163 3300044712 Ga0453684_0120568 Ga0453684_0120568_1207_2352 376
164 3300045051 Ga0451576_0000392 Ga0451576_0000392_14599_15744 376
165 3300046453 Ga0495627_000245 Ga0495627_000245_22260_23390 376
166 3300046492 Ga0495585_0002038 Ga0495585_0002038_11784_12914 376
167 3300046492 Ga0495585_0021955 Ga0495585_0021955_68_1198 376
168 3300046518 Ga0495631_0010108 Ga0495631_0010108_1857_2987 376
169 3300046523 Ga0495644_0004276 Ga0495644_0004276_2120_3250 376
170 3300046528 Ga0495642_0000058 Ga0495642_0000058_47794_48924 376
171 3300046648 Ga0495611_0025832 Ga0495611_0025832_1099_2229 376
172 3300046665 Ga0495661_0016465 Ga0495661_0016465_1931_3061 376
173 3300046692 Ga0495671_0000405 Ga0495671_0000405_23131_24261 376
174 3300048928 Ga0496125_0006853 Ga0496125_0006853_9225_10355 376
175 3300049575 Ga0501039_0245571 Ga0501039_0245571_63_1196 376
176 3300003316 rootH1_10096404 rootH1_100964043 377
177 3300003781 Ga0055536_1000027 Ga0055536_100002715 377
178 3300003791 Ga0055530_10000079 Ga0055530_1000007915 377
179 3300003794 Ga0055531_10033743 Ga0055531_100337432 377
180 3300005288 Ga0065714_10065942 Ga0065714_100659425 377
181 3300005341 Ga0070691_10120675 Ga0070691_101206751 377
182 3300005544 Ga0070686_100099658 Ga0070686_1000996582 377
183 3300025292 Ga0209676_1000087 Ga0209676_1000087208 377
184 3300025298 Ga0209050_1000083 Ga0209050_1000083208 377
185 3300025303 Ga0209051_1002598 Ga0209051_10025985 377
186 3300025304 Ga0209257_1009904 Ga0209257_10099045 377
187 3300031548 Ga0307408_100046698 Ga0307408_1000466982 377
188 3300031711 Ga0265314_10025786 Ga0265314_100257862 377
189 3300042876 Ga0451577_0001712 Ga0451577_0001712_13320_14453 377
190 3300044673 Ga0453683_0004283 Ga0453683_0004283_4321_5454 377
191 3300044712 Ga0453684_0036693 Ga0453684_0036693_3670_4803 377
192 3300045051 Ga0451576_0120603 Ga0451576_0120603_205_1338 377
193 3300046513 Ga0495616_0000362 Ga0495616_0000362_19418_20551 377
194 3300046513 Ga0495616_0008321 Ga0495616_0008321_2286_3419 377
195 3300046691 Ga0495670_0000221 Ga0495670_0000221_8874_10007 377
196 3300047321 Ga0495676_0032467 Ga0495676_0032467_1487_2620 377
197 3300047323 Ga0495683_0001293 Ga0495683_0001293_7161_8294 377
198 3300047470 Ga0495681_0000247 Ga0495681_0000247_22774_23907 377
199 3300050511 nmdc:mga08y16_50404_c1 nmdc:mga08y16_50404_c1_1583_2719 377
200 3300053156 Ga0500622_0095358 Ga0500622_0095358_278_1414 377
201 3300003320 rootH2_10093371 rootH2_100933712 378
202 3300032004 Ga0307414_10000380 Ga0307414_1000038015 378
203 3300044673 Ga0453683_0015242 Ga0453683_0015242_3399_4544 378
204 3300044712 Ga0453684_0000329 Ga0453684_0000329_186554_187840 378
205 3300046507 Ga0495606_0013179 Ga0495606_0013179_2237_3373 378
206 3300046522 Ga0495643_0015486 Ga0495643_0015486_690_1826 378
207 3300013104 Ga0157370_10001276 Ga0157370_1000127625 380
208 iso_pu_bacteria 2582581873 2585424255 380
209 2162886007 SwRhRL2b_contig_1576874 SwRhRL2b_0314.00000600 381

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02350

Epimerase_2

UDP-N-acetylglucosamine 2-epimerase

73

401

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ya2-assembly1.cif.gz_A crystal structure of capsular polysaccharide synthesis enzyme capg from staphylococcus aureus 0.9685 3 376
7ya2-assembly1.cif.gz_A crystal structure of capsular polysaccharide synthesis enzyme capg from staphylococcus aureus 0.9583 3 376
7ya2-assembly1.cif.gz_E crystal structure of capsular polysaccharide synthesis enzyme capg from staphylococcus aureus 0.958 3 376
4hwg-assembly1.cif.gz_A structure of udp-n-acetylglucosamine 2-epimerase from rickettsia bellii 0.9504 3 376
7ya2-assembly1.cif.gz_E crystal structure of capsular polysaccharide synthesis enzyme capg from staphylococcus aureus 0.948 3 376
ID Description Score Start End Superfamily
af_Q2G1K2_188_329_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9763 192 331 3.40.50.2000
af_Q2G1K2_188_329_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9562 192 331 3.40.50.2000
4hwgA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9554 3 190 3.40.50.2000
af_Q58899_2_184_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9553 7 188 3.40.50.2000
af_Q58899_2_184_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9452 7 188 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A0M3C407-F1-model_v4 deleted 0.9941 120 379
AF-A0A4D6U7B9-F1-model_v4 UDP-N-acetylglucosamine 2-epimerase non-hydrolyzing 0.9929 80 378 GO:0008761
AF-A0A519QM94-F1-model_v4 UDP-N-acetylglucosamine 2-epimerase (Non-hydrolyzing) 0.9913 3 237 GO:0008761
AF-M6G8M4-F1-model_v4 UDP-N-acetylglucosamine 2-epimerase-like protein 0.9894 8 196 GO:0008761
AF-A0A6I0DW15-F1-model_v4 UDP-N-acetyl glucosamine 2-epimerase 0.989 3 179 GO:0008761

Feature Viewer

pLDDT pTM Quality
92.5 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map