F318949

General Info

Members Datasets Scaffolds Average Seq Length
209 116 418 176

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100041921|Ga0075428_1000419212
Length 185
Sequence MRIIAGEWRGRPLLAPPGRATRPTADRVRETLFSMLASRLGSFEDLRVADLFAGSGALGFEALSRGAATATFVDRDPAAAAAIRANAAKLGASDRVTILGGSALALPKAEPFDLLFADPPYTAGSGTAALRAVLAAGWLAPGGWISVETARGDPVEPGDLVLETERVVGRARLWLLRRPSPSPPS

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
94 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
101 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
102 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
103 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
106 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 2.87
Rhizosphere 96.65
Stem 0
Stem Tuber 0
Unclassified 0.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100041921 3300006844 Bacteria 5033
2 Ga0070658_10003372 3300005327 Bacteria 13158
3 Ga0070658_10494159 3300005327 Bacteria 1056
4 Ga0070658_10709083 3300005327 Bacteria 873
5 Ga0070658_10792359 3300005327 Bacteria 823
6 Ga0070676_10048579 3300005328 Bacteria 2481
7 Ga0070683_100061392 3300005329 Bacteria 3495
8 Ga0070683_100116143 3300005329 Bacteria 2526
9 Ga0070683_100349700 3300005329 Unclassified 1408
10 Ga0070690_100194131 3300005330 Bacteria 1409
11 Ga0070680_100518324 3300005336 Bacteria 1020
12 Ga0070660_100113638 3300005339 Bacteria 2156
13 Ga0070660_100134656 3300005339 Bacteria 1979
14 Ga0070660_100151643 3300005339 Bacteria 1864
15 Ga0070660_100268134 3300005339 Bacteria 1395
16 Ga0070660_100631528 3300005339 Bacteria 896
17 Ga0070660_100631529 3300005339 Bacteria 896
18 Ga0070661_100119324 3300005344 Bacteria 1974
19 Ga0070661_100387769 3300005344 Bacteria 1102
20 Ga0070661_100899939 3300005344 Bacteria 730
21 Ga0070692_10013191 3300005345 Bacteria 3847
22 Ga0070668_100008256 3300005347 Bacteria 7729
23 Ga0070668_100943339 3300005347 Bacteria 773
24 Ga0070671_100397572 3300005355 Bacteria 1179
25 Ga0070659_100055905 3300005366 Bacteria 3111
26 Ga0070659_100169011 3300005366 Bacteria 1790
27 Ga0070659_100362791 3300005366 Bacteria 1217
28 Ga0070667_100131762 3300005367 Bacteria 2183
29 Ga0070663_100116321 3300005455 Bacteria 2015
30 Ga0070662_100117370 3300005457 Bacteria 2035
31 Ga0070662_100170764 3300005457 Bacteria 1708
32 Ga0068867_100019160 3300005459 Bacteria 4874
33 Ga0070679_100185913 3300005530 Bacteria 2048
34 Ga0070684_100011961 3300005535 Bacteria 6932
35 Ga0068853_100017452 3300005539 Bacteria 5923
36 Ga0070693_100712350 3300005547 Bacteria 736
37 Ga0068855_100234009 3300005563 Bacteria 2055
38 Ga0068855_100235581 3300005563 Bacteria 2047
39 Ga0068855_100302010 3300005563 Bacteria 1773
40 Ga0068855_100454121 3300005563 Bacteria 1398
41 Ga0070664_100012144 3300005564 Bacteria 6995
42 Ga0068854_100008611 3300005578 Bacteria 6569
43 Ga0068854_100190066 3300005578 Bacteria 1608
44 Ga0068856_100090507 3300005614 Bacteria 3043
45 Ga0068856_100495535 3300005614 Bacteria 1243
46 Ga0068852_100002819 3300005616 Bacteria 12045
47 Ga0068852_100196163 3300005616 Bacteria 1908
48 Ga0068852_100265220 3300005616 Bacteria 1650
49 Ga0068852_100327002 3300005616 Bacteria 1490
50 Ga0068861_100275864 3300005719 Bacteria 1446
51 Ga0068851_10033747 3300005834 Bacteria 2552
52 Ga0068863_100207560 3300005841 Bacteria 1886
53 Ga0068860_100101308 3300005843 Bacteria 2748
54 Ga0068862_100137692 3300005844 Bacteria 2165
55 Ga0068862_101061710 3300005844 Bacteria 803
56 Ga0081539_10194946 3300005985 Unclassified 940
57 Ga0075366_10054747 3300006195 Bacteria 2369
58 Ga0097620_100039138 3300006931 Bacteria 4756
59 Ga0105243_10103754 3300009148 Bacteria 2365
60 Ga0105248_10029071 3300009177 Bacteria 6163
61 Ga0105248_10401469 3300009177 Bacteria 1543
62 Ga0105238_10082853 3300009551 Bacteria 3197
63 Ga0157373_10012059 3300013100 Bacteria 6352
64 Ga0157373_10186707 3300013100 Bacteria 1460
65 Ga0157373_10426188 3300013100 Bacteria 953
66 Ga0157371_10005962 3300013102 Bacteria 10165
67 Ga0157371_10082227 3300013102 Bacteria 2280
68 Ga0157371_10289771 3300013102 Bacteria 1183
69 Ga0157370_10218915 3300013104 Bacteria 1764
70 Ga0157369_10006276 3300013105 Bacteria 13799
71 Ga0157369_10113168 3300013105 Bacteria 2883
72 Ga0157369_10871301 3300013105 Bacteria 924
73 Ga0157372_10167257 3300013307 Bacteria 2543
74 Ga0157372_10226363 3300013307 Bacteria 2168
75 Ga0157379_10274175 3300014968 Bacteria 1534
76 Ga0206354_10536384 3300020081 Bacteria 1297
77 Ga0206353_11672233 3300020082 Bacteria 753
78 Ga0207656_10039430 3300025321 Bacteria 1998
79 Ga0207647_10366726 3300025904 Bacteria 814
80 Ga0207645_10029264 3300025907 Bacteria 3552
81 Ga0207705_10032193 3300025909 Bacteria 3746
82 Ga0207705_10080037 3300025909 Bacteria 2380
83 Ga0207705_10460636 3300025909 Bacteria 986
84 Ga0207705_10819188 3300025909 Bacteria 722
85 Ga0207707_10384971 3300025912 Bacteria 1205
86 Ga0207660_10145117 3300025917 Bacteria 1818
87 Ga0207660_10300320 3300025917 Bacteria 1278
88 Ga0207660_10959424 3300025917 Bacteria 698
89 Ga0207657_10004683 3300025919 Bacteria 14443
90 Ga0207657_10017421 3300025919 Bacteria 6888
91 Ga0207657_10086924 3300025919 Bacteria 2616
92 Ga0207657_10104962 3300025919 Bacteria 2340
93 Ga0207657_10697574 3300025919 Bacteria 788
94 Ga0207649_10274359 3300025920 Bacteria 1223
95 Ga0207649_10494022 3300025920 Bacteria 930
96 Ga0207649_10552809 3300025920 Bacteria 881
97 Ga0207649_11136237 3300025920 Bacteria 617
98 Ga0207652_10062544 3300025921 Bacteria 3216
99 Ga0207652_10533530 3300025921 Bacteria 1055
100 Ga0207652_10543764 3300025921 Bacteria 1044
101 Ga0207652_11417137 3300025921 Bacteria 598
102 Ga0207681_10051500 3300025923 Bacteria 2790
103 Ga0207664_10782700 3300025929 Bacteria 858
104 Ga0207690_10024211 3300025932 Bacteria 3800
105 Ga0207690_10061664 3300025932 Bacteria 2550
106 Ga0207690_10064008 3300025932 Bacteria 2509
107 Ga0207706_10012411 3300025933 Bacteria 7763
108 Ga0207709_10087453 3300025935 Bacteria 2026
109 Ga0207711_10270130 3300025941 Bacteria 1564
110 Ga0207661_10292718 3300025944 Bacteria 1458
111 Ga0207661_10689281 3300025944 Bacteria 939
112 Ga0207679_10002345 3300025945 Bacteria 11650
113 Ga0207667_10429788 3300025949 Bacteria 1343
114 Ga0207668_10396297 3300025972 Bacteria 1166
115 Ga0207640_10027156 3300025981 Bacteria 3485
116 Ga0207640_10313028 3300025981 Bacteria 1247
117 Ga0207658_10224744 3300025986 Bacteria 1581
118 Ga0207677_10492642 3300026023 Bacteria 1058
119 Ga0207678_10110512 3300026067 Bacteria 2345
120 Ga0207678_10137530 3300026067 Bacteria 2084
121 Ga0207678_10147051 3300026067 Bacteria 2011
122 Ga0207702_10069235 3300026078 Bacteria 3033
123 Ga0207702_10509798 3300026078 Bacteria 1173
124 Ga0207641_10233238 3300026088 Bacteria 1711
125 Ga0207648_10017010 3300026089 Bacteria 6627
126 Ga0207674_10474847 3300026116 Bacteria 1209
127 Ga0207675_100227151 3300026118 Bacteria 1800
128 Ga0207698_10000336 3300026142 Bacteria 27862
129 Ga0207698_10604408 3300026142 Bacteria 1082
130 Ga0207698_10926818 3300026142 Bacteria 879
131 Ga0207698_11259942 3300026142 Bacteria 754
132 Ga0268265_10100860 3300028380 Bacteria 2331
133 Ga0268265_10213577 3300028380 Bacteria 1683
134 Ga0268265_10268775 3300028380 Bacteria 1520
135 Ga0268264_10090305 3300028381 Bacteria 2640
136 Ga0307408_100011314 3300031548 Bacteria 5896
137 Ga0307408_100033080 3300031548 Bacteria 3609
138 Ga0307405_10068176 3300031731 Bacteria 2276
139 Ga0307405_10285147 3300031731 Bacteria 1245
140 Ga0307405_10814846 3300031731 Bacteria 783
141 Ga0307413_10081434 3300031824 Bacteria 2075
142 Ga0307413_10820496 3300031824 Bacteria 783
143 Ga0307410_10021287 3300031852 Bacteria 3985
144 Ga0307410_10119513 3300031852 Bacteria 1919
145 Ga0307410_10150402 3300031852 Bacteria 1733
146 Ga0307410_10772848 3300031852 Bacteria 815
147 Ga0307412_10016413 3300031911 Bacteria 4411
148 Ga0307409_100531772 3300031995 Bacteria 1150
149 Ga0307416_100016566 3300032002 Bacteria 5128
150 Ga0307416_100688366 3300032002 Bacteria 1110
151 Ga0307414_10098541 3300032004 Bacteria 2193
152 Ga0307414_10509659 3300032004 Bacteria 1066
153 Ga0307411_10079354 3300032005 Bacteria 2253
154 Ga0307411_10396002 3300032005 Bacteria 1140
155 Ga0307411_10713611 3300032005 Bacteria 875
156 Ga0307415_100020590 3300032126 Bacteria 4031
157 Ga0307415_100096574 3300032126 Bacteria 2154
158 Ga0307415_100571035 3300032126 Bacteria 1001
159 Ga0373960_0201456 3300035121 Bacteria 704
160 Ga0373937_0132127 3300036401 Bacteria 2332
161 Ga0395899_0020515 3300037312 Bacteria 5009
162 Ga0395899_0062721 3300037312 Bacteria 2736
163 Ga0395899_0325234 3300037312 Bacteria 1034
164 Ga0395900_0010494 3300037418 Bacteria 9474
165 Ga0395900_0144812 3300037418 Bacteria 2430
166 Ga0395900_0177681 3300037418 Bacteria 2165
167 Ga0395900_0453625 3300037418 Bacteria 1238
168 Ga0395900_0616024 3300037418 Bacteria 1025
169 Ga0395898_0318227 3300037466 Bacteria 1484
170 Ga0395898_0645978 3300037466 Bacteria 1000
171 Ga0395905_0010965 3300037471 Bacteria 8772
172 Ga0395905_0061642 3300037471 Bacteria 3509
173 Ga0395905_0062703 3300037471 Bacteria 3477
174 Ga0395905_0129166 3300037471 Bacteria 2376
175 Ga0395905_0619078 3300037471 Bacteria 984
176 Ga0395905_0648481 3300037471 Bacteria 958
177 Ga0395905_0897124 3300037471 Bacteria 789
178 Ga0395901_0005517 3300038443 Bacteria 12810
179 Ga0395901_0034945 3300038443 Bacteria 5193
180 Ga0395901_0167559 3300038443 Bacteria 2306
181 Ga0439458_0004104 3300042157 Bacteria 3362
182 Ga0466971_0068948 3300044719 Bacteria 1604
183 Ga0466970_0104661 3300044765 Bacteria 1543
184 Ga0466957_0000183 3300044842 Bacteria 28401
185 Ga0466957_0513892 3300044842 Bacteria 832
186 Ga0466959_0020858 3300045049 Bacteria 4828
187 Ga0466958_0002401 3300045836 Bacteria 9381
188 Ga0466967_0011416 3300045976 Bacteria 6726
189 Ga0466967_0017911 3300045976 Bacteria 5644
190 Ga0466967_0036647 3300045976 Bacteria 4189
191 Ga0466967_0141568 3300045976 Bacteria 2240
192 Ga0466967_0533596 3300045976 Bacteria 1154
193 Ga0495617_143355 3300046452 Bacteria 762
194 Ga0495663_0007056 3300046525 Bacteria 3101
195 Ga0495598_0000383 3300046537 Bacteria 7958
196 Ga0495621_0000472 3300046539 Bacteria 9904
197 Ga0495633_0008182 3300046558 Bacteria 5921
198 Ga0495661_0030829 3300046665 Bacteria 3411
199 Ga0495669_0001960 3300046684 Bacteria 8453
200 Ga0495670_0015568 3300046691 Bacteria 3736
201 Ga0495677_0004140 3300047445 Bacteria 5598
202 Ga0496100_0081578 3300048903 Bacteria 2185
203 Ga0496105_0246181 3300048908 Bacteria 1450
204 Ga0496106_0307732 3300048909 Bacteria 1271
205 Ga0496107_0007050 3300048910 Bacteria 7742
206 Ga0496112_0268154 3300048915 Bacteria 1656
207 Ga0496114_0021020 3300048917 Bacteria 5303
208 nmdc:mga0n895_163642_c1 3300050512 Bacteria 2256
209 Ga0466962_0109482 3300061719 Bacteria 1330
210 Ga0075428_100041921
211 Ga0070658_10003372
212 Ga0070658_10494159
213 Ga0070658_10709083
214 Ga0070658_10792359
215 Ga0070676_10048579
216 Ga0070683_100061392
217 Ga0070683_100116143
218 Ga0070683_100349700
219 Ga0070690_100194131
220 Ga0070680_100518324
221 Ga0070660_100113638
222 Ga0070660_100134656
223 Ga0070660_100151643
224 Ga0070660_100268134
225 Ga0070660_100631528
226 Ga0070660_100631529
227 Ga0070661_100119324
228 Ga0070661_100387769
229 Ga0070661_100899939
230 Ga0070692_10013191
231 Ga0070668_100008256
232 Ga0070668_100943339
233 Ga0070671_100397572
234 Ga0070659_100055905
235 Ga0070659_100169011
236 Ga0070659_100362791
237 Ga0070667_100131762
238 Ga0070663_100116321
239 Ga0070662_100117370
240 Ga0070662_100170764
241 Ga0068867_100019160
242 Ga0070679_100185913
243 Ga0070684_100011961
244 Ga0068853_100017452
245 Ga0070693_100712350
246 Ga0068855_100234009
247 Ga0068855_100235581
248 Ga0068855_100302010
249 Ga0068855_100454121
250 Ga0070664_100012144
251 Ga0068854_100008611
252 Ga0068854_100190066
253 Ga0068856_100090507
254 Ga0068856_100495535
255 Ga0068852_100002819
256 Ga0068852_100196163
257 Ga0068852_100265220
258 Ga0068852_100327002
259 Ga0068861_100275864
260 Ga0068851_10033747
261 Ga0068863_100207560
262 Ga0068860_100101308
263 Ga0068862_100137692
264 Ga0068862_101061710
265 Ga0081539_10194946
266 Ga0075366_10054747
267 Ga0097620_100039138
268 Ga0105243_10103754
269 Ga0105248_10029071
270 Ga0105248_10401469
271 Ga0105238_10082853
272 Ga0157373_10012059
273 Ga0157373_10186707
274 Ga0157373_10426188
275 Ga0157371_10005962
276 Ga0157371_10082227
277 Ga0157371_10289771
278 Ga0157370_10218915
279 Ga0157369_10006276
280 Ga0157369_10113168
281 Ga0157369_10871301
282 Ga0157372_10167257
283 Ga0157372_10226363
284 Ga0157379_10274175
285 Ga0206354_10536384
286 Ga0206353_11672233
287 Ga0207656_10039430
288 Ga0207647_10366726
289 Ga0207645_10029264
290 Ga0207705_10032193
291 Ga0207705_10080037
292 Ga0207705_10460636
293 Ga0207705_10819188
294 Ga0207707_10384971
295 Ga0207660_10145117
296 Ga0207660_10300320
297 Ga0207660_10959424
298 Ga0207657_10004683
299 Ga0207657_10017421
300 Ga0207657_10086924
301 Ga0207657_10104962
302 Ga0207657_10697574
303 Ga0207649_10274359
304 Ga0207649_10494022
305 Ga0207649_10552809
306 Ga0207649_11136237
307 Ga0207652_10062544
308 Ga0207652_10533530
309 Ga0207652_10543764
310 Ga0207652_11417137
311 Ga0207681_10051500
312 Ga0207664_10782700
313 Ga0207690_10024211
314 Ga0207690_10061664
315 Ga0207690_10064008
316 Ga0207706_10012411
317 Ga0207709_10087453
318 Ga0207711_10270130
319 Ga0207661_10292718
320 Ga0207661_10689281
321 Ga0207679_10002345
322 Ga0207667_10429788
323 Ga0207668_10396297
324 Ga0207640_10027156
325 Ga0207640_10313028
326 Ga0207658_10224744
327 Ga0207677_10492642
328 Ga0207678_10110512
329 Ga0207678_10137530
330 Ga0207678_10147051
331 Ga0207702_10069235
332 Ga0207702_10509798
333 Ga0207641_10233238
334 Ga0207648_10017010
335 Ga0207674_10474847
336 Ga0207675_100227151
337 Ga0207698_10000336
338 Ga0207698_10604408
339 Ga0207698_10926818
340 Ga0207698_11259942
341 Ga0268265_10100860
342 Ga0268265_10213577
343 Ga0268265_10268775
344 Ga0268264_10090305
345 Ga0307408_100011314
346 Ga0307408_100033080
347 Ga0307405_10068176
348 Ga0307405_10285147
349 Ga0307405_10814846
350 Ga0307413_10081434
351 Ga0307413_10820496
352 Ga0307410_10021287
353 Ga0307410_10119513
354 Ga0307410_10150402
355 Ga0307410_10772848
356 Ga0307412_10016413
357 Ga0307409_100531772
358 Ga0307416_100016566
359 Ga0307416_100688366
360 Ga0307414_10098541
361 Ga0307414_10509659
362 Ga0307411_10079354
363 Ga0307411_10396002
364 Ga0307411_10713611
365 Ga0307415_100020590
366 Ga0307415_100096574
367 Ga0307415_100571035
368 Ga0373960_0201456
369 Ga0373937_0132127
370 Ga0395899_0020515
371 Ga0395899_0062721
372 Ga0395899_0325234
373 Ga0395900_0010494
374 Ga0395900_0144812
375 Ga0395900_0177681
376 Ga0395900_0453625
377 Ga0395900_0616024
378 Ga0395898_0318227
379 Ga0395898_0645978
380 Ga0395905_0010965
381 Ga0395905_0061642
382 Ga0395905_0062703
383 Ga0395905_0129166
384 Ga0395905_0619078
385 Ga0395905_0648481
386 Ga0395905_0897124
387 Ga0395901_0005517
388 Ga0395901_0034945
389 Ga0395901_0167559
390 Ga0439458_0004104
391 Ga0466971_0068948
392 Ga0466970_0104661
393 Ga0466957_0000183
394 Ga0466957_0513892
395 Ga0466959_0020858
396 Ga0466958_0002401
397 Ga0466967_0011416
398 Ga0466967_0017911
399 Ga0466967_0036647
400 Ga0466967_0141568
401 Ga0466967_0533596
402 Ga0495617_143355
403 Ga0495663_0007056
404 Ga0495598_0000383
405 Ga0495621_0000472
406 Ga0495633_0008182
407 Ga0495661_0030829
408 Ga0495669_0001960
409 Ga0495670_0015568
410 Ga0495677_0004140
411 Ga0496100_0081578
412 Ga0496105_0246181
413 Ga0496106_0307732
414 Ga0496107_0007050
415 Ga0496112_0268154
416 Ga0496114_0021020
417 nmdc:mga0n895_163642_c1
418 Ga0466962_0109482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

1

177

0.93

PF13649

Methyltransf_25

Methyltransferase domain

48

143

0.84

PF05175

MTS

Methyltransferase small domain

15

161

0.82

PF13847

Methyltransf_31

Methyltransferase domain

42

166

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m1c-assembly1.cif.gz_A crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions 0.912 1 176
6m1c-assembly1.cif.gz_A crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions 0.9023 1 176
3p9n-assembly1.cif.gz_A rv2966c of m. tuberculosis is a rsmd-like methyltransferase 0.9019 1 177
3p9n-assembly1.cif.gz_A rv2966c of m. tuberculosis is a rsmd-like methyltransferase 0.8971 1 177
2fpo-assembly6.cif.gz_F putative methyltransferase yhhf from escherichia coli. 0.887 1 176
ID Description Score Start End Superfamily
af_Q8ILX8_228_372_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9269 46 99 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9172 44 101 3.40.50.150
af_A0A0R0EHR2_116_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.917 1 176 3.40.50.150
af_A0A0R0EHR2_116_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9073 1 176 3.40.50.150
6aieC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9059 1 177 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7X6BG87-F1-model_v4 16S rRNA (Guanine966-N2)-methyltransferase (EC 2.1.1.171) 0.9901 1 174 GO:0003676
GO:0052913
AF-A0A2H0QLI4-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.968 1 174 GO:0003676
GO:0008168
GO:0031167
AF-A0A530AQ03-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9611 1 104 GO:0008168
GO:0031167
AF-A0A090GDB4-F1-model_v4 Methyltransferase 0.957 1 177 GO:0003676
GO:0008168
GO:0031167
AF-A0A2H0QLI4-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9519 1 174 GO:0003676
GO:0008168
GO:0031167

Map