F318689

General Info

Members Datasets Scaffolds Average Seq Length
209 115 418 167

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100154479|Ga0070670_1001544791
Length 174
Sequence MSESQSAEEKRKSRLRWVTLGESIAISALVVSAVGVWISWKDGDKPSGPTKIVEERQAVPLALRGKVEDEGKSLEIAPANSDHALQSLNVIIGSNSVVDVGSSGEMSASDFERALGDKAADGKGVNRVRVRIDAKYLDGGTDKSASGSYVIAYKWEGGGLFGGRSLRFTGLTRG

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
106 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
107 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.31
Rhizosphere 95.69
Stem 0
Stem Tuber 0
Unclassified 5.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100154479 3300005331 Bacteria 1987
2 MRS1b_contig_2461418 2162886011 Bacteria 819
3 JGI24739J22299_10004359 3300001989 Bacteria 5421
4 JGI24737J22298_10015047 3300001990 Bacteria 2505
5 JGI24735J21928_10008273 3300002067 Bacteria 3370
6 JGI24738J21930_10007357 3300002075 Bacteria 2544
7 Ga0070658_10018933 3300005327 Bacteria 5515
8 Ga0070658_10484358 3300005327 Bacteria 1068
9 Ga0070658_11126563 3300005327 Bacteria 682
10 Ga0070676_10098108 3300005328 Bacteria 1806
11 Ga0070676_10113152 3300005328 Bacteria 1693
12 Ga0070676_10324847 3300005328 Bacteria 1050
13 Ga0070683_100009797 3300005329 Bacteria 8209
14 Ga0070683_100011024 3300005329 Bacteria 7791
15 Ga0070670_100025540 3300005331 Bacteria 5081
16 Ga0070670_100582957 3300005331 Bacteria 1000
17 Ga0070666_10011770 3300005335 Bacteria 5501
18 Ga0070682_100395580 3300005337 Bacteria 1043
19 Ga0070660_100015476 3300005339 Bacteria 5510
20 Ga0070689_100590552 3300005340 Bacteria 961
21 Ga0070661_100050620 3300005344 Bacteria 3040
22 Ga0070668_100178340 3300005347 Bacteria 1734
23 Ga0070668_100612012 3300005347 Bacteria 954
24 Ga0070668_101156320 3300005347 Unclassified 700
25 Ga0070669_100007604 3300005353 Bacteria 7747
26 Ga0070669_100237650 3300005353 Bacteria 1446
27 Ga0070669_100633984 3300005353 Bacteria 898
28 Ga0070675_100473054 3300005354 Bacteria 1126
29 Ga0070671_100101612 3300005355 Bacteria 2412
30 Ga0070674_100799261 3300005356 Bacteria 814
31 Ga0070673_100049443 3300005364 Bacteria 3283
32 Ga0070673_100846676 3300005364 Bacteria 846
33 Ga0070688_100680541 3300005365 Bacteria 795
34 Ga0070659_100017538 3300005366 Bacteria 5392
35 Ga0070659_100528587 3300005366 Bacteria 1008
36 Ga0070659_100566557 3300005366 Bacteria 973
37 Ga0070659_100822366 3300005366 Bacteria 809
38 Ga0070667_100006814 3300005367 Bacteria 9490
39 Ga0070667_100058669 3300005367 Bacteria 3254
40 Ga0070667_100312732 3300005367 Bacteria 1416
41 Ga0070667_100420517 3300005367 Bacteria 1218
42 Ga0070667_100634692 3300005367 Bacteria 986
43 Ga0070713_100366987 3300005436 Unclassified 1339
44 Ga0070663_100456822 3300005455 Bacteria 1054
45 Ga0070662_100020005 3300005457 Bacteria 4555
46 Ga0070662_100071838 3300005457 Bacteria 2553
47 Ga0070662_100212517 3300005457 Bacteria 1540
48 Ga0070662_100215593 3300005457 Unclassified 1529
49 Ga0070685_10627078 3300005466 Unclassified 776
50 Ga0070679_100295697 3300005530 Bacteria 1570
51 Ga0070684_100350671 3300005535 Bacteria 1357
52 Ga0068853_100564807 3300005539 Bacteria 1079
53 Ga0068853_100713200 3300005539 Bacteria 957
54 Ga0070672_100090655 3300005543 Bacteria 2466
55 Ga0070665_100021397 3300005548 Bacteria 6505
56 Ga0070665_100118761 3300005548 Bacteria 2646
57 Ga0070665_100456244 3300005548 Bacteria 1288
58 Ga0070665_100614327 3300005548 Unclassified 1100
59 Ga0070665_100965436 3300005548 Unclassified 865
60 Ga0070664_100018669 3300005564 Bacteria 5702
61 Ga0068857_100024467 3300005577 Bacteria 5316
62 Ga0068854_100104612 3300005578 Bacteria 2127
63 Ga0068856_100298860 3300005614 Bacteria 1627
64 Ga0068852_100977942 3300005616 Bacteria 865
65 Ga0068864_100651825 3300005618 Bacteria 1025
66 Ga0068851_10120452 3300005834 Bacteria 1410
67 Ga0068862_100107917 3300005844 Unclassified 2441
68 Ga0081539_10044982 3300005985 Bacteria 2543
69 Ga0097621_100121123 3300006237 Bacteria 2219
70 Ga0068871_100090870 3300006358 Bacteria 2543
71 Ga0068865_100250703 3300006881 Bacteria 1397
72 Ga0105242_10401620 3300009176 Bacteria 1279
73 Ga0105248_10061186 3300009177 Bacteria 4227
74 Ga0157373_10139561 3300013100 Bacteria 1704
75 Ga0157371_10009970 3300013102 Bacteria 7435
76 Ga0157371_10222968 3300013102 Bacteria 1354
77 Ga0157371_10820369 3300013102 Bacteria 702
78 Ga0157370_10127691 3300013104 Bacteria 2373
79 Ga0157372_10088049 3300013307 Bacteria 3525
80 Ga0157372_10751272 3300013307 Bacteria 1134
81 Ga0157375_10080742 3300013308 Bacteria 3291
82 Ga0157375_11170638 3300013308 Bacteria 901
83 Ga0163163_10363278 3300014325 Bacteria 1504
84 Ga0207647_10023563 3300025904 Bacteria 4070
85 Ga0207645_10092650 3300025907 Bacteria 1944
86 Ga0207705_10255826 3300025909 Bacteria 1336
87 Ga0207705_10689484 3300025909 Bacteria 794
88 Ga0207660_11148033 3300025917 Bacteria 633
89 Ga0207657_10009585 3300025919 Bacteria 9721
90 Ga0207657_10073895 3300025919 Bacteria 2880
91 Ga0207657_10164551 3300025919 Bacteria 1800
92 Ga0207657_10165723 3300025919 Bacteria 1792
93 Ga0207681_10358500 3300025923 Bacteria 1169
94 Ga0207650_10030799 3300025925 Bacteria 3869
95 Ga0207650_10042797 3300025925 Bacteria 3323
96 Ga0207659_10083823 3300025926 Bacteria 2364
97 Ga0207700_10249997 3300025928 Unclassified 1514
98 Ga0207664_10040509 3300025929 Bacteria 3623
99 Ga0207644_10115709 3300025931 Bacteria 2034
100 Ga0207644_10769129 3300025931 Bacteria 805
101 Ga0207690_10069292 3300025932 Bacteria 2426
102 Ga0207690_11045022 3300025932 Bacteria 680
103 Ga0207706_10270297 3300025933 Bacteria 1483
104 Ga0207706_10274632 3300025933 Bacteria 1470
105 Ga0207706_10442703 3300025933 Bacteria 1125
106 Ga0207669_11108527 3300025937 Unclassified 668
107 Ga0207691_10100221 3300025940 Bacteria 2585
108 Ga0207661_10313638 3300025944 Bacteria 1408
109 Ga0207679_10025811 3300025945 Bacteria 4046
110 Ga0207667_11667815 3300025949 Bacteria 605
111 Ga0207640_10593917 3300025981 Bacteria 936
112 Ga0207640_11317095 3300025981 Bacteria 645
113 Ga0207658_10020720 3300025986 Bacteria 4554
114 Ga0207658_10080230 3300025986 Bacteria 2499
115 Ga0207658_10322326 3300025986 Unclassified 1338
116 Ga0207658_10535965 3300025986 Bacteria 1046
117 Ga0207639_10675620 3300026041 Bacteria 957
118 Ga0207639_10717067 3300026041 Bacteria 928
119 Ga0207639_11636404 3300026041 Bacteria 604
120 Ga0207639_11899969 3300026041 Bacteria 556
121 Ga0207678_10004608 3300026067 Bacteria 12388
122 Ga0207678_10011950 3300026067 Bacteria 7623
123 Ga0207678_10046457 3300026067 Bacteria 3754
124 Ga0207676_10331737 3300026095 Bacteria 1400
125 Ga0207698_10061580 3300026142 Bacteria 2925
126 Ga0268266_10283386 3300028379 Bacteria 1541
127 Ga0268266_10441059 3300028379 Bacteria 1237
128 Ga0268266_10491419 3300028379 Bacteria 1171
129 Ga0268265_10127154 3300028380 Unclassified 2111
130 Ga0307405_10425317 3300031731 Bacteria 1046
131 Ga0307405_10575581 3300031731 Unclassified 915
132 Ga0307413_10004288 3300031824 Bacteria 6181
133 Ga0307413_10004693 3300031824 Bacteria 5993
134 Ga0307410_10869897 3300031852 Bacteria 770
135 Ga0307407_10005305 3300031903 Bacteria 5577
136 Ga0307407_10039975 3300031903 Bacteria 2612
137 Ga0307412_10100674 3300031911 Bacteria 2043
138 Ga0307412_10225274 3300031911 Bacteria 1440
139 Ga0307409_100089064 3300031995 Bacteria 2521
140 Ga0307409_100121812 3300031995 Bacteria 2210
141 Ga0307409_100394699 3300031995 Bacteria 1319
142 Ga0307409_101575419 3300031995 Bacteria 685
143 Ga0307416_100056046 3300032002 Bacteria 3178
144 Ga0307416_100184389 3300032002 Bacteria 1960
145 Ga0307416_100319518 3300032002 Bacteria 1554
146 Ga0307416_100334261 3300032002 Bacteria 1524
147 Ga0307416_100396597 3300032002 Bacteria 1416
148 Ga0307414_10041961 3300032004 Bacteria 3104
149 Ga0307414_10181108 3300032004 Bacteria 1695
150 Ga0307414_10251459 3300032004 Bacteria 1469
151 Ga0307411_10031648 3300032005 Bacteria 3258
152 Ga0307411_10048507 3300032005 Bacteria 2752
153 Ga0307411_10049018 3300032005 Bacteria 2742
154 Ga0307415_100000934 3300032126 Bacteria 13403
155 Ga0307415_100071859 3300032126 Bacteria 2435
156 Ga0307415_100073971 3300032126 Bacteria 2406
157 Ga0395899_0002132 3300037312 Bacteria 16264
158 Ga0395899_0027660 3300037312 Bacteria 4273
159 Ga0395899_0295513 3300037312 Bacteria 1098
160 Ga0395899_0302643 3300037312 Bacteria 1081
161 Ga0395899_0485159 3300037312 Bacteria 804
162 Ga0395900_0002074 3300037418 Bacteria 22489
163 Ga0395900_0039343 3300037418 Bacteria 4872
164 Ga0395900_0174082 3300037418 Bacteria 2190
165 Ga0395900_0213295 3300037418 Bacteria 1949
166 Ga0395898_0003817 3300037466 Bacteria 16688
167 Ga0395898_0153022 3300037466 Bacteria 2206
168 Ga0395905_0000313 3300037471 Bacteria 70446
169 Ga0395905_0017126 3300037471 Bacteria 6882
170 Ga0395905_0092071 3300037471 Bacteria 2843
171 Ga0395905_0098789 3300037471 Bacteria 2741
172 Ga0395905_0165210 3300037471 Bacteria 2080
173 Ga0395905_0427665 3300037471 Bacteria 1221
174 Ga0395905_0653054 3300037471 Bacteria 954
175 Ga0395905_0678081 3300037471 Bacteria 933
176 Ga0395905_1123155 3300037471 Bacteria 689
177 Ga0395905_1307292 3300037471 Bacteria 629
178 Ga0395901_0005690 3300038443 Bacteria 12615
179 Ga0395901_0076296 3300038443 Bacteria 3496
180 Ga0395901_0097442 3300038443 Bacteria 3083
181 Ga0466966_0052838 3300044684 Bacteria 2579
182 Ga0466961_0012733 3300044693 Bacteria 5386
183 Ga0466971_0108605 3300044719 Bacteria 1279
184 Ga0466970_0023812 3300044765 Bacteria 3201
185 Ga0466959_0237596 3300045049 Bacteria 1259
186 Ga0466959_0435717 3300045049 Bacteria 889
187 Ga0466967_0081419 3300045976 Bacteria 2924
188 Ga0495638_0182432 3300046460 Bacteria 1197
189 Ga0495605_0263777 3300046474 Bacteria 735
190 Ga0495620_0206338 3300046515 Bacteria 755
191 Ga0495663_0118151 3300046525 Bacteria 886
192 Ga0495668_0014585 3300046616 Bacteria 4602
193 Ga0495668_0062462 3300046616 Bacteria 2052
194 Ga0495669_0001938 3300046684 Bacteria 8506
195 Ga0495669_0024855 3300046684 Bacteria 2610
196 Ga0495669_0027977 3300046684 Bacteria 2467
197 Ga0495669_0061422 3300046684 Bacteria 1700
198 Ga0495685_085435 3300047447 Bacteria 1049
199 Ga0496107_0017856 3300048910 Bacteria 4993
200 Ga0496107_0202320 3300048910 Bacteria 1476
201 Ga0496108_0001241 3300048911 Bacteria 19989
202 Ga0496108_0011527 3300048911 Bacteria 7186
203 Ga0496109_0131626 3300048912 Bacteria 2335
204 Ga0496110_0427661 3300048913 Bacteria 1207
205 Ga0496112_0002624 3300048915 Bacteria 14527
206 Ga0496113_0009432 3300048916 Bacteria 6403
207 Ga0496114_0019525 3300048917 Bacteria 5491
208 Ga0495655_0072310 3300053083 Bacteria 967
209 Ga0466962_0057154 3300061719 Bacteria 1863
210 Ga0070670_100154479
211 MRS1b_contig_2461418
212 JGI24739J22299_10004359
213 JGI24737J22298_10015047
214 JGI24735J21928_10008273
215 JGI24738J21930_10007357
216 Ga0070658_10018933
217 Ga0070658_10484358
218 Ga0070658_11126563
219 Ga0070676_10098108
220 Ga0070676_10113152
221 Ga0070676_10324847
222 Ga0070683_100009797
223 Ga0070683_100011024
224 Ga0070670_100025540
225 Ga0070670_100582957
226 Ga0070666_10011770
227 Ga0070682_100395580
228 Ga0070660_100015476
229 Ga0070689_100590552
230 Ga0070661_100050620
231 Ga0070668_100178340
232 Ga0070668_100612012
233 Ga0070668_101156320
234 Ga0070669_100007604
235 Ga0070669_100237650
236 Ga0070669_100633984
237 Ga0070675_100473054
238 Ga0070671_100101612
239 Ga0070674_100799261
240 Ga0070673_100049443
241 Ga0070673_100846676
242 Ga0070688_100680541
243 Ga0070659_100017538
244 Ga0070659_100528587
245 Ga0070659_100566557
246 Ga0070659_100822366
247 Ga0070667_100006814
248 Ga0070667_100058669
249 Ga0070667_100312732
250 Ga0070667_100420517
251 Ga0070667_100634692
252 Ga0070713_100366987
253 Ga0070663_100456822
254 Ga0070662_100020005
255 Ga0070662_100071838
256 Ga0070662_100212517
257 Ga0070662_100215593
258 Ga0070685_10627078
259 Ga0070679_100295697
260 Ga0070684_100350671
261 Ga0068853_100564807
262 Ga0068853_100713200
263 Ga0070672_100090655
264 Ga0070665_100021397
265 Ga0070665_100118761
266 Ga0070665_100456244
267 Ga0070665_100614327
268 Ga0070665_100965436
269 Ga0070664_100018669
270 Ga0068857_100024467
271 Ga0068854_100104612
272 Ga0068856_100298860
273 Ga0068852_100977942
274 Ga0068864_100651825
275 Ga0068851_10120452
276 Ga0068862_100107917
277 Ga0081539_10044982
278 Ga0097621_100121123
279 Ga0068871_100090870
280 Ga0068865_100250703
281 Ga0105242_10401620
282 Ga0105248_10061186
283 Ga0157373_10139561
284 Ga0157371_10009970
285 Ga0157371_10222968
286 Ga0157371_10820369
287 Ga0157370_10127691
288 Ga0157372_10088049
289 Ga0157372_10751272
290 Ga0157375_10080742
291 Ga0157375_11170638
292 Ga0163163_10363278
293 Ga0207647_10023563
294 Ga0207645_10092650
295 Ga0207705_10255826
296 Ga0207705_10689484
297 Ga0207660_11148033
298 Ga0207657_10009585
299 Ga0207657_10073895
300 Ga0207657_10164551
301 Ga0207657_10165723
302 Ga0207681_10358500
303 Ga0207650_10030799
304 Ga0207650_10042797
305 Ga0207659_10083823
306 Ga0207700_10249997
307 Ga0207664_10040509
308 Ga0207644_10115709
309 Ga0207644_10769129
310 Ga0207690_10069292
311 Ga0207690_11045022
312 Ga0207706_10270297
313 Ga0207706_10274632
314 Ga0207706_10442703
315 Ga0207669_11108527
316 Ga0207691_10100221
317 Ga0207661_10313638
318 Ga0207679_10025811
319 Ga0207667_11667815
320 Ga0207640_10593917
321 Ga0207640_11317095
322 Ga0207658_10020720
323 Ga0207658_10080230
324 Ga0207658_10322326
325 Ga0207658_10535965
326 Ga0207639_10675620
327 Ga0207639_10717067
328 Ga0207639_11636404
329 Ga0207639_11899969
330 Ga0207678_10004608
331 Ga0207678_10011950
332 Ga0207678_10046457
333 Ga0207676_10331737
334 Ga0207698_10061580
335 Ga0268266_10283386
336 Ga0268266_10441059
337 Ga0268266_10491419
338 Ga0268265_10127154
339 Ga0307405_10425317
340 Ga0307405_10575581
341 Ga0307413_10004288
342 Ga0307413_10004693
343 Ga0307410_10869897
344 Ga0307407_10005305
345 Ga0307407_10039975
346 Ga0307412_10100674
347 Ga0307412_10225274
348 Ga0307409_100089064
349 Ga0307409_100121812
350 Ga0307409_100394699
351 Ga0307409_101575419
352 Ga0307416_100056046
353 Ga0307416_100184389
354 Ga0307416_100319518
355 Ga0307416_100334261
356 Ga0307416_100396597
357 Ga0307414_10041961
358 Ga0307414_10181108
359 Ga0307414_10251459
360 Ga0307411_10031648
361 Ga0307411_10048507
362 Ga0307411_10049018
363 Ga0307415_100000934
364 Ga0307415_100071859
365 Ga0307415_100073971
366 Ga0395899_0002132
367 Ga0395899_0027660
368 Ga0395899_0295513
369 Ga0395899_0302643
370 Ga0395899_0485159
371 Ga0395900_0002074
372 Ga0395900_0039343
373 Ga0395900_0174082
374 Ga0395900_0213295
375 Ga0395898_0003817
376 Ga0395898_0153022
377 Ga0395905_0000313
378 Ga0395905_0017126
379 Ga0395905_0092071
380 Ga0395905_0098789
381 Ga0395905_0165210
382 Ga0395905_0427665
383 Ga0395905_0653054
384 Ga0395905_0678081
385 Ga0395905_1123155
386 Ga0395905_1307292
387 Ga0395901_0005690
388 Ga0395901_0076296
389 Ga0395901_0097442
390 Ga0466966_0052838
391 Ga0466961_0012733
392 Ga0466971_0108605
393 Ga0466970_0023812
394 Ga0466959_0237596
395 Ga0466959_0435717
396 Ga0466967_0081419
397 Ga0495638_0182432
398 Ga0495605_0263777
399 Ga0495620_0206338
400 Ga0495663_0118151
401 Ga0495668_0014585
402 Ga0495668_0062462
403 Ga0495669_0001938
404 Ga0495669_0024855
405 Ga0495669_0027977
406 Ga0495669_0061422
407 Ga0495685_085435
408 Ga0496107_0017856
409 Ga0496107_0202320
410 Ga0496108_0001241
411 Ga0496108_0011527
412 Ga0496109_0131626
413 Ga0496110_0427661
414 Ga0496112_0002624
415 Ga0496113_0009432
416 Ga0496114_0019525
417 Ga0495655_0072310
418 Ga0466962_0057154

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cnl-assembly1.cif.gz_A crystal structure of an icml-like type iv secretion system protein (lpg0120) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 2.65 a resolution 0.6816 120 167
8h2t-assembly1.cif.gz_H cryo-em structure of iadd/e dioxygenase bound with iaa 0.6673 112 164
5u9o-assembly2.cif.gz_D cocrystal structure of the intermembrane space region of the plastid division proteins parc6 and pdv1 0.5918 120 169
5u9o-assembly1.cif.gz_E cocrystal structure of the intermembrane space region of the plastid division proteins parc6 and pdv1 0.551 114 169
3ksp-assembly1.cif.gz_A-2 crystal structure of a putative ca/calmodulin-dependent kinase ii association domain (exig_1688) from exiguobacterium sibiricum 255-15 at 2.59 a resolution 0.5493 117 165
ID Description Score Start End Superfamily
af_O53973_67_188_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7008 112 167 3.10.450.50
af_A8WFJ7_211_497_3.15.20.10 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 2;Bactericidal permeability-increasing protein; domain 2 0.6667 120 166 3.15.20.10
af_Q93796_259_524_3.15.20.10 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 2;Bactericidal permeability-increasing protein; domain 2 0.6346 120 167 3.15.20.10
af_Q8NFQ6_213_474_3.15.20.10 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 2;Bactericidal permeability-increasing protein; domain 2 0.6014 120 168 3.15.20.10
af_B3H594_39_223_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.5828 122 165 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A0R2JYJ5-F1-model_v4 TcaA second domain-containing protein 0.7788 78 168
AF-A0A2W4LBY8-F1-model_v4 Nuclear transport factor 2 family protein 0.7309 120 168
AF-A0A2U2IZA2-F1-model_v4 Uncharacterized protein 0.7138 22 168
AF-A0A0N0AIK9-F1-model_v4 deleted 0.6751 116 168
AF-A0A7G5YZR7-F1-model_v4 Uncharacterized protein 0.6632 12 168 GO:0016020

Map