F319195

General Info

Members Datasets Scaffolds Average Seq Length
209 147 418 274

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_10179570|Ga0207703_101795702
Length 310
Sequence MTERCSSIRIISSVCDQCGPADIAVLFAGLRCQYWCMSLQLTDVWRYPVKSCRGERLSSAAVEPWGLAGDRRWMIVDGAGDPVTAREHPPLLLVTPRVEDGKITLAGPGLADVTVPVPPAGDLVPVNVWGSDLLATLADEAAATWLTGIVGEPVRLVYLDDPTRRAPNPAYSRDGDRVSFADGYPLLLTSEESLDALNGWIAEGPRPAEGPLPMRRFRPSVVVSGAPAWAEDDWRRLRIGPVTFRAVKGCDRCVMTTIDPDTAAKGHEPLFALARYRRWDGKIWFGVNLIPDHPDPGALIRPGDPVEILE

Samples

Sample ID Description Type Environment
1 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
71 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
72 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
75 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
92 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
93 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
97 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
98 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
99 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
123 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
126 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
127 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
133 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
134 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
137 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
138 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
139 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
140 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
141 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
142 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
143 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
144 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
145 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
146 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
147 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.91
Metatranscriptomes 3.35
Isolates 5.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.96
Bulb 0
Endosphere 5.26
Nodule 0
Rhizoplane 8.61
Rhizosphere 69.86
Stem 0
Stem Tuber 0
Unclassified 1.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207703_10179570 3300026035 Bacteria 1867
2 Ga0065704_10072750 3300005289 Bacteria 8060
3 Ga0070658_10038032 3300005327 Bacteria 3880
4 Ga0070658_10043020 3300005327 Bacteria 3649
5 Ga0070683_100023932 3300005329 Bacteria 5467
6 Ga0070683_100150577 3300005329 Bacteria 2206
7 Ga0070680_100053983 3300005336 Bacteria 3280
8 Ga0070680_100169077 3300005336 Bacteria 1839
9 Ga0070668_100091725 3300005347 Bacteria 2395
10 Ga0070671_100000311 3300005355 Bacteria 33051
11 Ga0070667_100000319 3300005367 Bacteria 53623
12 Ga0070667_100067073 3300005367 Bacteria 3050
13 Ga0070714_100112086 3300005435 Bacteria 2417
14 Ga0070714_100226666 3300005435 Bacteria 1720
15 Ga0070714_100276605 3300005435 Bacteria 1558
16 Ga0070714_100388639 3300005435 Bacteria 1317
17 Ga0070713_100001554 3300005436 Bacteria 14689
18 Ga0070713_100109869 3300005436 Bacteria 2402
19 Ga0070713_100121620 3300005436 Bacteria 2291
20 Ga0070663_100107133 3300005455 Bacteria 2095
21 Ga0070663_100165773 3300005455 Bacteria 1704
22 Ga0070663_100215472 3300005455 Bacteria 1505
23 Ga0070679_100084776 3300005530 Bacteria 3156
24 Ga0070679_100086535 3300005530 Bacteria 3120
25 Ga0070684_100085120 3300005535 Bacteria 2804
26 Ga0070684_100279828 3300005535 Bacteria 1528
27 Ga0070665_100010944 3300005548 Bacteria 9174
28 Ga0068855_100029972 3300005563 Bacteria 6507
29 Ga0068852_100565189 3300005616 Bacteria 1139
30 Ga0068864_100000098 3300005618 Bacteria 85661
31 Ga0068864_100305942 3300005618 Bacteria 1489
32 Ga0068863_100000127 3300005841 Bacteria 80572
33 Ga0068863_100196245 3300005841 Bacteria 1940
34 Ga0068860_100001880 3300005843 Bacteria 22303
35 Ga0068860_100350659 3300005843 Bacteria 1452
36 Ga0068862_100000133 3300005844 Bacteria 86113
37 Ga0068862_100065481 3300005844 Bacteria 3130
38 Ga0081455_10004489 3300005937 Bacteria 15615
39 Ga0075365_10018863 3300006038 Bacteria 4248
40 Ga0075365_10161716 3300006038 Bacteria 1560
41 Ga0075365_10309307 3300006038 Bacteria 1112
42 Ga0075364_10082807 3300006051 Bacteria 2123
43 Ga0097620_100004512 3300006931 Bacteria 14205
44 Ga0105251_10000741 3300009011 Bacteria 29926
45 Ga0105251_10066256 3300009011 Bacteria 1688
46 Ga0105244_10175758 3300009036 Bacteria 1017
47 Ga0105240_10259617 3300009093 Bacteria 2005
48 Ga0105247_10039200 3300009101 Bacteria 2894
49 Ga0105241_10213821 3300009174 Bacteria 1617
50 Ga0105248_10000016 3300009177 Bacteria 308151
51 Ga0105249_10000116 3300009553 Bacteria 108394
52 Ga0105239_10219806 3300010375 Bacteria 2130
53 Ga0157371_10005266 3300013102 Bacteria 10964
54 Ga0157371_10339110 3300013102 Bacteria 1093
55 Ga0157370_10144828 3300013104 Bacteria 2213
56 Ga0157369_10021362 3300013105 Bacteria 7240
57 Ga0157369_10126105 3300013105 Bacteria 2714
58 Ga0157378_10083887 3300013297 Bacteria 2884
59 Ga0163162_10044411 3300013306 Bacteria 4451
60 Ga0163163_10150538 3300014325 Bacteria 2371
61 Ga0157379_10006292 3300014968 Bacteria 10223
62 Ga0157379_10013483 3300014968 Bacteria 7162
63 Ga0206351_10870742 3300020077 Bacteria 2008
64 Ga0206353_11249250 3300020082 Bacteria 2738
65 Ga0206353_11969399 3300020082 Bacteria 2218
66 Ga0213873_10000401 3300021358 Bacteria 7085
67 Ga0213876_10050702 3300021384 Bacteria 2193
68 Ga0224712_10006441 3300022467 Bacteria 3349
69 Ga0224712_10093394 3300022467 Bacteria 1264
70 Ga0207713_1008624 3300025735 Bacteria 5842
71 Ga0207710_10008893 3300025900 Bacteria 4226
72 Ga0207705_10027612 3300025909 Bacteria 4048
73 Ga0207705_10100682 3300025909 Bacteria 2125
74 Ga0207654_10130743 3300025911 Bacteria 1589
75 Ga0207707_10024329 3300025912 Bacteria 5300
76 Ga0207693_10101222 3300025915 Bacteria 2259
77 Ga0207652_10131046 3300025921 Bacteria 2236
78 Ga0207650_10002031 3300025925 Bacteria 14171
79 Ga0207700_10061486 3300025928 Bacteria 2848
80 Ga0207700_10391800 3300025928 Bacteria 1216
81 Ga0207700_10512830 3300025928 Bacteria 1062
82 Ga0207664_10022747 3300025929 Bacteria 4686
83 Ga0207664_10120222 3300025929 Bacteria 2197
84 Ga0207664_10283271 3300025929 Bacteria 1455
85 Ga0207664_10635137 3300025929 Bacteria 959
86 Ga0207644_10001480 3300025931 Bacteria 15114
87 Ga0207711_10000022 3300025941 Bacteria 340441
88 Ga0207661_10186832 3300025944 Bacteria 1814
89 Ga0207667_10013104 3300025949 Bacteria 9515
90 Ga0207712_10000380 3300025961 Bacteria 38956
91 Ga0207668_10008296 3300025972 Bacteria 6189
92 Ga0207668_10015209 3300025972 Bacteria 4776
93 Ga0207668_10337377 3300025972 Bacteria 1256
94 Ga0207658_10000143 3300025986 Bacteria 74612
95 Ga0207658_10069146 3300025986 Bacteria 2667
96 Ga0207703_10044948 3300026035 Bacteria 3551
97 Ga0207678_10026554 3300026067 Bacteria 5051
98 Ga0207678_10217266 3300026067 Bacteria 1636
99 Ga0207678_10259512 3300026067 Bacteria 1489
100 Ga0207702_10330301 3300026078 Bacteria 1454
101 Ga0207641_10000022 3300026088 Bacteria 279334
102 Ga0207641_10891404 3300026088 Bacteria 883
103 Ga0207676_10000051 3300026095 Bacteria 132645
104 Ga0207676_10277868 3300026095 Bacteria 1519
105 Ga0207674_10015121 3300026116 Bacteria 8492
106 Ga0268266_10219643 3300028379 Bacteria 1746
107 Ga0268265_10000090 3300028380 Bacteria 116514
108 Ga0268264_10011340 3300028381 Bacteria 7364
109 Ga0265337_1000474 3300028556 Bacteria 21283
110 Ga0265326_10006167 3300028558 Bacteria 3744
111 Ga0265319_1001318 3300028563 Bacteria 15004
112 Ga0265334_10000699 3300028573 Bacteria 16827
113 Ga0265323_10007447 3300028653 Bacteria 4547
114 Ga0265336_10009549 3300028666 Bacteria 3348
115 Ga0265338_10001239 3300028800 Bacteria 42061
116 Ga0265324_10001702 3300029957 Bacteria 12097
117 Ga0265332_10001417 3300031238 Bacteria 13496
118 Ga0265320_10048241 3300031240 Bacteria 2079
119 Ga0265340_10038724 3300031247 Bacteria 2356
120 Ga0265313_10013373 3300031595 Bacteria 4930
121 Ga0307508_10065573 3300031616 Bacteria 3199
122 Ga0265314_10011772 3300031711 Bacteria 7195
123 Ga0265342_10000958 3300031712 Bacteria 28739
124 Ga0307516_10040813 3300031730 Bacteria 4616
125 Ga0307510_10037982 3300033180 Bacteria 5330
126 Ga0373935_0211048 3300035692 Bacteria 1345
127 Ga0372808_001905 3300036459 Bacteria 2296
128 Ga0372808_012298 3300036459 Bacteria 1215
129 Ga0373925_0000051 3300037068 Bacteria 127667
130 Ga0436364_0517414 3300037853 Bacteria 2105
131 Ga0436364_1280826 3300037853 Bacteria 93394
132 Ga0436364_1497727 3300037853 Bacteria 1689
133 Ga0400490_42606 3300038726 Bacteria 5974
134 Ga0400488_04288 3300038741 Unclassified 1103
135 Ga0400483_244620 3300039062 Unclassified 1092
136 Ga0436365_0192909 3300039437 Bacteria 4531
137 Ga0436365_0353373 3300039437 Bacteria 3703
138 Ga0436362_1302232 3300039453 Bacteria 30573
139 Ga0451800_1021887 3300041459 Bacteria 1272
140 Ga0451839_0206928 3300041496 Bacteria 1431
141 Ga0466972_0009032 3300044658 Bacteria 5003
142 Ga0466965_0149462 3300044683 Bacteria 1220
143 Ga0466966_0053495 3300044684 Bacteria 2561
144 Ga0466961_0011496 3300044693 Bacteria 5661
145 Ga0466961_0049077 3300044693 Bacteria 2698
146 Ga0466963_0017873 3300044694 Bacteria 4424
147 Ga0466963_0243078 3300044694 Bacteria 1262
148 Ga0466964_0034018 3300044706 Bacteria 2033
149 Ga0466971_0005456 3300044719 Bacteria 5520
150 Ga0466957_0015324 3300044842 Bacteria 4479
151 Ga0466959_0008165 3300045049 Bacteria 7386
152 Ga0466959_0032984 3300045049 Bacteria 3832
153 Ga0466958_0001276 3300045836 Bacteria 11815
154 Ga0466958_0211734 3300045836 Bacteria 1235
155 Ga0466967_0100354 3300045976 Bacteria 2645
156 Ga0466967_0107506 3300045976 Bacteria 2559
157 Ga0466967_0313655 3300045976 Bacteria 1511
158 Ga0495638_0044187 3300046460 Bacteria 2808
159 Ga0495639_0017143 3300046475 Bacteria 3146
160 Ga0496101_0005125 3300048904 Bacteria 8329
161 Ga0496101_0342871 3300048904 Bacteria 1174
162 Ga0496102_0000079 3300048905 Bacteria 140942
163 Ga0496102_0000286 3300048905 Bacteria 64518
164 Ga0496103_0000034 3300048906 Bacteria 189284
165 Ga0496103_0000520 3300048906 Bacteria 31686
166 Ga0496103_0040185 3300048906 Unclassified 2875
167 Ga0496104_0151924 3300048907 Bacteria 2222
168 Ga0496105_0036487 3300048908 Bacteria 4050
169 Ga0496107_0097552 3300048910 Bacteria 2152
170 Ga0496108_0056897 3300048911 Bacteria 3286
171 Ga0496109_0107756 3300048912 Bacteria 2588
172 Ga0496109_0109557 3300048912 Bacteria 2567
173 Ga0496112_0343439 3300048915 Bacteria 1436
174 Ga0496114_0000916 3300048917 Bacteria 22093
175 Ga0496114_0123382 3300048917 Bacteria 2230
176 Ga0496115_0514611 3300048918 Bacteria 960
177 Ga0496116_0000716 3300048919 Bacteria 42501
178 Ga0496117_0000579 3300048920 Bacteria 60223
179 Ga0496117_0005645 3300048920 Bacteria 13058
180 Ga0496118_0000587 3300048921 Bacteria 60205
181 Ga0496118_0002599 3300048921 Bacteria 24027
182 Ga0496119_0003873 3300048922 Bacteria 15254
183 Ga0496119_0009384 3300048922 Bacteria 8410
184 Ga0496120_0021385 3300048923 Bacteria 4090
185 Ga0496121_0100701 3300048924 Bacteria 2230
186 Ga0496124_0041984 3300048927 Bacteria 3941
187 Ga0496126_0000649 3300048929 Bacteria 64480
188 Ga0496126_0272785 3300048929 Bacteria 1403
189 Ga0501067_0095240 3300049583 Bacteria 1653
190 nmdc:mga0yw44_148551_c1 3300050492 Bacteria 1527
191 nmdc:mga0yw44_231439_c1 3300050492 Bacteria 1227
192 nmdc:mga0yw44_37449_c1 3300050492 Bacteria 2864
193 nmdc:mga0yw44_9981_c1 3300050492 Bacteria 4829
194 nmdc:mga07m45_169874_c1 3300050496 Bacteria 1267
195 Ga0500644_0074459 3300053088 Bacteria 1232
196 Ga0500573_0002382 3300053140 Bacteria 9367
197 Ga0501082_0017276 3300060353 Bacteria 6216
198 2510285212 2510065053 Bacteria 5005518
199 2510293952 2510065055 Bacteria 5037935
200 2510312985 2510065058 Bacteria 5005894
201 2753272378 2751185782 Bacteria 11227053
202 2774128301 2773857672 Bacteria 4993178
203 2868088953 2868088558 Bacteria 7609351
204 2917835332 2917832318 Bacteria 5346010
205 2919129326 2919125081 Bacteria 5385106
206 2974299542 2974298342 Bacteria 4840922
207 2984501896 2984499530 Bacteria 5020881
208 2984504618 2984504281 Bacteria 5262371
209 8016733569 8016728285 Bacteria 5263933
210 Ga0207703_10179570
211 Ga0065704_10072750
212 Ga0070658_10038032
213 Ga0070658_10043020
214 Ga0070683_100023932
215 Ga0070683_100150577
216 Ga0070680_100053983
217 Ga0070680_100169077
218 Ga0070668_100091725
219 Ga0070671_100000311
220 Ga0070667_100000319
221 Ga0070667_100067073
222 Ga0070714_100112086
223 Ga0070714_100226666
224 Ga0070714_100276605
225 Ga0070714_100388639
226 Ga0070713_100001554
227 Ga0070713_100109869
228 Ga0070713_100121620
229 Ga0070663_100107133
230 Ga0070663_100165773
231 Ga0070663_100215472
232 Ga0070679_100084776
233 Ga0070679_100086535
234 Ga0070684_100085120
235 Ga0070684_100279828
236 Ga0070665_100010944
237 Ga0068855_100029972
238 Ga0068852_100565189
239 Ga0068864_100000098
240 Ga0068864_100305942
241 Ga0068863_100000127
242 Ga0068863_100196245
243 Ga0068860_100001880
244 Ga0068860_100350659
245 Ga0068862_100000133
246 Ga0068862_100065481
247 Ga0081455_10004489
248 Ga0075365_10018863
249 Ga0075365_10161716
250 Ga0075365_10309307
251 Ga0075364_10082807
252 Ga0097620_100004512
253 Ga0105251_10000741
254 Ga0105251_10066256
255 Ga0105244_10175758
256 Ga0105240_10259617
257 Ga0105247_10039200
258 Ga0105241_10213821
259 Ga0105248_10000016
260 Ga0105249_10000116
261 Ga0105239_10219806
262 Ga0157371_10005266
263 Ga0157371_10339110
264 Ga0157370_10144828
265 Ga0157369_10021362
266 Ga0157369_10126105
267 Ga0157378_10083887
268 Ga0163162_10044411
269 Ga0163163_10150538
270 Ga0157379_10006292
271 Ga0157379_10013483
272 Ga0206351_10870742
273 Ga0206353_11249250
274 Ga0206353_11969399
275 Ga0213873_10000401
276 Ga0213876_10050702
277 Ga0224712_10006441
278 Ga0224712_10093394
279 Ga0207713_1008624
280 Ga0207710_10008893
281 Ga0207705_10027612
282 Ga0207705_10100682
283 Ga0207654_10130743
284 Ga0207707_10024329
285 Ga0207693_10101222
286 Ga0207652_10131046
287 Ga0207650_10002031
288 Ga0207700_10061486
289 Ga0207700_10391800
290 Ga0207700_10512830
291 Ga0207664_10022747
292 Ga0207664_10120222
293 Ga0207664_10283271
294 Ga0207664_10635137
295 Ga0207644_10001480
296 Ga0207711_10000022
297 Ga0207661_10186832
298 Ga0207667_10013104
299 Ga0207712_10000380
300 Ga0207668_10008296
301 Ga0207668_10015209
302 Ga0207668_10337377
303 Ga0207658_10000143
304 Ga0207658_10069146
305 Ga0207703_10044948
306 Ga0207678_10026554
307 Ga0207678_10217266
308 Ga0207678_10259512
309 Ga0207702_10330301
310 Ga0207641_10000022
311 Ga0207641_10891404
312 Ga0207676_10000051
313 Ga0207676_10277868
314 Ga0207674_10015121
315 Ga0268266_10219643
316 Ga0268265_10000090
317 Ga0268264_10011340
318 Ga0265337_1000474
319 Ga0265326_10006167
320 Ga0265319_1001318
321 Ga0265334_10000699
322 Ga0265323_10007447
323 Ga0265336_10009549
324 Ga0265338_10001239
325 Ga0265324_10001702
326 Ga0265332_10001417
327 Ga0265320_10048241
328 Ga0265340_10038724
329 Ga0265313_10013373
330 Ga0307508_10065573
331 Ga0265314_10011772
332 Ga0265342_10000958
333 Ga0307516_10040813
334 Ga0307510_10037982
335 Ga0373935_0211048
336 Ga0372808_001905
337 Ga0372808_012298
338 Ga0373925_0000051
339 Ga0436364_0517414
340 Ga0436364_1280826
341 Ga0436364_1497727
342 Ga0400490_42606
343 Ga0400488_04288
344 Ga0400483_244620
345 Ga0436365_0192909
346 Ga0436365_0353373
347 Ga0436362_1302232
348 Ga0451800_1021887
349 Ga0451839_0206928
350 Ga0466972_0009032
351 Ga0466965_0149462
352 Ga0466966_0053495
353 Ga0466961_0011496
354 Ga0466961_0049077
355 Ga0466963_0017873
356 Ga0466963_0243078
357 Ga0466964_0034018
358 Ga0466971_0005456
359 Ga0466957_0015324
360 Ga0466959_0008165
361 Ga0466959_0032984
362 Ga0466958_0001276
363 Ga0466958_0211734
364 Ga0466967_0100354
365 Ga0466967_0107506
366 Ga0466967_0313655
367 Ga0495638_0044187
368 Ga0495639_0017143
369 Ga0496101_0005125
370 Ga0496101_0342871
371 Ga0496102_0000079
372 Ga0496102_0000286
373 Ga0496103_0000034
374 Ga0496103_0000520
375 Ga0496103_0040185
376 Ga0496104_0151924
377 Ga0496105_0036487
378 Ga0496107_0097552
379 Ga0496108_0056897
380 Ga0496109_0107756
381 Ga0496109_0109557
382 Ga0496112_0343439
383 Ga0496114_0000916
384 Ga0496114_0123382
385 Ga0496115_0514611
386 Ga0496116_0000716
387 Ga0496117_0000579
388 Ga0496117_0005645
389 Ga0496118_0000587
390 Ga0496118_0002599
391 Ga0496119_0003873
392 Ga0496119_0009384
393 Ga0496120_0021385
394 Ga0496121_0100701
395 Ga0496124_0041984
396 Ga0496126_0000649
397 Ga0496126_0272785
398 Ga0501067_0095240
399 nmdc:mga0yw44_148551_c1
400 nmdc:mga0yw44_231439_c1
401 nmdc:mga0yw44_37449_c1
402 nmdc:mga0yw44_9981_c1
403 nmdc:mga07m45_169874_c1
404 Ga0500644_0074459
405 Ga0500573_0002382
406 Ga0501082_0017276
407 2510285212
408 2510293952
409 2510312985
410 2753272378
411 2774128301
412 2868088953
413 2917835332
414 2919129326
415 2974299542
416 2984501896
417 2984504618
418 8016733569

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03476

MOSC_N

MOSC N-terminal beta barrel domain

38

153

0.96

PF03473

MOSC

MOSC domain

175

307

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fw2-assembly1.cif.gz_A crystal structure of human marc1 0.9356 2 266
7p41-assembly1.cif.gz_D crystal structure of human marc1 a165t variant 0.9348 2 266
6fw2-assembly1.cif.gz_A crystal structure of human marc1 0.9058 2 266
7p41-assembly1.cif.gz_D crystal structure of human marc1 a165t variant 0.9051 2 266
2exn-assembly1.cif.gz_A solution structure for the protein coded by gene locus bb0938 of bordetella bronchiseptica. northeast structural genomics target bor11. 0.7669 23 123
ID Description Score Start End Superfamily
af_U4PC34_202_334_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.9708 140 263 2.40.33.20
af_P75863_136_262_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.9585 135 263 2.40.33.20
af_P75863_136_262_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.9511 135 263 2.40.33.20
af_Q58EJ9_194_321_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.94 139 263 2.40.33.20
af_I1KZR4_670_814_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.921 141 263 2.40.33.20
ID Description Score Start End GO Terms
AF-A0A4Q2UDN6-F1-model_v4 MOSC domain-containing protein 0.9872 1 266 GO:0003824
GO:0030151
GO:0030170
AF-A0A6L8C7M3-F1-model_v4 MOSC domain-containing protein 0.9859 1 267 GO:0003824
GO:0030151
GO:0030170
AF-A0A1G5T1B3-F1-model_v4 MOSC domain-containing protein 0.9852 2 268 GO:0003824
GO:0030151
GO:0030170
AF-A0A849TJM7-F1-model_v4 MOSC domain-containing protein 0.9846 1 271 GO:0003824
GO:0030151
GO:0030170
AF-A0A523K2R1-F1-model_v4 MOSC domain-containing protein 0.9839 2 266 GO:0003824
GO:0030151
GO:0030170

Map