F318950

General Info

Members Datasets Scaffolds Average Seq Length
209 125 418 344

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100103511|Ga0075428_1001035112
Length 356
Sequence MKRIAVVTSSPPLAEGGHLVIARALTEALRDAGHQADIIVTPQNRFGRQASAYLATWLTDVGLSDRGPIDQVISLRYPSYAIRHPHHVCWLNHTMREYYDLWDRFSSGLSGRGRIKEGVRRRLIHAADRFLLTRNVSKLFVQSETIQKRLSMWPELRATVLYPPAPHRQYHCDRYGDFIFMVSRLTPLKRADLLIRALATADGEGIKAVIAGDGGERTRLADLVNELDLADRVQLVGPVTQPELLHYFAHCRAVCFPTLAEDYGFVTVEAFSSRKAVVTCTDSGGPAELVGDGERGFVVPPTAEALAAAIKRLMEDSALAETLGHNGFHLAQTITWPDTVDVLLGVKTAVQYSRTT

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
83 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
84 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
93 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
94 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
102 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
103 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
107 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
121 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
122 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
123 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
125 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.53
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 17.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100103511 3300006844 Bacteria 3104
2 Ga0065712_10000315 3300005290 Bacteria 16573
3 Ga0065712_10068874 3300005290 Bacteria 8719
4 Ga0065712_10072918 3300005290 Bacteria 4566
5 Ga0065715_10009252 3300005293 Unclassified 2884
6 Ga0065715_10024579 3300005293 Unclassified 1477
7 Ga0065715_10088996 3300005293 Bacteria 17728
8 Ga0070683_100002741 3300005329 Bacteria 14070
9 Ga0070670_100022381 3300005331 Bacteria 5441
10 Ga0070670_100067525 3300005331 Bacteria 3068
11 Ga0070666_10159082 3300005335 Bacteria 1578
12 Ga0070661_100139801 3300005344 Bacteria 1824
13 Ga0070669_100201084 3300005353 Bacteria 1568
14 Ga0070675_100087182 3300005354 Bacteria 2610
15 Ga0070674_100095739 3300005356 Bacteria 2153
16 Ga0070673_100289008 3300005364 Bacteria 1440
17 Ga0070688_100003791 3300005365 Bacteria 7835
18 Ga0070688_100073519 3300005365 Bacteria 2193
19 Ga0070667_100077687 3300005367 Bacteria 2835
20 Ga0070667_100209995 3300005367 Bacteria 1730
21 Ga0070703_10038211 3300005406 Bacteria 1483
22 Ga0070694_100031108 3300005444 Bacteria 3497
23 Ga0070663_100067946 3300005455 Bacteria 2587
24 Ga0070678_100029687 3300005456 Bacteria 3748
25 Ga0070678_100230423 3300005456 Bacteria 1544
26 Ga0070662_100285819 3300005457 Unclassified 1336
27 Ga0070685_10014795 3300005466 Bacteria 4138
28 Ga0070684_100000084 3300005535 Bacteria 61595
29 Ga0070672_100022710 3300005543 Bacteria 4614
30 Ga0070672_100152519 3300005543 Bacteria 1912
31 Ga0070672_100260553 3300005543 Bacteria 1462
32 Ga0070686_100038681 3300005544 Bacteria 2967
33 Ga0070695_100046603 3300005545 Unclassified 2766
34 Ga0070693_100008170 3300005547 Bacteria 5143
35 Ga0070665_100006573 3300005548 Bacteria 11821
36 Ga0070665_100266243 3300005548 Bacteria 1715
37 Ga0070664_100000177 3300005564 Bacteria 44970
38 Ga0068859_100038631 3300005617 Bacteria 4789
39 Ga0068859_100391614 3300005617 Bacteria 1485
40 Ga0068864_100026056 3300005618 Bacteria 4929
41 Ga0068861_100204429 3300005719 Bacteria 1660
42 Ga0068863_100023104 3300005841 Bacteria 5943
43 Ga0068858_100339195 3300005842 Bacteria 1438
44 Ga0068862_100029892 3300005844 Unclassified 4590
45 Ga0068862_100049326 3300005844 Bacteria 3595
46 Ga0068862_100283020 3300005844 Bacteria 1520
47 Ga0068871_100145575 3300006358 Bacteria 2017
48 Ga0075428_100002508 3300006844 Bacteria 19940
49 Ga0075428_100392756 3300006844 Bacteria 1487
50 Ga0075430_100002489 3300006846 Bacteria 15349
51 Ga0075430_100187522 3300006846 Bacteria 1720
52 Ga0075431_100004551 3300006847 Bacteria 13616
53 Ga0075431_100052421 3300006847 Bacteria 4207
54 Ga0075431_100056680 3300006847 Unclassified 4041
55 Ga0075431_100399832 3300006847 Bacteria 1375
56 Ga0075433_10018596 3300006852 Bacteria 5779
57 Ga0075433_10287312 3300006852 Bacteria 1457
58 Ga0075434_100002153 3300006871 Bacteria 17151
59 Ga0075429_100005533 3300006880 Bacteria 10883
60 Ga0075429_100028384 3300006880 Bacteria 4859
61 Ga0075429_100051692 3300006880 Bacteria 3575
62 Ga0075429_100216784 3300006880 Unclassified 1677
63 Ga0075429_100376551 3300006880 Bacteria 1243
64 Ga0097620_100038629 3300006931 Bacteria 4789
65 Ga0097620_100391619 3300006931 Bacteria 1485
66 Ga0075435_100205476 3300007076 Bacteria 1669
67 Ga0111539_10000740 3300009094 Bacteria 42401
68 Ga0111539_10063699 3300009094 Unclassified 4362
69 Ga0111539_10185576 3300009094 Bacteria 2429
70 Ga0111539_10224723 3300009094 Bacteria 2187
71 Ga0114129_10000186 3300009147 Bacteria 69381
72 Ga0114129_10001901 3300009147 Bacteria 28450
73 Ga0114129_10015389 3300009147 Bacteria 10885
74 Ga0114129_10030391 3300009147 Bacteria 7643
75 Ga0114129_10052394 3300009147 Bacteria 5727
76 Ga0114129_10106942 3300009147 Bacteria 3864
77 Ga0105242_10140109 3300009176 Bacteria 2098
78 Ga0105248_10073864 3300009177 Bacteria 3833
79 Ga0105248_10191839 3300009177 Bacteria 2302
80 Ga0105249_10046155 3300009553 Unclassified 3965
81 Ga0105249_10048430 3300009553 Bacteria 3874
82 Ga0105249_10227724 3300009553 Bacteria 1837
83 Ga0157374_10008431 3300013296 Bacteria 8806
84 Ga0157375_10040412 3300013308 Bacteria 4496
85 Ga0163163_10032379 3300014325 Bacteria 5048
86 Ga0157380_10080872 3300014326 Bacteria 2656
87 Ga0157380_10186550 3300014326 Unclassified 1827
88 Ga0157380_10202529 3300014326 Unclassified 1762
89 Ga0157377_10069955 3300014745 Bacteria 2026
90 Ga0207688_10002737 3300025901 Bacteria 9539
91 Ga0207649_10035571 3300025920 Bacteria 2993
92 Ga0207681_10033878 3300025923 Bacteria 3354
93 Ga0207681_10106740 3300025923 Bacteria 2030
94 Ga0207650_10024246 3300025925 Bacteria 4311
95 Ga0207650_10110904 3300025925 Bacteria 2124
96 Ga0207659_10003740 3300025926 Bacteria 9176
97 Ga0207706_10056610 3300025933 Bacteria 3456
98 Ga0207686_10207571 3300025934 Bacteria 1406
99 Ga0207709_10231948 3300025935 Unclassified 1338
100 Ga0207670_10100976 3300025936 Bacteria 2061
101 Ga0207669_10008271 3300025937 Bacteria 4875
102 Ga0207669_10029040 3300025937 Bacteria 3052
103 Ga0207669_10061236 3300025937 Bacteria 2312
104 Ga0207691_10017364 3300025940 Bacteria 6826
105 Ga0207691_10037297 3300025940 Bacteria 4502
106 Ga0207691_10081819 3300025940 Bacteria 2902
107 Ga0207691_10177580 3300025940 Bacteria 1862
108 Ga0207661_10000827 3300025944 Bacteria 20291
109 Ga0207651_10091683 3300025960 Bacteria 2226
110 Ga0207712_10132522 3300025961 Unclassified 1901
111 Ga0207658_10142306 3300025986 Bacteria 1943
112 Ga0207703_10382764 3300026035 Bacteria 1302
113 Ga0207678_10026592 3300026067 Bacteria 5047
114 Ga0207708_10236494 3300026075 Bacteria 1468
115 Ga0207641_10197085 3300026088 Bacteria 1854
116 Ga0207675_100090105 3300026118 Unclassified 2883
117 Ga0207675_100166978 3300026118 Bacteria 2102
118 Ga0207683_10109382 3300026121 Bacteria 2474
119 Ga0207683_10209226 3300026121 Bacteria 1775
120 Ga0207683_10224562 3300026121 Bacteria 1712
121 Ga0207428_10002580 3300027907 Bacteria 18089
122 Ga0268266_10048601 3300028379 Bacteria 3637
123 Ga0268266_10159626 3300028379 Bacteria 2039
124 Ga0268265_10030640 3300028380 Bacteria 3877
125 Ga0268265_10046906 3300028380 Unclassified 3233
126 Ga0307408_100014747 3300031548 Bacteria 5195
127 Ga0307408_100352066 3300031548 Bacteria 1250
128 Ga0307405_10014237 3300031731 Unclassified 4271
129 Ga0307409_100017603 3300031995 Bacteria 4771
130 Ga0307416_100010377 3300032002 Bacteria 6149
131 Ga0307411_10127561 3300032005 Unclassified 1853
132 Ga0307415_100048668 3300032126 Unclassified 2862
133 Ga0395905_0235450 3300037471 Bacteria 1712
134 Ga0439449_0093387 3300042007 Unclassified 1111
135 Ga0450923_009899 3300042125 Bacteria 1679
136 Ga0439464_0009182 3300042439 Bacteria 2601
137 Ga0451577_0029598 3300042876 Bacteria 4950
138 Ga0453684_0318268 3300044712 Unclassified 1763
139 Ga0451576_0208714 3300045051 Bacteria 2040
140 Ga0496101_0088201 3300048904 Bacteria 2304
141 Ga0496101_0170387 3300048904 Bacteria 1673
142 Ga0496101_0313174 3300048904 Bacteria 1231
143 Ga0496102_0029802 3300048905 Bacteria 4883
144 Ga0496103_0151442 3300048906 Bacteria 1486
145 Ga0496103_0222592 3300048906 Bacteria 1214
146 Ga0496104_0004948 3300048907 Bacteria 11626
147 Ga0496104_0006152 3300048907 Bacteria 10536
148 Ga0496105_0054485 3300048908 Bacteria 3302
149 Ga0496106_0184644 3300048909 Unclassified 1656
150 Ga0496107_0214702 3300048910 Bacteria 1431
151 Ga0496108_0030346 3300048911 Bacteria 4480
152 Ga0496109_0000257 3300048912 Bacteria 51399
153 Ga0496109_0015018 3300048912 Bacteria 6738
154 Ga0496110_0013764 3300048913 Bacteria 6702
155 Ga0496110_0039145 3300048913 Bacteria 4127
156 Ga0496110_0116359 3300048913 Bacteria 2407
157 Ga0496111_0065399 3300048914 Bacteria 2639
158 Ga0496112_0000175 3300048915 Bacteria 40859
159 Ga0496112_0000571 3300048915 Bacteria 25344
160 Ga0496112_0197446 3300048915 Bacteria 1972
161 Ga0496113_0097428 3300048916 Bacteria 2275
162 Ga0501292_005038 3300049515 Bacteria 1829
163 Ga0501299_004224 3300049522 Unclassified 2132
164 Ga0501299_007061 3300049522 Unclassified 1780
165 Ga0501300_004094 3300049523 Unclassified 2169
166 Ga0501040_0135760 3300049576 Unclassified 1732
167 Ga0501041_0064790 3300049577 Unclassified 2238
168 Ga0501041_0167640 3300049577 Bacteria 1374
169 Ga0501071_0026907 3300049587 Bacteria 4042
170 Ga0501072_0059503 3300049588 Bacteria 3012
171 Ga0501072_0308157 3300049588 Unclassified 1259
172 Ga0501075_0199838 3300049591 Bacteria 1525
173 Ga0501076_0041682 3300049592 Unclassified 3613
174 Ga0501076_0053988 3300049592 Unclassified 3185
175 Ga0501076_0126148 3300049592 Unclassified 2074
176 Ga0501076_0211108 3300049592 Bacteria 1586
177 Ga0501077_0020489 3300049593 Bacteria 4186
178 Ga0501079_0011190 3300049741 Bacteria 6845
179 Ga0501079_0120078 3300049741 Unclassified 2044
180 Ga0501080_0228772 3300049742 Unclassified 1700
181 Ga0501080_0425884 3300049742 Bacteria 1192
182 Ga0501081_0237236 3300049743 Bacteria 1329
183 Ga0501081_0357400 3300049743 Bacteria 1077
184 nmdc:mga05p37_1386_c1 3300050507 Bacteria 28194
185 nmdc:mga05p37_1524_c1 3300050507 Bacteria 26970
186 nmdc:mga05p37_163681_c1 3300050507 Bacteria 2716
187 nmdc:mga05p37_177145_c1 3300050507 Bacteria 2597
188 nmdc:mga05p37_53406_c1 3300050507 Bacteria 4969
189 nmdc:mga09592_203463_c1 3300050508 Unclassified 1715
190 nmdc:mga09592_30145_c1 3300050508 Bacteria 4514
191 nmdc:mga09592_329303_c1 3300050508 Bacteria 1322
192 nmdc:mga09592_35270_c1 3300050508 Bacteria 4187
193 nmdc:mga0qj67_75878_c1 3300050509 Bacteria 2688
194 nmdc:mga0qj67_78542_c1 3300050509 Bacteria 2642
195 nmdc:mga06r32_20444_c1 3300050510 Bacteria 6097
196 nmdc:mga06r32_368466_c1 3300050510 Bacteria 1420
197 nmdc:mga06r32_473395_c1 3300050510 Bacteria 1231
198 nmdc:mga06r32_47707_c1 3300050510 Unclassified 4092
199 nmdc:mga06r32_497238_c1 3300050510 Unclassified 1197
200 nmdc:mga08y16_218283_c1 3300050511 Bacteria 1974
201 nmdc:mga08y16_4666_c1 3300050511 Bacteria 14275
202 nmdc:mga0n895_11161_c1 3300050512 Bacteria 7996
203 Ga0590071_000695 3300059421 Bacteria 9562
204 Ga0590071_013374 3300059421 Bacteria 1921
205 Ga0590074_000432 3300059423 Bacteria 6062
206 Ga0590075_000238 3300059424 Bacteria 15479
207 Ga0590077_000270 3300059426 Bacteria 14724
208 Ga0501082_0240822 3300060353 Unclassified 1574
209 Ga0530510_0277792 3300061734 Unclassified 1251
210 Ga0075428_100103511
211 Ga0065712_10000315
212 Ga0065712_10068874
213 Ga0065712_10072918
214 Ga0065715_10009252
215 Ga0065715_10024579
216 Ga0065715_10088996
217 Ga0070683_100002741
218 Ga0070670_100022381
219 Ga0070670_100067525
220 Ga0070666_10159082
221 Ga0070661_100139801
222 Ga0070669_100201084
223 Ga0070675_100087182
224 Ga0070674_100095739
225 Ga0070673_100289008
226 Ga0070688_100003791
227 Ga0070688_100073519
228 Ga0070667_100077687
229 Ga0070667_100209995
230 Ga0070703_10038211
231 Ga0070694_100031108
232 Ga0070663_100067946
233 Ga0070678_100029687
234 Ga0070678_100230423
235 Ga0070662_100285819
236 Ga0070685_10014795
237 Ga0070684_100000084
238 Ga0070672_100022710
239 Ga0070672_100152519
240 Ga0070672_100260553
241 Ga0070686_100038681
242 Ga0070695_100046603
243 Ga0070693_100008170
244 Ga0070665_100006573
245 Ga0070665_100266243
246 Ga0070664_100000177
247 Ga0068859_100038631
248 Ga0068859_100391614
249 Ga0068864_100026056
250 Ga0068861_100204429
251 Ga0068863_100023104
252 Ga0068858_100339195
253 Ga0068862_100029892
254 Ga0068862_100049326
255 Ga0068862_100283020
256 Ga0068871_100145575
257 Ga0075428_100002508
258 Ga0075428_100392756
259 Ga0075430_100002489
260 Ga0075430_100187522
261 Ga0075431_100004551
262 Ga0075431_100052421
263 Ga0075431_100056680
264 Ga0075431_100399832
265 Ga0075433_10018596
266 Ga0075433_10287312
267 Ga0075434_100002153
268 Ga0075429_100005533
269 Ga0075429_100028384
270 Ga0075429_100051692
271 Ga0075429_100216784
272 Ga0075429_100376551
273 Ga0097620_100038629
274 Ga0097620_100391619
275 Ga0075435_100205476
276 Ga0111539_10000740
277 Ga0111539_10063699
278 Ga0111539_10185576
279 Ga0111539_10224723
280 Ga0114129_10000186
281 Ga0114129_10001901
282 Ga0114129_10015389
283 Ga0114129_10030391
284 Ga0114129_10052394
285 Ga0114129_10106942
286 Ga0105242_10140109
287 Ga0105248_10073864
288 Ga0105248_10191839
289 Ga0105249_10046155
290 Ga0105249_10048430
291 Ga0105249_10227724
292 Ga0157374_10008431
293 Ga0157375_10040412
294 Ga0163163_10032379
295 Ga0157380_10080872
296 Ga0157380_10186550
297 Ga0157380_10202529
298 Ga0157377_10069955
299 Ga0207688_10002737
300 Ga0207649_10035571
301 Ga0207681_10033878
302 Ga0207681_10106740
303 Ga0207650_10024246
304 Ga0207650_10110904
305 Ga0207659_10003740
306 Ga0207706_10056610
307 Ga0207686_10207571
308 Ga0207709_10231948
309 Ga0207670_10100976
310 Ga0207669_10008271
311 Ga0207669_10029040
312 Ga0207669_10061236
313 Ga0207691_10017364
314 Ga0207691_10037297
315 Ga0207691_10081819
316 Ga0207691_10177580
317 Ga0207661_10000827
318 Ga0207651_10091683
319 Ga0207712_10132522
320 Ga0207658_10142306
321 Ga0207703_10382764
322 Ga0207678_10026592
323 Ga0207708_10236494
324 Ga0207641_10197085
325 Ga0207675_100090105
326 Ga0207675_100166978
327 Ga0207683_10109382
328 Ga0207683_10209226
329 Ga0207683_10224562
330 Ga0207428_10002580
331 Ga0268266_10048601
332 Ga0268266_10159626
333 Ga0268265_10030640
334 Ga0268265_10046906
335 Ga0307408_100014747
336 Ga0307408_100352066
337 Ga0307405_10014237
338 Ga0307409_100017603
339 Ga0307416_100010377
340 Ga0307411_10127561
341 Ga0307415_100048668
342 Ga0395905_0235450
343 Ga0439449_0093387
344 Ga0450923_009899
345 Ga0439464_0009182
346 Ga0451577_0029598
347 Ga0453684_0318268
348 Ga0451576_0208714
349 Ga0496101_0088201
350 Ga0496101_0170387
351 Ga0496101_0313174
352 Ga0496102_0029802
353 Ga0496103_0151442
354 Ga0496103_0222592
355 Ga0496104_0004948
356 Ga0496104_0006152
357 Ga0496105_0054485
358 Ga0496106_0184644
359 Ga0496107_0214702
360 Ga0496108_0030346
361 Ga0496109_0000257
362 Ga0496109_0015018
363 Ga0496110_0013764
364 Ga0496110_0039145
365 Ga0496110_0116359
366 Ga0496111_0065399
367 Ga0496112_0000175
368 Ga0496112_0000571
369 Ga0496112_0197446
370 Ga0496113_0097428
371 Ga0501292_005038
372 Ga0501299_004224
373 Ga0501299_007061
374 Ga0501300_004094
375 Ga0501040_0135760
376 Ga0501041_0064790
377 Ga0501041_0167640
378 Ga0501071_0026907
379 Ga0501072_0059503
380 Ga0501072_0308157
381 Ga0501075_0199838
382 Ga0501076_0041682
383 Ga0501076_0053988
384 Ga0501076_0126148
385 Ga0501076_0211108
386 Ga0501077_0020489
387 Ga0501079_0011190
388 Ga0501079_0120078
389 Ga0501080_0228772
390 Ga0501080_0425884
391 Ga0501081_0237236
392 Ga0501081_0357400
393 nmdc:mga05p37_1386_c1
394 nmdc:mga05p37_1524_c1
395 nmdc:mga05p37_163681_c1
396 nmdc:mga05p37_177145_c1
397 nmdc:mga05p37_53406_c1
398 nmdc:mga09592_203463_c1
399 nmdc:mga09592_30145_c1
400 nmdc:mga09592_329303_c1
401 nmdc:mga09592_35270_c1
402 nmdc:mga0qj67_75878_c1
403 nmdc:mga0qj67_78542_c1
404 nmdc:mga06r32_20444_c1
405 nmdc:mga06r32_368466_c1
406 nmdc:mga06r32_473395_c1
407 nmdc:mga06r32_47707_c1
408 nmdc:mga06r32_497238_c1
409 nmdc:mga08y16_218283_c1
410 nmdc:mga08y16_4666_c1
411 nmdc:mga0n895_11161_c1
412 Ga0590071_000695
413 Ga0590071_013374
414 Ga0590074_000432
415 Ga0590075_000238
416 Ga0590077_000270
417 Ga0501082_0240822
418 Ga0530510_0277792

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

168

330

0.96

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

176

316

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8724 177 336
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8673 177 336
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8556 170 334
2f9f-assembly1.cif.gz_A crystal structure of the putative mannosyl transferase (wbaz-1)from archaeoglobus fulgidus, northeast structural genomics target gr29a. 0.8523 170 334
2bfw-assembly1.cif.gz_A structure of the c domain of glycogen synthase from pyrococcus abyssi 0.8474 179 336
ID Description Score Start End Superfamily
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9412 179 334 3.40.50.2000
af_P9WMZ3_200_365_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9217 181 336 3.40.50.2000
af_F4IBV4_205_380_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9179 175 336 3.40.50.2000
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9179 179 334 3.40.50.2000
af_P96407_190_356_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9154 174 332 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A538G9T2-F1-model_v4 Glycosyltransferase 0.9659 125 345 GO:0016758
AF-A0A2V8C5X4-F1-model_v4 Glycosyl transferase family 1 0.9508 171 321 GO:0016757
AF-A0A538G9T2-F1-model_v4 Glycosyltransferase 0.9325 125 345 GO:0016758
AF-A0A538LKC2-F1-model_v4 Glycosyltransferase 0.9312 186 349 GO:0016757
AF-A0A538LKC2-F1-model_v4 Glycosyltransferase 0.9256 186 349 GO:0016757

Map