F319232

General Info

Members Datasets Scaffolds Average Seq Length
209 140 418 130

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10000387|Ga0307511_1000038732
Length 150
Sequence LVILAVPTGCNIHRINHQKCNIMDTNSNSLNWFELPATDIARAKNFYEAIFSVQMVDLGEMMGMKMVGFPSVPGNGKASGGLAQSQMHTPSQSGTIVYLNANPSIQEVLDRIEPAGGKVVMPRTEISPEIGVMAFFVDTEGNRVGLHAQQ

Samples

Sample ID Description Type Environment
1 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
93 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
94 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
98 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
99 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
121 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
122 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
123 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
124 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
125 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
140 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 0
Rhizoplane 0.96
Rhizosphere 94.26
Stem 0
Stem Tuber 0
Unclassified 16.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307511_10000387 3300030521 Bacteria 47111
2 MRS1b_contig_2472133 2162886011 Unclassified 892
3 rootH1_10335956 3300003323 Bacteria 2050
4 Ga0065714_10125804 3300005288 Bacteria 1297
5 Ga0065714_10284903 3300005288 Unclassified 717
6 Ga0065712_10085896 3300005290 Bacteria 2667
7 Ga0070658_10095147 3300005327 Bacteria 2458
8 Ga0070683_100096440 3300005329 Bacteria 2781
9 Ga0070677_10165296 3300005333 Bacteria 1041
10 Ga0068869_100005255 3300005334 Bacteria 8132
11 Ga0070666_10000043 3300005335 Bacteria 111402
12 Ga0070680_100009892 3300005336 Bacteria 7340
13 Ga0070680_100136300 3300005336 Bacteria 2056
14 Ga0070682_100551154 3300005337 Bacteria 902
15 Ga0070660_100201220 3300005339 Bacteria 1615
16 Ga0070689_100344950 3300005340 Unclassified 1248
17 Ga0070691_10030628 3300005341 Bacteria 2520
18 Ga0070675_101310475 3300005354 Unclassified 667
19 Ga0070659_100128665 3300005366 Bacteria 2055
20 Ga0070667_100003552 3300005367 Bacteria 13290
21 Ga0070711_101149523 3300005439 Unclassified 670
22 Ga0070681_10207990 3300005458 Bacteria 1873
23 Ga0070681_10312626 3300005458 Unclassified 1480
24 Ga0070685_10449429 3300005466 Bacteria 902
25 Ga0070679_100043995 3300005530 Unclassified 4447
26 Ga0070679_100176942 3300005530 Unclassified 2106
27 Ga0070684_100030159 3300005535 Bacteria 4605
28 Ga0068853_100048105 3300005539 Unclassified 3662
29 Ga0068853_101014081 3300005539 Bacteria 799
30 Ga0068853_101593338 3300005539 Bacteria 633
31 Ga0068855_100052672 3300005563 Bacteria 4790
32 Ga0068855_100930788 3300005563 Bacteria 917
33 Ga0068857_100971886 3300005577 Bacteria 816
34 Ga0068852_100052387 3300005616 Unclassified 3507
35 Ga0068852_101629201 3300005616 Bacteria 668
36 Ga0068859_100000012 3300005617 Bacteria 300376
37 Ga0068859_101137905 3300005617 Unclassified 859
38 Ga0068864_100070311 3300005618 Unclassified 3045
39 Ga0068864_102300718 3300005618 Bacteria 545
40 Ga0068863_100008374 3300005841 Bacteria 10098
41 Ga0068860_100004050 3300005843 Bacteria 15046
42 Ga0068860_100021944 3300005843 Bacteria 6178
43 Ga0070712_100343013 3300006175 Bacteria 1220
44 Ga0097621_100671431 3300006237 Bacteria 952
45 Ga0068871_100302285 3300006358 Bacteria 1405
46 Ga0068871_101054885 3300006358 Bacteria 759
47 Ga0068871_101776561 3300006358 Bacteria 585
48 Ga0075430_100592036 3300006846 Bacteria 915
49 Ga0068865_100345973 3300006881 Bacteria 1203
50 Ga0097620_100000012 3300006931 Bacteria 300376
51 Ga0097620_101137779 3300006931 Unclassified 859
52 Ga0105240_10062764 3300009093 Bacteria 4625
53 Ga0105240_10080384 3300009093 Bacteria 4009
54 Ga0105245_10070341 3300009098 Bacteria 3175
55 Ga0105245_10964152 3300009098 Unclassified 896
56 Ga0105247_10025782 3300009101 Bacteria 3548
57 Ga0105241_10001105 3300009174 Bacteria 20534
58 Ga0105241_10002395 3300009174 Bacteria 14083
59 Ga0105237_10000725 3300009545 Bacteria 45577
60 Ga0105237_10315913 3300009545 Bacteria 1565
61 Ga0105237_11287691 3300009545 Unclassified 737
62 Ga0105249_10012219 3300009553 Bacteria 7563
63 Ga0105249_10514979 3300009553 Bacteria 1243
64 Ga0105239_10124083 3300010375 Bacteria 2869
65 Ga0105239_10159857 3300010375 Bacteria 2516
66 Ga0105239_10247165 3300010375 Bacteria 2003
67 Ga0105246_10034789 3300011119 Bacteria 3361
68 Ga0105246_10100608 3300011119 Unclassified 2103
69 Ga0157373_10212908 3300013100 Bacteria 1363
70 Ga0157371_10669286 3300013102 Bacteria 776
71 Ga0157370_10018336 3300013104 Bacteria 7041
72 Ga0157370_10020286 3300013104 Bacteria 6638
73 Ga0157369_10790522 3300013105 Bacteria 975
74 Ga0157369_10998248 3300013105 Bacteria 857
75 Ga0157374_10037992 3300013296 Unclassified 4423
76 Ga0157374_10285070 3300013296 Bacteria 1631
77 Ga0157378_10379689 3300013297 Bacteria 1387
78 Ga0157378_12084511 3300013297 Bacteria 618
79 Ga0163162_10000279 3300013306 Bacteria 46872
80 Ga0163162_10013425 3300013306 Bacteria 7997
81 Ga0157372_11149169 3300013307 Bacteria 898
82 Ga0157372_12440752 3300013307 Bacteria 600
83 Ga0157375_10093458 3300013308 Unclassified 3073
84 Ga0157375_10231501 3300013308 Bacteria 2007
85 Ga0157375_11465621 3300013308 Bacteria 805
86 Ga0163163_10372365 3300014325 Unclassified 1485
87 Ga0157380_10305666 3300014326 Bacteria 1467
88 Ga0157380_10592205 3300014326 Bacteria 1095
89 Ga0157379_10034367 3300014968 Bacteria 4521
90 Ga0157376_10120505 3300014969 Bacteria 2324
91 Ga0157376_10224075 3300014969 Bacteria 1743
92 Ga0206352_10772333 3300020078 Bacteria 668
93 Ga0207680_10000362 3300025903 Bacteria 21818
94 Ga0207647_10293878 3300025904 Bacteria 926
95 Ga0207645_10843024 3300025907 Bacteria 623
96 Ga0207705_10131667 3300025909 Bacteria 1862
97 Ga0207654_10002914 3300025911 Bacteria 8672
98 Ga0207707_10001992 3300025912 Bacteria 18554
99 Ga0207707_10483012 3300025912 Bacteria 1058
100 Ga0207695_10000241 3300025913 Bacteria 142030
101 Ga0207695_10169182 3300025913 Unclassified 2112
102 Ga0207671_10000438 3300025914 Bacteria 57265
103 Ga0207671_10004439 3300025914 Bacteria 13417
104 Ga0207671_10200517 3300025914 Bacteria 1558
105 Ga0207660_10028761 3300025917 Bacteria 3805
106 Ga0207660_10161763 3300025917 Bacteria 1728
107 Ga0207657_10074795 3300025919 Bacteria 2860
108 Ga0207652_10057163 3300025921 Unclassified 3359
109 Ga0207652_10349005 3300025921 Unclassified 1335
110 Ga0207681_10506549 3300025923 Bacteria 989
111 Ga0207659_11093942 3300025926 Unclassified 686
112 Ga0207687_10191376 3300025927 Bacteria 1593
113 Ga0207690_10230028 3300025932 Bacteria 1423
114 Ga0207686_10018402 3300025934 Bacteria 3956
115 Ga0207670_10147350 3300025936 Unclassified 1742
116 Ga0207704_10032899 3300025938 Bacteria 2942
117 Ga0207689_10000329 3300025942 Bacteria 44014
118 Ga0207661_10003609 3300025944 Bacteria 10767
119 Ga0207667_10095714 3300025949 Bacteria 3065
120 Ga0207651_10362253 3300025960 Bacteria 1224
121 Ga0207712_10009000 3300025961 Bacteria 6315
122 Ga0207712_10091109 3300025961 Unclassified 2245
123 Ga0207668_10764040 3300025972 Bacteria 853
124 Ga0207703_10001495 3300026035 Bacteria 21327
125 Ga0207639_10075741 3300026041 Unclassified 2647
126 Ga0207639_11264813 3300026041 Bacteria 692
127 Ga0207639_11457408 3300026041 Unclassified 642
128 Ga0207678_10161112 3300026067 Bacteria 1916
129 Ga0207641_10000152 3300026088 Bacteria 98311
130 Ga0207674_10371836 3300026116 Bacteria 1381
131 Ga0207675_100549853 3300026118 Bacteria 1153
132 Ga0207698_10003540 3300026142 Bacteria 9417
133 Ga0268264_10001955 3300028381 Bacteria 18514
134 Ga0268264_10002744 3300028381 Bacteria 15376
135 Ga0265337_1000058 3300028556 Bacteria 50152
136 Ga0265337_1012222 3300028556 Unclassified 2926
137 Ga0265326_10006210 3300028558 Bacteria 3723
138 Ga0265326_10007245 3300028558 Bacteria 3410
139 Ga0265319_1000036 3300028563 Bacteria 115781
140 Ga0265319_1001335 3300028563 Bacteria 14877
141 Ga0265319_1074648 3300028563 Bacteria 1083
142 Ga0265319_1110016 3300028563 Bacteria 862
143 Ga0265334_10009799 3300028573 Bacteria 4050
144 Ga0265318_10001331 3300028577 Bacteria 14799
145 Ga0265318_10012422 3300028577 Bacteria 3627
146 Ga0265323_10008893 3300028653 Bacteria 4124
147 Ga0265336_10000041 3300028666 Bacteria 136990
148 Ga0307517_10121109 3300028786 Bacteria 1933
149 Ga0265338_10000056 3300028800 Bacteria 200914
150 Ga0265338_10000432 3300028800 Bacteria 75203
151 Ga0265338_10001235 3300028800 Bacteria 42204
152 Ga0265338_10003585 3300028800 Bacteria 21679
153 Ga0265324_10000468 3300029957 Bacteria 28382
154 Ga0265324_10001493 3300029957 Bacteria 13263
155 Ga0265324_10007858 3300029957 Bacteria 4281
156 Ga0265324_10075197 3300029957 Bacteria 1150
157 Ga0265330_10004096 3300031235 Bacteria 7473
158 Ga0265332_10000291 3300031238 Bacteria 39487
159 Ga0265328_10000524 3300031239 Bacteria 17867
160 Ga0265320_10002425 3300031240 Bacteria 12994
161 Ga0265320_10003963 3300031240 Bacteria 9766
162 Ga0265320_10168133 3300031240 Bacteria 986
163 Ga0265325_10001533 3300031241 Bacteria 16160
164 Ga0265325_10138758 3300031241 Unclassified 1158
165 Ga0265329_10000331 3300031242 Bacteria 25099
166 Ga0265340_10002965 3300031247 Bacteria 9663
167 Ga0265339_10000497 3300031249 Bacteria 30642
168 Ga0265339_10084587 3300031249 Bacteria 1672
169 Ga0265331_10000519 3300031250 Bacteria 35699
170 Ga0265327_10059659 3300031251 Bacteria 1953
171 Ga0265316_10007717 3300031344 Bacteria 10084
172 Ga0265316_10015679 3300031344 Bacteria 6612
173 Ga0265316_10131645 3300031344 Unclassified 1884
174 Ga0307509_10301838 3300031507 Bacteria 1349
175 Ga0265313_10014499 3300031595 Bacteria 4651
176 Ga0265313_10019092 3300031595 Bacteria 3831
177 Ga0265314_10000782 3300031711 Bacteria 37770
178 Ga0265314_10047526 3300031711 Bacteria 3019
179 Ga0265342_10001519 3300031712 Bacteria 21471
180 Ga0265342_10356802 3300031712 Bacteria 761
181 Ga0373927_0007722 3300035695 Bacteria 7278
182 Ga0395901_0101161 3300038443 Bacteria 3024
183 Ga0436365_1523612 3300039437 Unclassified 854
184 Ga0451800_0599828 3300041459 Bacteria 601
185 Ga0451851_0210247 3300041507 Bacteria 509
186 Ga0439433_0184680 3300041999 Unclassified 547
187 Ga0439449_0001776 3300042007 Bacteria 8478
188 Ga0439457_014338 3300042014 Bacteria 1775
189 Ga0439462_0032550 3300042015 Unclassified 1382
190 Ga0451577_0000227 3300042876 Bacteria 114840
191 Ga0451577_0975538 3300042876 Unclassified 762
192 Ga0453684_0000033 3300044712 Bacteria 734012
193 Ga0453684_0020165 3300044712 Bacteria 10085
194 Ga0453684_0200277 3300044712 Bacteria 2328
195 Ga0453684_1453972 3300044712 Bacteria 709
196 Ga0451576_1459443 3300045051 Bacteria 711
197 Ga0495605_0393717 3300046474 Bacteria 577
198 Ga0495611_0051480 3300046648 Bacteria 1856
199 Ga0495661_0000527 3300046665 Bacteria 39504
200 Ga0495661_0037181 3300046665 Bacteria 3041
201 Ga0496114_0001010 3300048917 Bacteria 21107
202 Ga0496125_0018158 3300048928 Bacteria 6684
203 Ga0496126_0129786 3300048929 Bacteria 2179
204 Ga0501033_0702343 3300049570 Bacteria 688
205 Ga0501257_203020 3300049686 Unclassified 571
206 Ga0501035_0464089 3300049822 Bacteria 1046
207 nmdc:mga0qj67_841687_c1 3300050509 Bacteria 725
208 Ga0500655_022339 3300053133 Bacteria 1190
209 Ga0500637_0233823 3300053178 Bacteria 1034
210 Ga0307511_10000387
211 MRS1b_contig_2472133
212 rootH1_10335956
213 Ga0065714_10125804
214 Ga0065714_10284903
215 Ga0065712_10085896
216 Ga0070658_10095147
217 Ga0070683_100096440
218 Ga0070677_10165296
219 Ga0068869_100005255
220 Ga0070666_10000043
221 Ga0070680_100009892
222 Ga0070680_100136300
223 Ga0070682_100551154
224 Ga0070660_100201220
225 Ga0070689_100344950
226 Ga0070691_10030628
227 Ga0070675_101310475
228 Ga0070659_100128665
229 Ga0070667_100003552
230 Ga0070711_101149523
231 Ga0070681_10207990
232 Ga0070681_10312626
233 Ga0070685_10449429
234 Ga0070679_100043995
235 Ga0070679_100176942
236 Ga0070684_100030159
237 Ga0068853_100048105
238 Ga0068853_101014081
239 Ga0068853_101593338
240 Ga0068855_100052672
241 Ga0068855_100930788
242 Ga0068857_100971886
243 Ga0068852_100052387
244 Ga0068852_101629201
245 Ga0068859_100000012
246 Ga0068859_101137905
247 Ga0068864_100070311
248 Ga0068864_102300718
249 Ga0068863_100008374
250 Ga0068860_100004050
251 Ga0068860_100021944
252 Ga0070712_100343013
253 Ga0097621_100671431
254 Ga0068871_100302285
255 Ga0068871_101054885
256 Ga0068871_101776561
257 Ga0075430_100592036
258 Ga0068865_100345973
259 Ga0097620_100000012
260 Ga0097620_101137779
261 Ga0105240_10062764
262 Ga0105240_10080384
263 Ga0105245_10070341
264 Ga0105245_10964152
265 Ga0105247_10025782
266 Ga0105241_10001105
267 Ga0105241_10002395
268 Ga0105237_10000725
269 Ga0105237_10315913
270 Ga0105237_11287691
271 Ga0105249_10012219
272 Ga0105249_10514979
273 Ga0105239_10124083
274 Ga0105239_10159857
275 Ga0105239_10247165
276 Ga0105246_10034789
277 Ga0105246_10100608
278 Ga0157373_10212908
279 Ga0157371_10669286
280 Ga0157370_10018336
281 Ga0157370_10020286
282 Ga0157369_10790522
283 Ga0157369_10998248
284 Ga0157374_10037992
285 Ga0157374_10285070
286 Ga0157378_10379689
287 Ga0157378_12084511
288 Ga0163162_10000279
289 Ga0163162_10013425
290 Ga0157372_11149169
291 Ga0157372_12440752
292 Ga0157375_10093458
293 Ga0157375_10231501
294 Ga0157375_11465621
295 Ga0163163_10372365
296 Ga0157380_10305666
297 Ga0157380_10592205
298 Ga0157379_10034367
299 Ga0157376_10120505
300 Ga0157376_10224075
301 Ga0206352_10772333
302 Ga0207680_10000362
303 Ga0207647_10293878
304 Ga0207645_10843024
305 Ga0207705_10131667
306 Ga0207654_10002914
307 Ga0207707_10001992
308 Ga0207707_10483012
309 Ga0207695_10000241
310 Ga0207695_10169182
311 Ga0207671_10000438
312 Ga0207671_10004439
313 Ga0207671_10200517
314 Ga0207660_10028761
315 Ga0207660_10161763
316 Ga0207657_10074795
317 Ga0207652_10057163
318 Ga0207652_10349005
319 Ga0207681_10506549
320 Ga0207659_11093942
321 Ga0207687_10191376
322 Ga0207690_10230028
323 Ga0207686_10018402
324 Ga0207670_10147350
325 Ga0207704_10032899
326 Ga0207689_10000329
327 Ga0207661_10003609
328 Ga0207667_10095714
329 Ga0207651_10362253
330 Ga0207712_10009000
331 Ga0207712_10091109
332 Ga0207668_10764040
333 Ga0207703_10001495
334 Ga0207639_10075741
335 Ga0207639_11264813
336 Ga0207639_11457408
337 Ga0207678_10161112
338 Ga0207641_10000152
339 Ga0207674_10371836
340 Ga0207675_100549853
341 Ga0207698_10003540
342 Ga0268264_10001955
343 Ga0268264_10002744
344 Ga0265337_1000058
345 Ga0265337_1012222
346 Ga0265326_10006210
347 Ga0265326_10007245
348 Ga0265319_1000036
349 Ga0265319_1001335
350 Ga0265319_1074648
351 Ga0265319_1110016
352 Ga0265334_10009799
353 Ga0265318_10001331
354 Ga0265318_10012422
355 Ga0265323_10008893
356 Ga0265336_10000041
357 Ga0307517_10121109
358 Ga0265338_10000056
359 Ga0265338_10000432
360 Ga0265338_10001235
361 Ga0265338_10003585
362 Ga0265324_10000468
363 Ga0265324_10001493
364 Ga0265324_10007858
365 Ga0265324_10075197
366 Ga0265330_10004096
367 Ga0265332_10000291
368 Ga0265328_10000524
369 Ga0265320_10002425
370 Ga0265320_10003963
371 Ga0265320_10168133
372 Ga0265325_10001533
373 Ga0265325_10138758
374 Ga0265329_10000331
375 Ga0265340_10002965
376 Ga0265339_10000497
377 Ga0265339_10084587
378 Ga0265331_10000519
379 Ga0265327_10059659
380 Ga0265316_10007717
381 Ga0265316_10015679
382 Ga0265316_10131645
383 Ga0307509_10301838
384 Ga0265313_10014499
385 Ga0265313_10019092
386 Ga0265314_10000782
387 Ga0265314_10047526
388 Ga0265342_10001519
389 Ga0265342_10356802
390 Ga0373927_0007722
391 Ga0395901_0101161
392 Ga0436365_1523612
393 Ga0451800_0599828
394 Ga0451851_0210247
395 Ga0439433_0184680
396 Ga0439449_0001776
397 Ga0439457_014338
398 Ga0439462_0032550
399 Ga0451577_0000227
400 Ga0451577_0975538
401 Ga0453684_0000033
402 Ga0453684_0020165
403 Ga0453684_0200277
404 Ga0453684_1453972
405 Ga0451576_1459443
406 Ga0495605_0393717
407 Ga0495611_0051480
408 Ga0495661_0000527
409 Ga0495661_0037181
410 Ga0496114_0001010
411 Ga0496125_0018158
412 Ga0496126_0129786
413 Ga0501033_0702343
414 Ga0501257_203020
415 Ga0501035_0464089
416 nmdc:mga0qj67_841687_c1
417 Ga0500655_022339
418 Ga0500637_0233823

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

29

146

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e5d-assembly1.cif.gz_A-2 crystal structure of a putative glyoxalase i (lmof2365_0426) from listeria monocytogenes str. 4b f2365 at 2.70 a resolution 0.7644 6 118
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.7569 4 121
2rk0-assembly1.cif.gz_B crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.7407 4 119
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.7386 3 119
2rk0-assembly1.cif.gz_A crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.7366 1 119
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8758 66 121 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8149 68 117 3.30.720.110
af_A0A0R0LFH0_212_347_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7635 8 119 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7569 4 121 3.10.180.10
4pavD00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7448 8 119 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A3D6EPX2-F1-model_v4 VOC family protein 0.9761 58 121
AF-A0A523J2K1-F1-model_v4 VOC family protein 0.9563 18 121
AF-A0A1T4T679-F1-model_v4 VOC domain-containing protein 0.9541 4 121
AF-A0A2E0L2C7-F1-model_v4 Glyoxalase 0.9503 5 121
AF-A0A1A6C1B2-F1-model_v4 Glyoxalase 0.9502 4 121

Map