F319195
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 209 | 147 | 418 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300026035|Ga0207703_10179570|Ga0207703_101795702 |
| Length | 310 |
| Sequence | MTERCSSIRIISSVCDQCGPADIAVLFAGLRCQYWCMSLQLTDVWRYPVKSCRGERLSSAAVEPWGLAGDRRWMIVDGAGDPVTAREHPPLLLVTPRVEDGKITLAGPGLADVTVPVPPAGDLVPVNVWGSDLLATLADEAAATWLTGIVGEPVRLVYLDDPTRRAPNPAYSRDGDRVSFADGYPLLLTSEESLDALNGWIAEGPRPAEGPLPMRRFRPSVVVSGAPAWAEDDWRRLRIGPVTFRAVKGCDRCVMTTIDPDTAAKGHEPLFALARYRRWDGKIWFGVNLIPDHPDPGALIRPGDPVEILE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 16 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 17 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 18 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 19 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 20 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 21 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 22 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 23 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 24 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 41 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 42 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 43 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 44 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 45 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 71 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 72 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 73 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 74 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 75 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 76 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 77 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 78 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 79 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 80 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 81 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 82 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 83 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 84 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 85 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 86 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 87 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 88 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 89 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 90 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 91 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 92 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 93 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 94 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 95 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 96 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 97 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 98 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 99 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 100 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 101 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 102 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 103 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 104 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 105 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 106 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 107 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 108 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 109 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 112 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 113 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 114 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 115 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 116 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 117 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 118 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 119 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 120 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 121 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 122 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 123 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 124 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 125 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 126 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 127 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 128 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 129 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 130 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 132 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 133 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 134 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 135 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 136 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 137 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 138 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 139 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 140 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 141 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 142 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 143 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 144 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 145 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 146 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 147 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.91 |
| Metatranscriptomes | 3.35 |
| Isolates | 5.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.96 |
| Bulb | 0 |
| Endosphere | 5.26 |
| Nodule | 0 |
| Rhizoplane | 8.61 |
| Rhizosphere | 69.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207703_10179570 | 3300026035 | Bacteria | 1867 |
| 2 | Ga0065704_10072750 | 3300005289 | Bacteria | 8060 |
| 3 | Ga0070658_10038032 | 3300005327 | Bacteria | 3880 |
| 4 | Ga0070658_10043020 | 3300005327 | Bacteria | 3649 |
| 5 | Ga0070683_100023932 | 3300005329 | Bacteria | 5467 |
| 6 | Ga0070683_100150577 | 3300005329 | Bacteria | 2206 |
| 7 | Ga0070680_100053983 | 3300005336 | Bacteria | 3280 |
| 8 | Ga0070680_100169077 | 3300005336 | Bacteria | 1839 |
| 9 | Ga0070668_100091725 | 3300005347 | Bacteria | 2395 |
| 10 | Ga0070671_100000311 | 3300005355 | Bacteria | 33051 |
| 11 | Ga0070667_100000319 | 3300005367 | Bacteria | 53623 |
| 12 | Ga0070667_100067073 | 3300005367 | Bacteria | 3050 |
| 13 | Ga0070714_100112086 | 3300005435 | Bacteria | 2417 |
| 14 | Ga0070714_100226666 | 3300005435 | Bacteria | 1720 |
| 15 | Ga0070714_100276605 | 3300005435 | Bacteria | 1558 |
| 16 | Ga0070714_100388639 | 3300005435 | Bacteria | 1317 |
| 17 | Ga0070713_100001554 | 3300005436 | Bacteria | 14689 |
| 18 | Ga0070713_100109869 | 3300005436 | Bacteria | 2402 |
| 19 | Ga0070713_100121620 | 3300005436 | Bacteria | 2291 |
| 20 | Ga0070663_100107133 | 3300005455 | Bacteria | 2095 |
| 21 | Ga0070663_100165773 | 3300005455 | Bacteria | 1704 |
| 22 | Ga0070663_100215472 | 3300005455 | Bacteria | 1505 |
| 23 | Ga0070679_100084776 | 3300005530 | Bacteria | 3156 |
| 24 | Ga0070679_100086535 | 3300005530 | Bacteria | 3120 |
| 25 | Ga0070684_100085120 | 3300005535 | Bacteria | 2804 |
| 26 | Ga0070684_100279828 | 3300005535 | Bacteria | 1528 |
| 27 | Ga0070665_100010944 | 3300005548 | Bacteria | 9174 |
| 28 | Ga0068855_100029972 | 3300005563 | Bacteria | 6507 |
| 29 | Ga0068852_100565189 | 3300005616 | Bacteria | 1139 |
| 30 | Ga0068864_100000098 | 3300005618 | Bacteria | 85661 |
| 31 | Ga0068864_100305942 | 3300005618 | Bacteria | 1489 |
| 32 | Ga0068863_100000127 | 3300005841 | Bacteria | 80572 |
| 33 | Ga0068863_100196245 | 3300005841 | Bacteria | 1940 |
| 34 | Ga0068860_100001880 | 3300005843 | Bacteria | 22303 |
| 35 | Ga0068860_100350659 | 3300005843 | Bacteria | 1452 |
| 36 | Ga0068862_100000133 | 3300005844 | Bacteria | 86113 |
| 37 | Ga0068862_100065481 | 3300005844 | Bacteria | 3130 |
| 38 | Ga0081455_10004489 | 3300005937 | Bacteria | 15615 |
| 39 | Ga0075365_10018863 | 3300006038 | Bacteria | 4248 |
| 40 | Ga0075365_10161716 | 3300006038 | Bacteria | 1560 |
| 41 | Ga0075365_10309307 | 3300006038 | Bacteria | 1112 |
| 42 | Ga0075364_10082807 | 3300006051 | Bacteria | 2123 |
| 43 | Ga0097620_100004512 | 3300006931 | Bacteria | 14205 |
| 44 | Ga0105251_10000741 | 3300009011 | Bacteria | 29926 |
| 45 | Ga0105251_10066256 | 3300009011 | Bacteria | 1688 |
| 46 | Ga0105244_10175758 | 3300009036 | Bacteria | 1017 |
| 47 | Ga0105240_10259617 | 3300009093 | Bacteria | 2005 |
| 48 | Ga0105247_10039200 | 3300009101 | Bacteria | 2894 |
| 49 | Ga0105241_10213821 | 3300009174 | Bacteria | 1617 |
| 50 | Ga0105248_10000016 | 3300009177 | Bacteria | 308151 |
| 51 | Ga0105249_10000116 | 3300009553 | Bacteria | 108394 |
| 52 | Ga0105239_10219806 | 3300010375 | Bacteria | 2130 |
| 53 | Ga0157371_10005266 | 3300013102 | Bacteria | 10964 |
| 54 | Ga0157371_10339110 | 3300013102 | Bacteria | 1093 |
| 55 | Ga0157370_10144828 | 3300013104 | Bacteria | 2213 |
| 56 | Ga0157369_10021362 | 3300013105 | Bacteria | 7240 |
| 57 | Ga0157369_10126105 | 3300013105 | Bacteria | 2714 |
| 58 | Ga0157378_10083887 | 3300013297 | Bacteria | 2884 |
| 59 | Ga0163162_10044411 | 3300013306 | Bacteria | 4451 |
| 60 | Ga0163163_10150538 | 3300014325 | Bacteria | 2371 |
| 61 | Ga0157379_10006292 | 3300014968 | Bacteria | 10223 |
| 62 | Ga0157379_10013483 | 3300014968 | Bacteria | 7162 |
| 63 | Ga0206351_10870742 | 3300020077 | Bacteria | 2008 |
| 64 | Ga0206353_11249250 | 3300020082 | Bacteria | 2738 |
| 65 | Ga0206353_11969399 | 3300020082 | Bacteria | 2218 |
| 66 | Ga0213873_10000401 | 3300021358 | Bacteria | 7085 |
| 67 | Ga0213876_10050702 | 3300021384 | Bacteria | 2193 |
| 68 | Ga0224712_10006441 | 3300022467 | Bacteria | 3349 |
| 69 | Ga0224712_10093394 | 3300022467 | Bacteria | 1264 |
| 70 | Ga0207713_1008624 | 3300025735 | Bacteria | 5842 |
| 71 | Ga0207710_10008893 | 3300025900 | Bacteria | 4226 |
| 72 | Ga0207705_10027612 | 3300025909 | Bacteria | 4048 |
| 73 | Ga0207705_10100682 | 3300025909 | Bacteria | 2125 |
| 74 | Ga0207654_10130743 | 3300025911 | Bacteria | 1589 |
| 75 | Ga0207707_10024329 | 3300025912 | Bacteria | 5300 |
| 76 | Ga0207693_10101222 | 3300025915 | Bacteria | 2259 |
| 77 | Ga0207652_10131046 | 3300025921 | Bacteria | 2236 |
| 78 | Ga0207650_10002031 | 3300025925 | Bacteria | 14171 |
| 79 | Ga0207700_10061486 | 3300025928 | Bacteria | 2848 |
| 80 | Ga0207700_10391800 | 3300025928 | Bacteria | 1216 |
| 81 | Ga0207700_10512830 | 3300025928 | Bacteria | 1062 |
| 82 | Ga0207664_10022747 | 3300025929 | Bacteria | 4686 |
| 83 | Ga0207664_10120222 | 3300025929 | Bacteria | 2197 |
| 84 | Ga0207664_10283271 | 3300025929 | Bacteria | 1455 |
| 85 | Ga0207664_10635137 | 3300025929 | Bacteria | 959 |
| 86 | Ga0207644_10001480 | 3300025931 | Bacteria | 15114 |
| 87 | Ga0207711_10000022 | 3300025941 | Bacteria | 340441 |
| 88 | Ga0207661_10186832 | 3300025944 | Bacteria | 1814 |
| 89 | Ga0207667_10013104 | 3300025949 | Bacteria | 9515 |
| 90 | Ga0207712_10000380 | 3300025961 | Bacteria | 38956 |
| 91 | Ga0207668_10008296 | 3300025972 | Bacteria | 6189 |
| 92 | Ga0207668_10015209 | 3300025972 | Bacteria | 4776 |
| 93 | Ga0207668_10337377 | 3300025972 | Bacteria | 1256 |
| 94 | Ga0207658_10000143 | 3300025986 | Bacteria | 74612 |
| 95 | Ga0207658_10069146 | 3300025986 | Bacteria | 2667 |
| 96 | Ga0207703_10044948 | 3300026035 | Bacteria | 3551 |
| 97 | Ga0207678_10026554 | 3300026067 | Bacteria | 5051 |
| 98 | Ga0207678_10217266 | 3300026067 | Bacteria | 1636 |
| 99 | Ga0207678_10259512 | 3300026067 | Bacteria | 1489 |
| 100 | Ga0207702_10330301 | 3300026078 | Bacteria | 1454 |
| 101 | Ga0207641_10000022 | 3300026088 | Bacteria | 279334 |
| 102 | Ga0207641_10891404 | 3300026088 | Bacteria | 883 |
| 103 | Ga0207676_10000051 | 3300026095 | Bacteria | 132645 |
| 104 | Ga0207676_10277868 | 3300026095 | Bacteria | 1519 |
| 105 | Ga0207674_10015121 | 3300026116 | Bacteria | 8492 |
| 106 | Ga0268266_10219643 | 3300028379 | Bacteria | 1746 |
| 107 | Ga0268265_10000090 | 3300028380 | Bacteria | 116514 |
| 108 | Ga0268264_10011340 | 3300028381 | Bacteria | 7364 |
| 109 | Ga0265337_1000474 | 3300028556 | Bacteria | 21283 |
| 110 | Ga0265326_10006167 | 3300028558 | Bacteria | 3744 |
| 111 | Ga0265319_1001318 | 3300028563 | Bacteria | 15004 |
| 112 | Ga0265334_10000699 | 3300028573 | Bacteria | 16827 |
| 113 | Ga0265323_10007447 | 3300028653 | Bacteria | 4547 |
| 114 | Ga0265336_10009549 | 3300028666 | Bacteria | 3348 |
| 115 | Ga0265338_10001239 | 3300028800 | Bacteria | 42061 |
| 116 | Ga0265324_10001702 | 3300029957 | Bacteria | 12097 |
| 117 | Ga0265332_10001417 | 3300031238 | Bacteria | 13496 |
| 118 | Ga0265320_10048241 | 3300031240 | Bacteria | 2079 |
| 119 | Ga0265340_10038724 | 3300031247 | Bacteria | 2356 |
| 120 | Ga0265313_10013373 | 3300031595 | Bacteria | 4930 |
| 121 | Ga0307508_10065573 | 3300031616 | Bacteria | 3199 |
| 122 | Ga0265314_10011772 | 3300031711 | Bacteria | 7195 |
| 123 | Ga0265342_10000958 | 3300031712 | Bacteria | 28739 |
| 124 | Ga0307516_10040813 | 3300031730 | Bacteria | 4616 |
| 125 | Ga0307510_10037982 | 3300033180 | Bacteria | 5330 |
| 126 | Ga0373935_0211048 | 3300035692 | Bacteria | 1345 |
| 127 | Ga0372808_001905 | 3300036459 | Bacteria | 2296 |
| 128 | Ga0372808_012298 | 3300036459 | Bacteria | 1215 |
| 129 | Ga0373925_0000051 | 3300037068 | Bacteria | 127667 |
| 130 | Ga0436364_0517414 | 3300037853 | Bacteria | 2105 |
| 131 | Ga0436364_1280826 | 3300037853 | Bacteria | 93394 |
| 132 | Ga0436364_1497727 | 3300037853 | Bacteria | 1689 |
| 133 | Ga0400490_42606 | 3300038726 | Bacteria | 5974 |
| 134 | Ga0400488_04288 | 3300038741 | Unclassified | 1103 |
| 135 | Ga0400483_244620 | 3300039062 | Unclassified | 1092 |
| 136 | Ga0436365_0192909 | 3300039437 | Bacteria | 4531 |
| 137 | Ga0436365_0353373 | 3300039437 | Bacteria | 3703 |
| 138 | Ga0436362_1302232 | 3300039453 | Bacteria | 30573 |
| 139 | Ga0451800_1021887 | 3300041459 | Bacteria | 1272 |
| 140 | Ga0451839_0206928 | 3300041496 | Bacteria | 1431 |
| 141 | Ga0466972_0009032 | 3300044658 | Bacteria | 5003 |
| 142 | Ga0466965_0149462 | 3300044683 | Bacteria | 1220 |
| 143 | Ga0466966_0053495 | 3300044684 | Bacteria | 2561 |
| 144 | Ga0466961_0011496 | 3300044693 | Bacteria | 5661 |
| 145 | Ga0466961_0049077 | 3300044693 | Bacteria | 2698 |
| 146 | Ga0466963_0017873 | 3300044694 | Bacteria | 4424 |
| 147 | Ga0466963_0243078 | 3300044694 | Bacteria | 1262 |
| 148 | Ga0466964_0034018 | 3300044706 | Bacteria | 2033 |
| 149 | Ga0466971_0005456 | 3300044719 | Bacteria | 5520 |
| 150 | Ga0466957_0015324 | 3300044842 | Bacteria | 4479 |
| 151 | Ga0466959_0008165 | 3300045049 | Bacteria | 7386 |
| 152 | Ga0466959_0032984 | 3300045049 | Bacteria | 3832 |
| 153 | Ga0466958_0001276 | 3300045836 | Bacteria | 11815 |
| 154 | Ga0466958_0211734 | 3300045836 | Bacteria | 1235 |
| 155 | Ga0466967_0100354 | 3300045976 | Bacteria | 2645 |
| 156 | Ga0466967_0107506 | 3300045976 | Bacteria | 2559 |
| 157 | Ga0466967_0313655 | 3300045976 | Bacteria | 1511 |
| 158 | Ga0495638_0044187 | 3300046460 | Bacteria | 2808 |
| 159 | Ga0495639_0017143 | 3300046475 | Bacteria | 3146 |
| 160 | Ga0496101_0005125 | 3300048904 | Bacteria | 8329 |
| 161 | Ga0496101_0342871 | 3300048904 | Bacteria | 1174 |
| 162 | Ga0496102_0000079 | 3300048905 | Bacteria | 140942 |
| 163 | Ga0496102_0000286 | 3300048905 | Bacteria | 64518 |
| 164 | Ga0496103_0000034 | 3300048906 | Bacteria | 189284 |
| 165 | Ga0496103_0000520 | 3300048906 | Bacteria | 31686 |
| 166 | Ga0496103_0040185 | 3300048906 | Unclassified | 2875 |
| 167 | Ga0496104_0151924 | 3300048907 | Bacteria | 2222 |
| 168 | Ga0496105_0036487 | 3300048908 | Bacteria | 4050 |
| 169 | Ga0496107_0097552 | 3300048910 | Bacteria | 2152 |
| 170 | Ga0496108_0056897 | 3300048911 | Bacteria | 3286 |
| 171 | Ga0496109_0107756 | 3300048912 | Bacteria | 2588 |
| 172 | Ga0496109_0109557 | 3300048912 | Bacteria | 2567 |
| 173 | Ga0496112_0343439 | 3300048915 | Bacteria | 1436 |
| 174 | Ga0496114_0000916 | 3300048917 | Bacteria | 22093 |
| 175 | Ga0496114_0123382 | 3300048917 | Bacteria | 2230 |
| 176 | Ga0496115_0514611 | 3300048918 | Bacteria | 960 |
| 177 | Ga0496116_0000716 | 3300048919 | Bacteria | 42501 |
| 178 | Ga0496117_0000579 | 3300048920 | Bacteria | 60223 |
| 179 | Ga0496117_0005645 | 3300048920 | Bacteria | 13058 |
| 180 | Ga0496118_0000587 | 3300048921 | Bacteria | 60205 |
| 181 | Ga0496118_0002599 | 3300048921 | Bacteria | 24027 |
| 182 | Ga0496119_0003873 | 3300048922 | Bacteria | 15254 |
| 183 | Ga0496119_0009384 | 3300048922 | Bacteria | 8410 |
| 184 | Ga0496120_0021385 | 3300048923 | Bacteria | 4090 |
| 185 | Ga0496121_0100701 | 3300048924 | Bacteria | 2230 |
| 186 | Ga0496124_0041984 | 3300048927 | Bacteria | 3941 |
| 187 | Ga0496126_0000649 | 3300048929 | Bacteria | 64480 |
| 188 | Ga0496126_0272785 | 3300048929 | Bacteria | 1403 |
| 189 | Ga0501067_0095240 | 3300049583 | Bacteria | 1653 |
| 190 | nmdc:mga0yw44_148551_c1 | 3300050492 | Bacteria | 1527 |
| 191 | nmdc:mga0yw44_231439_c1 | 3300050492 | Bacteria | 1227 |
| 192 | nmdc:mga0yw44_37449_c1 | 3300050492 | Bacteria | 2864 |
| 193 | nmdc:mga0yw44_9981_c1 | 3300050492 | Bacteria | 4829 |
| 194 | nmdc:mga07m45_169874_c1 | 3300050496 | Bacteria | 1267 |
| 195 | Ga0500644_0074459 | 3300053088 | Bacteria | 1232 |
| 196 | Ga0500573_0002382 | 3300053140 | Bacteria | 9367 |
| 197 | Ga0501082_0017276 | 3300060353 | Bacteria | 6216 |
| 198 | 2510285212 | 2510065053 | Bacteria | 5005518 |
| 199 | 2510293952 | 2510065055 | Bacteria | 5037935 |
| 200 | 2510312985 | 2510065058 | Bacteria | 5005894 |
| 201 | 2753272378 | 2751185782 | Bacteria | 11227053 |
| 202 | 2774128301 | 2773857672 | Bacteria | 4993178 |
| 203 | 2868088953 | 2868088558 | Bacteria | 7609351 |
| 204 | 2917835332 | 2917832318 | Bacteria | 5346010 |
| 205 | 2919129326 | 2919125081 | Bacteria | 5385106 |
| 206 | 2974299542 | 2974298342 | Bacteria | 4840922 |
| 207 | 2984501896 | 2984499530 | Bacteria | 5020881 |
| 208 | 2984504618 | 2984504281 | Bacteria | 5262371 |
| 209 | 8016733569 | 8016728285 | Bacteria | 5263933 |
| 210 | Ga0207703_10179570 | |||
| 211 | Ga0065704_10072750 | |||
| 212 | Ga0070658_10038032 | |||
| 213 | Ga0070658_10043020 | |||
| 214 | Ga0070683_100023932 | |||
| 215 | Ga0070683_100150577 | |||
| 216 | Ga0070680_100053983 | |||
| 217 | Ga0070680_100169077 | |||
| 218 | Ga0070668_100091725 | |||
| 219 | Ga0070671_100000311 | |||
| 220 | Ga0070667_100000319 | |||
| 221 | Ga0070667_100067073 | |||
| 222 | Ga0070714_100112086 | |||
| 223 | Ga0070714_100226666 | |||
| 224 | Ga0070714_100276605 | |||
| 225 | Ga0070714_100388639 | |||
| 226 | Ga0070713_100001554 | |||
| 227 | Ga0070713_100109869 | |||
| 228 | Ga0070713_100121620 | |||
| 229 | Ga0070663_100107133 | |||
| 230 | Ga0070663_100165773 | |||
| 231 | Ga0070663_100215472 | |||
| 232 | Ga0070679_100084776 | |||
| 233 | Ga0070679_100086535 | |||
| 234 | Ga0070684_100085120 | |||
| 235 | Ga0070684_100279828 | |||
| 236 | Ga0070665_100010944 | |||
| 237 | Ga0068855_100029972 | |||
| 238 | Ga0068852_100565189 | |||
| 239 | Ga0068864_100000098 | |||
| 240 | Ga0068864_100305942 | |||
| 241 | Ga0068863_100000127 | |||
| 242 | Ga0068863_100196245 | |||
| 243 | Ga0068860_100001880 | |||
| 244 | Ga0068860_100350659 | |||
| 245 | Ga0068862_100000133 | |||
| 246 | Ga0068862_100065481 | |||
| 247 | Ga0081455_10004489 | |||
| 248 | Ga0075365_10018863 | |||
| 249 | Ga0075365_10161716 | |||
| 250 | Ga0075365_10309307 | |||
| 251 | Ga0075364_10082807 | |||
| 252 | Ga0097620_100004512 | |||
| 253 | Ga0105251_10000741 | |||
| 254 | Ga0105251_10066256 | |||
| 255 | Ga0105244_10175758 | |||
| 256 | Ga0105240_10259617 | |||
| 257 | Ga0105247_10039200 | |||
| 258 | Ga0105241_10213821 | |||
| 259 | Ga0105248_10000016 | |||
| 260 | Ga0105249_10000116 | |||
| 261 | Ga0105239_10219806 | |||
| 262 | Ga0157371_10005266 | |||
| 263 | Ga0157371_10339110 | |||
| 264 | Ga0157370_10144828 | |||
| 265 | Ga0157369_10021362 | |||
| 266 | Ga0157369_10126105 | |||
| 267 | Ga0157378_10083887 | |||
| 268 | Ga0163162_10044411 | |||
| 269 | Ga0163163_10150538 | |||
| 270 | Ga0157379_10006292 | |||
| 271 | Ga0157379_10013483 | |||
| 272 | Ga0206351_10870742 | |||
| 273 | Ga0206353_11249250 | |||
| 274 | Ga0206353_11969399 | |||
| 275 | Ga0213873_10000401 | |||
| 276 | Ga0213876_10050702 | |||
| 277 | Ga0224712_10006441 | |||
| 278 | Ga0224712_10093394 | |||
| 279 | Ga0207713_1008624 | |||
| 280 | Ga0207710_10008893 | |||
| 281 | Ga0207705_10027612 | |||
| 282 | Ga0207705_10100682 | |||
| 283 | Ga0207654_10130743 | |||
| 284 | Ga0207707_10024329 | |||
| 285 | Ga0207693_10101222 | |||
| 286 | Ga0207652_10131046 | |||
| 287 | Ga0207650_10002031 | |||
| 288 | Ga0207700_10061486 | |||
| 289 | Ga0207700_10391800 | |||
| 290 | Ga0207700_10512830 | |||
| 291 | Ga0207664_10022747 | |||
| 292 | Ga0207664_10120222 | |||
| 293 | Ga0207664_10283271 | |||
| 294 | Ga0207664_10635137 | |||
| 295 | Ga0207644_10001480 | |||
| 296 | Ga0207711_10000022 | |||
| 297 | Ga0207661_10186832 | |||
| 298 | Ga0207667_10013104 | |||
| 299 | Ga0207712_10000380 | |||
| 300 | Ga0207668_10008296 | |||
| 301 | Ga0207668_10015209 | |||
| 302 | Ga0207668_10337377 | |||
| 303 | Ga0207658_10000143 | |||
| 304 | Ga0207658_10069146 | |||
| 305 | Ga0207703_10044948 | |||
| 306 | Ga0207678_10026554 | |||
| 307 | Ga0207678_10217266 | |||
| 308 | Ga0207678_10259512 | |||
| 309 | Ga0207702_10330301 | |||
| 310 | Ga0207641_10000022 | |||
| 311 | Ga0207641_10891404 | |||
| 312 | Ga0207676_10000051 | |||
| 313 | Ga0207676_10277868 | |||
| 314 | Ga0207674_10015121 | |||
| 315 | Ga0268266_10219643 | |||
| 316 | Ga0268265_10000090 | |||
| 317 | Ga0268264_10011340 | |||
| 318 | Ga0265337_1000474 | |||
| 319 | Ga0265326_10006167 | |||
| 320 | Ga0265319_1001318 | |||
| 321 | Ga0265334_10000699 | |||
| 322 | Ga0265323_10007447 | |||
| 323 | Ga0265336_10009549 | |||
| 324 | Ga0265338_10001239 | |||
| 325 | Ga0265324_10001702 | |||
| 326 | Ga0265332_10001417 | |||
| 327 | Ga0265320_10048241 | |||
| 328 | Ga0265340_10038724 | |||
| 329 | Ga0265313_10013373 | |||
| 330 | Ga0307508_10065573 | |||
| 331 | Ga0265314_10011772 | |||
| 332 | Ga0265342_10000958 | |||
| 333 | Ga0307516_10040813 | |||
| 334 | Ga0307510_10037982 | |||
| 335 | Ga0373935_0211048 | |||
| 336 | Ga0372808_001905 | |||
| 337 | Ga0372808_012298 | |||
| 338 | Ga0373925_0000051 | |||
| 339 | Ga0436364_0517414 | |||
| 340 | Ga0436364_1280826 | |||
| 341 | Ga0436364_1497727 | |||
| 342 | Ga0400490_42606 | |||
| 343 | Ga0400488_04288 | |||
| 344 | Ga0400483_244620 | |||
| 345 | Ga0436365_0192909 | |||
| 346 | Ga0436365_0353373 | |||
| 347 | Ga0436362_1302232 | |||
| 348 | Ga0451800_1021887 | |||
| 349 | Ga0451839_0206928 | |||
| 350 | Ga0466972_0009032 | |||
| 351 | Ga0466965_0149462 | |||
| 352 | Ga0466966_0053495 | |||
| 353 | Ga0466961_0011496 | |||
| 354 | Ga0466961_0049077 | |||
| 355 | Ga0466963_0017873 | |||
| 356 | Ga0466963_0243078 | |||
| 357 | Ga0466964_0034018 | |||
| 358 | Ga0466971_0005456 | |||
| 359 | Ga0466957_0015324 | |||
| 360 | Ga0466959_0008165 | |||
| 361 | Ga0466959_0032984 | |||
| 362 | Ga0466958_0001276 | |||
| 363 | Ga0466958_0211734 | |||
| 364 | Ga0466967_0100354 | |||
| 365 | Ga0466967_0107506 | |||
| 366 | Ga0466967_0313655 | |||
| 367 | Ga0495638_0044187 | |||
| 368 | Ga0495639_0017143 | |||
| 369 | Ga0496101_0005125 | |||
| 370 | Ga0496101_0342871 | |||
| 371 | Ga0496102_0000079 | |||
| 372 | Ga0496102_0000286 | |||
| 373 | Ga0496103_0000034 | |||
| 374 | Ga0496103_0000520 | |||
| 375 | Ga0496103_0040185 | |||
| 376 | Ga0496104_0151924 | |||
| 377 | Ga0496105_0036487 | |||
| 378 | Ga0496107_0097552 | |||
| 379 | Ga0496108_0056897 | |||
| 380 | Ga0496109_0107756 | |||
| 381 | Ga0496109_0109557 | |||
| 382 | Ga0496112_0343439 | |||
| 383 | Ga0496114_0000916 | |||
| 384 | Ga0496114_0123382 | |||
| 385 | Ga0496115_0514611 | |||
| 386 | Ga0496116_0000716 | |||
| 387 | Ga0496117_0000579 | |||
| 388 | Ga0496117_0005645 | |||
| 389 | Ga0496118_0000587 | |||
| 390 | Ga0496118_0002599 | |||
| 391 | Ga0496119_0003873 | |||
| 392 | Ga0496119_0009384 | |||
| 393 | Ga0496120_0021385 | |||
| 394 | Ga0496121_0100701 | |||
| 395 | Ga0496124_0041984 | |||
| 396 | Ga0496126_0000649 | |||
| 397 | Ga0496126_0272785 | |||
| 398 | Ga0501067_0095240 | |||
| 399 | nmdc:mga0yw44_148551_c1 | |||
| 400 | nmdc:mga0yw44_231439_c1 | |||
| 401 | nmdc:mga0yw44_37449_c1 | |||
| 402 | nmdc:mga0yw44_9981_c1 | |||
| 403 | nmdc:mga07m45_169874_c1 | |||
| 404 | Ga0500644_0074459 | |||
| 405 | Ga0500573_0002382 | |||
| 406 | Ga0501082_0017276 | |||
| 407 | 2510285212 | |||
| 408 | 2510293952 | |||
| 409 | 2510312985 | |||
| 410 | 2753272378 | |||
| 411 | 2774128301 | |||
| 412 | 2868088953 | |||
| 413 | 2917835332 | |||
| 414 | 2919129326 | |||
| 415 | 2974299542 | |||
| 416 | 2984501896 | |||
| 417 | 2984504618 | |||
| 418 | 8016733569 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6fw2-assembly1.cif.gz_A | crystal structure of human marc1 | 0.9356 | 2 | 266 |
| 7p41-assembly1.cif.gz_D | crystal structure of human marc1 a165t variant | 0.9348 | 2 | 266 |
| 6fw2-assembly1.cif.gz_A | crystal structure of human marc1 | 0.9058 | 2 | 266 |
| 7p41-assembly1.cif.gz_D | crystal structure of human marc1 a165t variant | 0.9051 | 2 | 266 |
| 2exn-assembly1.cif.gz_A | solution structure for the protein coded by gene locus bb0938 of bordetella bronchiseptica. northeast structural genomics target bor11. | 0.7669 | 23 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_U4PC34_202_334_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.9708 | 140 | 263 | 2.40.33.20 |
| af_P75863_136_262_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.9585 | 135 | 263 | 2.40.33.20 |
| af_P75863_136_262_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.9511 | 135 | 263 | 2.40.33.20 |
| af_Q58EJ9_194_321_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.94 | 139 | 263 | 2.40.33.20 |
| af_I1KZR4_670_814_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.921 | 141 | 263 | 2.40.33.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q2UDN6-F1-model_v4 | MOSC domain-containing protein | 0.9872 | 1 | 266 |
GO:0003824
GO:0030151 GO:0030170 |
| AF-A0A6L8C7M3-F1-model_v4 | MOSC domain-containing protein | 0.9859 | 1 | 267 |
GO:0003824
GO:0030151 GO:0030170 |
| AF-A0A1G5T1B3-F1-model_v4 | MOSC domain-containing protein | 0.9852 | 2 | 268 |
GO:0003824
GO:0030151 GO:0030170 |
| AF-A0A849TJM7-F1-model_v4 | MOSC domain-containing protein | 0.9846 | 1 | 271 |
GO:0003824
GO:0030151 GO:0030170 |
| AF-A0A523K2R1-F1-model_v4 | MOSC domain-containing protein | 0.9839 | 2 | 266 |
GO:0003824
GO:0030151 GO:0030170 |