F318341

General Info

Members Datasets Scaffolds Average Seq Length
208 158 202 279

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0011588|Ga0496118_0011588_840_1832
Length 330
Sequence MSLARVRWVNFVGVSRIGACSTLGFACRRTAWRRRDEFASFNRVMRPSGRGMLMSIVSEAIARRFGDGRAKGEDGGDNDFIRRVLSRKTVRRYAETIPSESLLDTLVACALSASAKSDFQQASILRVHDQAKRAAIGALFPAMPWIGAAPVFFVFLGDARRLQRIGELRGKPVVNGTLEGFFNASIDAALALQTMILCAESIGLGACPISVIRNEVDKVAEILALPDLVFPVAGLCLGYPASEGHVSLRLPRSITTHVDRYDDSALAAAIDDYDQRRHRQHAIPKEQHRANAEFGEAPFYGWSEDKARQAAKAEGAAFPPYLCAHGFGFD

Samples

Sample ID Description Type Environment
1 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
2 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
3 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
4 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
5 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
6 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
90 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
131 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
132 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
133 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
141 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
148 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
149 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
150 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
151 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
152 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
153 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
154 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
155 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
156 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
157 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
158 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.63
Metatranscriptomes 0.48
Isolates 2.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.46
Nodule 2.88
Rhizoplane 1.44
Rhizosphere 65.87
Stem 0
Stem Tuber 0
Unclassified 16.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10127269 3300003323 Bacteria 2881
2 Ga0070683_100051513 3300005329 Bacteria 3812
3 Ga0070683_100291136 3300005329 Bacteria 1553
4 Ga0070675_100201352 3300005354 Unclassified 1728
5 Ga0070675_100253917 3300005354 Bacteria 1540
6 Ga0070671_100125378 3300005355 Bacteria 2162
7 Ga0070671_100427453 3300005355 Bacteria 1135
8 Ga0070674_100292220 3300005356 Bacteria 1296
9 Ga0070709_10000319 3300005434 Bacteria 30574
10 Ga0070709_10152272 3300005434 Bacteria 1599
11 Ga0070714_100004831 3300005435 Bacteria 10228
12 Ga0070714_100069876 3300005435 Bacteria 3034
13 Ga0070714_100374967 3300005435 Bacteria 1340
14 Ga0070713_100376165 3300005436 Bacteria 1322
15 Ga0070713_100460633 3300005436 Bacteria 1195
16 Ga0070711_100001884 3300005439 Bacteria 11723
17 Ga0070681_10099305 3300005458 Bacteria 2857
18 Ga0070681_10138440 3300005458 Unclassified 2364
19 Ga0070706_100377704 3300005467 Bacteria 1320
20 Ga0070707_100012273 3300005468 Bacteria 8002
21 Ga0070707_100057071 3300005468 Bacteria 3746
22 Ga0070698_100120799 3300005471 Bacteria 2580
23 Ga0070699_100075941 3300005518 Bacteria 2924
24 Ga0070697_100282050 3300005536 Bacteria 1425
25 Ga0068853_100277302 3300005539 Bacteria 1545
26 Ga0068857_100321576 3300005577 Bacteria 1429
27 Ga0068856_100325534 3300005614 Bacteria 1554
28 Ga0068859_100948367 3300005617 Bacteria 944
29 Ga0068860_100000223 3300005843 Bacteria 88152
30 Ga0070717_10005505 3300006028 Bacteria 9243
31 Ga0070717_10025258 3300006028 Bacteria 4723
32 Ga0070717_10064722 3300006028 Bacteria 3037
33 Ga0070717_10090949 3300006028 Bacteria 2576
34 Ga0075365_10088957 3300006038 Bacteria 2102
35 Ga0075365_10238906 3300006038 Bacteria 1276
36 Ga0075368_10003938 3300006042 Bacteria 5000
37 Ga0070716_100007592 3300006173 Bacteria 5348
38 Ga0070712_100192997 3300006175 Bacteria 1595
39 Ga0075369_10001433 3300006186 Bacteria 8136
40 Ga0068865_100425154 3300006881 Bacteria 1093
41 Ga0097620_100948355 3300006931 Bacteria 944
42 Ga0099794_10001048 3300007265 Bacteria 9427
43 Ga0105237_10344114 3300009545 Bacteria 1495
44 Ga0105237_10528594 3300009545 Bacteria 1186
45 Ga0105238_10024642 3300009551 Bacteria 6133
46 Ga0105249_10570083 3300009553 Unclassified 1184
47 Ga0099796_10016767 3300010159 Bacteria 2169
48 Ga0105239_10154925 3300010375 Bacteria 2558
49 Ga0157375_10702223 3300013308 Bacteria 1165
50 Ga0163163_10352808 3300014325 Bacteria 1527
51 Ga0157380_10065784 3300014326 Bacteria 2915
52 Ga0182008_10082498 3300014497 Unclassified 1582
53 Ga0157376_10247082 3300014969 Bacteria 1665
54 Ga0213872_10023385 3300021361 Bacteria 2843
55 Ga0213876_10068588 3300021384 Bacteria 1873
56 Ga0213875_10000305 3300021388 Bacteria 46895
57 Ga0213875_10021229 3300021388 Bacteria 3112
58 Ga0209677_101648 3300025253 Bacteria 9393
59 Ga0209148_1022693 3300025254 Bacteria 1005
60 Ga0209233_1000794 3300025261 Bacteria 14173
61 Ga0209455_1007443 3300025272 Bacteria 3088
62 Ga0209758_1025319 3300025297 Bacteria 2608
63 Ga0207692_10002089 3300025898 Bacteria 7627
64 Ga0207710_10020387 3300025900 Bacteria 2834
65 Ga0207685_10048913 3300025905 Bacteria 1622
66 Ga0207699_10000325 3300025906 Bacteria 25458
67 Ga0207699_10269007 3300025906 Bacteria 1180
68 Ga0207645_10322716 3300025907 Bacteria 1030
69 Ga0207684_10022527 3300025910 Bacteria 5378
70 Ga0207684_10090898 3300025910 Bacteria 2601
71 Ga0207684_10323678 3300025910 Bacteria 1329
72 Ga0207671_10222086 3300025914 Bacteria 1480
73 Ga0207693_10121525 3300025915 Bacteria 2051
74 Ga0207663_10000634 3300025916 Bacteria 15595
75 Ga0207663_10188256 3300025916 Bacteria 1480
76 Ga0207646_10019895 3300025922 Bacteria 6230
77 Ga0207646_10048213 3300025922 Bacteria 3819
78 Ga0207694_10027393 3300025924 Bacteria 4340
79 Ga0207659_10118671 3300025926 Bacteria 2024
80 Ga0207700_10007913 3300025928 Bacteria 6540
81 Ga0207700_10026219 3300025928 Bacteria 4062
82 Ga0207700_10097164 3300025928 Bacteria 2340
83 Ga0207664_10010338 3300025929 Bacteria 6591
84 Ga0207664_10059195 3300025929 Bacteria 3050
85 Ga0207706_10465434 3300025933 Bacteria 1093
86 Ga0207669_10313036 3300025937 Bacteria 1198
87 Ga0207704_10134562 3300025938 Bacteria 1718
88 Ga0207665_10008916 3300025939 Bacteria 6588
89 Ga0207691_10197805 3300025940 Bacteria 1750
90 Ga0207667_10609217 3300025949 Bacteria 1100
91 Ga0207668_10237912 3300025972 Bacteria 1472
92 Ga0207677_10349990 3300026023 Bacteria 1238
93 Ga0207676_10696832 3300026095 Bacteria 984
94 Ga0207675_100452645 3300026118 Bacteria 1272
95 Ga0209588_1009011 3300027671 Bacteria 2971
96 Ga0268264_10000119 3300028381 Bacteria 192507
97 Ga0268264_10395898 3300028381 Bacteria 1326
98 Ga0307515_10068790 3300028794 Bacteria 4856
99 Ga0307513_10002974 3300031456 Bacteria 23112
100 Ga0307513_10212885 3300031456 Bacteria 1762
101 Ga0265313_10028387 3300031595 Bacteria 2909
102 Ga0307508_10000020 3300031616 Bacteria 188730
103 Ga0265314_10019577 3300031711 Bacteria 5241
104 Ga0265342_10012633 3300031712 Bacteria 5712
105 Ga0307516_10007316 3300031730 Bacteria 12708
106 Ga0307516_10062918 3300031730 Bacteria 3594
107 Ga0307507_10136119 3300033179 Bacteria 1902
108 Ga0307510_10008359 3300033180 Bacteria 12332
109 Ga0373926_0021270 3300035083 Bacteria 2245
110 Ga0373953_0098635 3300035117 Bacteria 1228
111 Ga0373943_0077045 3300035170 Bacteria 1702
112 Ga0373955_0091417 3300035172 Bacteria 1735
113 Ga0373935_0126739 3300035692 Bacteria 1711
114 Ga0373927_0018401 3300035695 Bacteria 4592
115 Ga0373927_0176100 3300035695 Bacteria 1403
116 Ga0373933_0157967 3300035724 Bacteria 1439
117 Ga0373937_0133016 3300036401 Bacteria 2324
118 Ga0373937_0463419 3300036401 Unclassified 1204
119 Ga0372808_007960 3300036459 Bacteria 1461
120 Ga0436364_0007994 3300037853 Bacteria 27957
121 Ga0436364_0369199 3300037853 Bacteria 2179
122 Ga0436364_0804800 3300037853 Bacteria 21862
123 Ga0436365_0242165 3300039437 Unclassified 1508
124 Ga0436365_0446073 3300039437 Bacteria 6286
125 Ga0436365_0671511 3300039437 Bacteria 3936
126 Ga0436365_1270305 3300039437 Bacteria 1218
127 Ga0436365_1690719 3300039437 Bacteria 5168
128 Ga0436361_0435808 3300039447 Unclassified 1431
129 Ga0436361_0850382 3300039447 Bacteria 9807
130 Ga0436362_0542728 3300039453 Bacteria 4003
131 Ga0439464_0034180 3300042439 Bacteria 1433
132 Ga0466963_0192636 3300044694 Bacteria 1424
133 Ga0495592_0061938 3300046454 Bacteria 2748
134 Ga0495629_0076500 3300046459 Bacteria 2337
135 Ga0495651_0002446 3300046462 Bacteria 14342
136 Ga0495651_0009689 3300046462 Bacteria 7409
137 Ga0495651_0076900 3300046462 Bacteria 2527
138 Ga0495664_0004570 3300046477 Bacteria 7572
139 Ga0495628_0013865 3300046516 Bacteria 6771
140 Ga0495652_0008475 3300046529 Bacteria 9380
141 Ga0495640_0040128 3300046533 Bacteria 3279
142 Ga0495586_0249933 3300046535 Bacteria 1011
143 Ga0495587_0006256 3300046536 Bacteria 7774
144 Ga0495645_0092603 3300046543 Bacteria 2158
145 Ga0495622_0053887 3300046557 Bacteria 1866
146 Ga0495667_0024983 3300046559 Bacteria 4026
147 Ga0495667_0084113 3300046559 Bacteria 2066
148 Ga0495634_0026914 3300046642 Bacteria 4009
149 Ga0495635_0037045 3300046663 Bacteria 3377
150 Ga0495635_0198970 3300046663 Bacteria 1359
151 Ga0495657_0223528 3300046675 Bacteria 1140
152 Ga0495623_0104539 3300046679 Bacteria 1722
153 Ga0495623_0148186 3300046679 Bacteria 1389
154 Ga0495600_0030548 3300046809 Bacteria 3490
155 Ga0495581_0243837 3300047315 Bacteria 1051
156 Ga0495604_0002500 3300047317 Bacteria 14683
157 Ga0495674_0039368 3300047319 Bacteria 4238
158 Ga0495680_0007992 3300047322 Bacteria 9640
159 Ga0495685_018858 3300047447 Bacteria 2369
160 Ga0495602_0010952 3300048088 Bacteria 9396
161 Ga0495602_0202323 3300048088 Bacteria 1514
162 Ga0496106_0001169 3300048909 Bacteria 19515
163 Ga0496112_0042678 3300048915 Bacteria 4438
164 Ga0496115_0076612 3300048918 Bacteria 2718
165 Ga0496116_0095275 3300048919 Bacteria 1797
166 Ga0496117_0009517 3300048920 Bacteria 9027
167 Ga0496118_0006686 3300048921 Bacteria 12570
168 Ga0496118_0011588 3300048921 Bacteria 8585
169 Ga0496119_0069404 3300048922 Bacteria 2071
170 Ga0496121_0000089 3300048924 Bacteria 219007
171 Ga0496121_0143918 3300048924 Bacteria 1764
172 Ga0496121_0189235 3300048924 Bacteria 1477
173 Ga0496124_0024482 3300048927 Bacteria 5486
174 Ga0496124_0075937 3300048927 Bacteria 2775
175 Ga0496125_0031819 3300048928 Bacteria 4694
176 Ga0496126_0008012 3300048929 Bacteria 11465
177 Ga0496126_0156467 3300048929 Bacteria 1950
178 nmdc:mga03683_2471_c1 3300050489 Bacteria 3788
179 nmdc:mga0yw44_67908_c1 3300050492 Bacteria 2204
180 nmdc:mga0k408_29465_c1 3300050493 Bacteria 3124
181 nmdc:mga07m45_26754_c1 3300050496 Bacteria 3171
182 nmdc:mga08y16_49264_c1 3300050511 Bacteria 4409
183 nmdc:mga0rr50_81729_c1 3300050513 Bacteria 2494
184 nmdc:mga08x19_39815_c1 3300050514 Bacteria 2989
185 nmdc:mga0sz30_1693_c1 3300050516 Bacteria 7833
186 Ga0495601_0182037 3300053077 Bacteria 1374
187 Ga0495595_0076491 3300053084 Bacteria 1589
188 Ga0495595_0117146 3300053084 Bacteria 1296
189 Ga0500641_0063514 3300053096 Bacteria 1541
190 Ga0500626_019027 3300053128 Bacteria 3041
191 Ga0500559_0000818 3300053136 Bacteria 20202
192 Ga0500559_0062277 3300053136 Bacteria 1666
193 Ga0500590_067285 3300053148 Bacteria 1788
194 Ga0500603_036323 3300053150 Bacteria 1296
195 Ga0500603_037588 3300053150 Bacteria 1278
196 Ga0500604_0063535 3300053151 Bacteria 1164
197 Ga0500638_020157 3300053162 Bacteria 3135
198 Ga0500639_085463 3300053163 Bacteria 1581
199 Ga0500636_0005679 3300053177 Bacteria 7134
200 Ga0500636_0026339 3300053177 Bacteria 3436
201 Ga0500552_009550 3300053733 Bacteria 1173
202 Ga0500596_005366 3300053735 Bacteria 2265

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047315 Ga0495581_0243837 Ga0495581_0243837_324_1028 234
2 3300046459 Ga0495629_0076500 Ga0495629_0076500_1504_2304 257
3 3300005434 Ga0070709_10000319 Ga0070709_1000031918 263
4 3300005435 Ga0070714_100004831 Ga0070714_10000483112 263
5 3300005439 Ga0070711_100001884 Ga0070711_1000018844 263
6 3300006028 Ga0070717_10090949 Ga0070717_100909493 263
7 3300006173 Ga0070716_100007592 Ga0070716_1000075926 263
8 3300025898 Ga0207692_10002089 Ga0207692_1000208911 263
9 3300025905 Ga0207685_10048913 Ga0207685_100489132 263
10 3300025906 Ga0207699_10000325 Ga0207699_1000032518 263
11 3300025916 Ga0207663_10000634 Ga0207663_1000063413 263
12 3300025929 Ga0207664_10059195 Ga0207664_100591952 263
13 3300025939 Ga0207665_10008916 Ga0207665_100089164 263
14 3300048920 Ga0496117_0009517 Ga0496117_0009517_7324_8121 264
15 3300039437 Ga0436365_0242165 Ga0436365_0242165_42_872 272
16 iso_pu_bacteria 2935630451 2935635659 272
17 iso_pu_bacteria 2941507105 2941509308 272
18 iso_pu_bacteria 2941515067 2941517137 272
19 iso_pu_bacteria 2941523033 2941524768 272
20 3300005355 Ga0070671_100125378 Ga0070671_1001253781 273
21 3300021388 Ga0213875_10000305 Ga0213875_100003058 274
22 3300037853 Ga0436364_0007994 Ga0436364_0007994_25237_26097 274
23 3300005329 Ga0070683_100291136 Ga0070683_1002911361 275
24 3300005354 Ga0070675_100201352 Ga0070675_1002013522 275
25 3300005354 Ga0070675_100253917 Ga0070675_1002539172 275
26 3300005355 Ga0070671_100427453 Ga0070671_1004274531 275
27 3300005356 Ga0070674_100292220 Ga0070674_1002922202 275
28 3300005434 Ga0070709_10152272 Ga0070709_101522722 275
29 3300005435 Ga0070714_100374967 Ga0070714_1003749671 275
30 3300005436 Ga0070713_100376165 Ga0070713_1003761651 275
31 3300005436 Ga0070713_100460633 Ga0070713_1004606331 275
32 3300005458 Ga0070681_10099305 Ga0070681_100993052 275
33 3300005458 Ga0070681_10138440 Ga0070681_101384402 275
34 3300005468 Ga0070707_100012273 Ga0070707_1000122732 275
35 3300005471 Ga0070698_100120799 Ga0070698_1001207992 275
36 3300005518 Ga0070699_100075941 Ga0070699_1000759411 275
37 3300005536 Ga0070697_100282050 Ga0070697_1002820502 275
38 3300005577 Ga0068857_100321576 Ga0068857_1003215762 275
39 3300005614 Ga0068856_100325534 Ga0068856_1003255342 275
40 3300005617 Ga0068859_100948367 Ga0068859_1009483671 275
41 3300005843 Ga0068860_100000223 Ga0068860_1000002237 275
42 3300006028 Ga0070717_10064722 Ga0070717_100647223 275
43 3300006881 Ga0068865_100425154 Ga0068865_1004251541 275
44 3300006931 Ga0097620_100948355 Ga0097620_1009483551 275
45 3300009545 Ga0105237_10344114 Ga0105237_103441142 275
46 3300009553 Ga0105249_10570083 Ga0105249_105700831 275
47 3300013308 Ga0157375_10702223 Ga0157375_107022232 275
48 3300014325 Ga0163163_10352808 Ga0163163_103528081 275
49 3300014326 Ga0157380_10065784 Ga0157380_100657842 275
50 3300014497 Ga0182008_10082498 Ga0182008_100824982 275
51 3300014969 Ga0157376_10247082 Ga0157376_102470821 275
52 3300021388 Ga0213875_10021229 Ga0213875_100212292 275
53 3300025900 Ga0207710_10020387 Ga0207710_100203873 275
54 3300025906 Ga0207699_10269007 Ga0207699_102690071 275
55 3300025907 Ga0207645_10322716 Ga0207645_103227162 275
56 3300025910 Ga0207684_10022527 Ga0207684_100225278 275
57 3300025922 Ga0207646_10019895 Ga0207646_100198955 275
58 3300025926 Ga0207659_10118671 Ga0207659_101186712 275
59 3300025928 Ga0207700_10007913 Ga0207700_100079132 275
60 3300025933 Ga0207706_10465434 Ga0207706_104654341 275
61 3300025937 Ga0207669_10313036 Ga0207669_103130362 275
62 3300025938 Ga0207704_10134562 Ga0207704_101345622 275
63 3300025940 Ga0207691_10197805 Ga0207691_101978052 275
64 3300025949 Ga0207667_10609217 Ga0207667_106092172 275
65 3300025972 Ga0207668_10237912 Ga0207668_102379122 275
66 3300026023 Ga0207677_10349990 Ga0207677_103499901 275
67 3300026095 Ga0207676_10696832 Ga0207676_106968321 275
68 3300026118 Ga0207675_100452645 Ga0207675_1004526452 275
69 3300028381 Ga0268264_10000119 Ga0268264_1000011989 275
70 3300028381 Ga0268264_10395898 Ga0268264_103958981 275
71 3300028794 Ga0307515_10068790 Ga0307515_100687905 275
72 3300031456 Ga0307513_10002974 Ga0307513_1000297414 275
73 3300031595 Ga0265313_10028387 Ga0265313_100283873 275
74 3300031730 Ga0307516_10007316 Ga0307516_1000731613 275
75 3300031730 Ga0307516_10062918 Ga0307516_100629183 275
76 3300033179 Ga0307507_10136119 Ga0307507_101361192 275
77 3300035083 Ga0373926_0021270 Ga0373926_0021270_931_1785 275
78 3300035117 Ga0373953_0098635 Ga0373953_0098635_268_1149 275
79 3300035170 Ga0373943_0077045 Ga0373943_0077045_146_976 275
80 3300035172 Ga0373955_0091417 Ga0373955_0091417_590_1471 275
81 3300035692 Ga0373935_0126739 Ga0373935_0126739_132_962 275
82 3300035695 Ga0373927_0018401 Ga0373927_0018401_1830_2660 275
83 3300035695 Ga0373927_0176100 Ga0373927_0176100_313_1176 275
84 3300035724 Ga0373933_0157967 Ga0373933_0157967_61_903 275
85 3300037853 Ga0436364_0804800 Ga0436364_0804800_11262_12116 275
86 3300039437 Ga0436365_0671511 Ga0436365_0671511_1437_2285 275
87 3300039453 Ga0436362_0542728 Ga0436362_0542728_1488_2342 275
88 3300042439 Ga0439464_0034180 Ga0439464_0034180_211_1041 275
89 3300044694 Ga0466963_0192636 Ga0466963_0192636_407_1258 275
90 3300046454 Ga0495592_0061938 Ga0495592_0061938_1572_2453 275
91 3300046535 Ga0495586_0249933 Ga0495586_0249933_14_895 275
92 3300046557 Ga0495622_0053887 Ga0495622_0053887_245_1075 275
93 3300046559 Ga0495667_0024983 Ga0495667_0024983_2650_3531 275
94 3300046642 Ga0495634_0026914 Ga0495634_0026914_889_1770 275
95 3300046663 Ga0495635_0037045 Ga0495635_0037045_2049_2930 275
96 3300048909 Ga0496106_0001169 Ga0496106_0001169_3847_4677 275
97 3300048915 Ga0496112_0042678 Ga0496112_0042678_2722_3588 275
98 3300048921 Ga0496118_0006686 Ga0496118_0006686_5336_6166 275
99 3300048924 Ga0496121_0000089 Ga0496121_0000089_183482_184312 275
100 3300048924 Ga0496121_0189235 Ga0496121_0189235_145_975 275
101 3300048927 Ga0496124_0024482 Ga0496124_0024482_3988_4818 275
102 3300048928 Ga0496125_0031819 Ga0496125_0031819_1590_2420 275
103 3300048929 Ga0496126_0008012 Ga0496126_0008012_2597_3427 275
104 3300050511 nmdc:mga08y16_49264_c1 nmdc:mga08y16_49264_c1_1571_2401 275
105 3300050513 nmdc:mga0rr50_81729_c1 nmdc:mga0rr50_81729_c1_1336_2202 275
106 3300050514 nmdc:mga08x19_39815_c1 nmdc:mga08x19_39815_c1_1945_2811 275
107 3300053084 Ga0495595_0117146 Ga0495595_0117146_414_1256 275
108 3300053136 Ga0500559_0000818 Ga0500559_0000818_6699_7529 275
109 3300053136 Ga0500559_0062277 Ga0500559_0062277_120_950 275
110 3300053148 Ga0500590_067285 Ga0500590_067285_378_1208 275
111 3300053150 Ga0500603_036323 Ga0500603_036323_183_1013 275
112 3300053162 Ga0500638_020157 Ga0500638_020157_75_905 275
113 3300053163 Ga0500639_085463 Ga0500639_085463_326_1156 275
114 3300053177 Ga0500636_0005679 Ga0500636_0005679_3741_4571 275
115 3300053177 Ga0500636_0026339 Ga0500636_0026339_1519_2349 275
116 3300053733 Ga0500552_009550 Ga0500552_009550_35_865 275
117 3300003323 rootH1_10127269 rootH1_101272692 276
118 3300005329 Ga0070683_100051513 Ga0070683_1000515133 276
119 3300005435 Ga0070714_100069876 Ga0070714_1000698762 276
120 3300005467 Ga0070706_100377704 Ga0070706_1003777041 276
121 3300005468 Ga0070707_100057071 Ga0070707_1000570714 276
122 3300005539 Ga0068853_100277302 Ga0068853_1002773021 276
123 3300006028 Ga0070717_10005505 Ga0070717_100055052 276
124 3300006028 Ga0070717_10025258 Ga0070717_100252584 276
125 3300006038 Ga0075365_10088957 Ga0075365_100889572 276
126 3300006038 Ga0075365_10238906 Ga0075365_102389061 276
127 3300006042 Ga0075368_10003938 Ga0075368_100039381 276
128 3300006175 Ga0070712_100192997 Ga0070712_1001929971 276
129 3300006186 Ga0075369_10001433 Ga0075369_100014335 276
130 3300007265 Ga0099794_10001048 Ga0099794_1000104811 276
131 3300009545 Ga0105237_10528594 Ga0105237_105285941 276
132 3300009551 Ga0105238_10024642 Ga0105238_100246425 276
133 3300010159 Ga0099796_10016767 Ga0099796_100167672 276
134 3300010375 Ga0105239_10154925 Ga0105239_101549252 276
135 3300021361 Ga0213872_10023385 Ga0213872_100233852 276
136 3300021384 Ga0213876_10068588 Ga0213876_100685882 276
137 3300025253 Ga0209677_101648 Ga0209677_1016484 276
138 3300025254 Ga0209148_1022693 Ga0209148_10226931 276
139 3300025261 Ga0209233_1000794 Ga0209233_10007945 276
140 3300025272 Ga0209455_1007443 Ga0209455_10074434 276
141 3300025297 Ga0209758_1025319 Ga0209758_10253192 276
142 3300025910 Ga0207684_10090898 Ga0207684_100908984 276
143 3300025910 Ga0207684_10323678 Ga0207684_103236781 276
144 3300025914 Ga0207671_10222086 Ga0207671_102220862 276
145 3300025915 Ga0207693_10121525 Ga0207693_101215252 276
146 3300025916 Ga0207663_10188256 Ga0207663_101882562 276
147 3300025922 Ga0207646_10048213 Ga0207646_100482134 276
148 3300025924 Ga0207694_10027393 Ga0207694_100273933 276
149 3300025928 Ga0207700_10026219 Ga0207700_100262192 276
150 3300025928 Ga0207700_10097164 Ga0207700_100971641 276
151 3300025929 Ga0207664_10010338 Ga0207664_100103388 276
152 3300027671 Ga0209588_1009011 Ga0209588_10090112 276
153 3300031456 Ga0307513_10212885 Ga0307513_102128852 276
154 3300031616 Ga0307508_10000020 Ga0307508_10000020131 276
155 3300031711 Ga0265314_10019577 Ga0265314_100195778 276
156 3300031712 Ga0265342_10012633 Ga0265342_100126338 276
157 3300033180 Ga0307510_10008359 Ga0307510_100083596 276
158 3300036401 Ga0373937_0133016 Ga0373937_0133016_878_1711 276
159 3300036401 Ga0373937_0463419 Ga0373937_0463419_316_1149 276
160 3300036459 Ga0372808_007960 Ga0372808_007960_182_1015 276
161 3300037853 Ga0436364_0369199 Ga0436364_0369199_723_1556 276
162 3300039437 Ga0436365_0446073 Ga0436365_0446073_3891_4754 276
163 3300039437 Ga0436365_1270305 Ga0436365_1270305_296_1129 276
164 3300039437 Ga0436365_1690719 Ga0436365_1690719_1744_2577 276
165 3300039447 Ga0436361_0435808 Ga0436361_0435808_320_1156 276
166 3300039447 Ga0436361_0850382 Ga0436361_0850382_7723_8556 276
167 3300046462 Ga0495651_0002446 Ga0495651_0002446_6440_7276 276
168 3300046462 Ga0495651_0009689 Ga0495651_0009689_1451_2284 276
169 3300046462 Ga0495651_0076900 Ga0495651_0076900_726_1559 276
170 3300046477 Ga0495664_0004570 Ga0495664_0004570_6075_6911 276
171 3300046516 Ga0495628_0013865 Ga0495628_0013865_2443_3279 276
172 3300046529 Ga0495652_0008475 Ga0495652_0008475_8447_9283 276
173 3300046533 Ga0495640_0040128 Ga0495640_0040128_500_1336 276
174 3300046536 Ga0495587_0006256 Ga0495587_0006256_594_1430 276
175 3300046543 Ga0495645_0092603 Ga0495645_0092603_555_1391 276
176 3300046559 Ga0495667_0084113 Ga0495667_0084113_496_1332 276
177 3300046663 Ga0495635_0198970 Ga0495635_0198970_253_1089 276
178 3300046675 Ga0495657_0223528 Ga0495657_0223528_178_1011 276
179 3300046679 Ga0495623_0104539 Ga0495623_0104539_471_1304 276
180 3300046679 Ga0495623_0148186 Ga0495623_0148186_421_1317 276
181 3300046809 Ga0495600_0030548 Ga0495600_0030548_1760_2593 276
182 3300047317 Ga0495604_0002500 Ga0495604_0002500_6769_7605 276
183 3300047319 Ga0495674_0039368 Ga0495674_0039368_1053_1889 276
184 3300047322 Ga0495680_0007992 Ga0495680_0007992_5074_5910 276
185 3300047447 Ga0495685_018858 Ga0495685_018858_53_886 276
186 3300048088 Ga0495602_0010952 Ga0495602_0010952_577_1413 276
187 3300048088 Ga0495602_0202323 Ga0495602_0202323_623_1456 276
188 3300048918 Ga0496115_0076612 Ga0496115_0076612_1287_2120 276
189 3300048919 Ga0496116_0095275 Ga0496116_0095275_53_892 276
190 3300048921 Ga0496118_0011588 Ga0496118_0011588_840_1832 276
191 3300048922 Ga0496119_0069404 Ga0496119_0069404_205_1197 276
192 3300048924 Ga0496121_0143918 Ga0496121_0143918_262_1101 276
193 3300048927 Ga0496124_0075937 Ga0496124_0075937_1749_2582 276
194 3300048929 Ga0496126_0156467 Ga0496126_0156467_1003_1836 276
195 3300050489 nmdc:mga03683_2471_c1 nmdc:mga03683_2471_c1_619_1449 276
196 3300050492 nmdc:mga0yw44_67908_c1 nmdc:mga0yw44_67908_c1_227_1060 276
197 3300050493 nmdc:mga0k408_29465_c1 nmdc:mga0k408_29465_c1_56_889 276
198 3300050496 nmdc:mga07m45_26754_c1 nmdc:mga07m45_26754_c1_705_1535 276
199 3300050516 nmdc:mga0sz30_1693_c1 nmdc:mga0sz30_1693_c1_3593_4423 276
200 3300053077 Ga0495601_0182037 Ga0495601_0182037_115_951 276
201 3300053084 Ga0495595_0076491 Ga0495595_0076491_477_1313 276
202 3300053096 Ga0500641_0063514 Ga0500641_0063514_280_1113 276
203 3300053128 Ga0500626_019027 Ga0500626_019027_824_1735 276
204 3300053150 Ga0500603_037588 Ga0500603_037588_65_898 276
205 3300053151 Ga0500604_0063535 Ga0500604_0063535_118_951 276
206 3300053735 Ga0500596_005366 Ga0500596_005366_178_1113 276
207 iso_pu_bacteria 2904690495 2904691784 276
208 iso_pu_bacteria 2908756301 2908763890 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

84

239

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bkj-assembly1.cif.gz_B nadph:fmn oxidoreductase from vibrio harveyi complexed with nad+ 0.9288 24 273
2bkj-assembly1.cif.gz_B nadph:fmn oxidoreductase from vibrio harveyi complexed with nad+ 0.9135 24 273
5uu6-assembly2.cif.gz_C the crystal structure of nitroreductase a from vibrio parahaemolyticus rimd 2210633 0.9132 22 273
5hei-assembly3.cif.gz_E structure of b. megaterium nfra2 0.9077 23 276
5uu6-assembly2.cif.gz_D the crystal structure of nitroreductase a from vibrio parahaemolyticus rimd 2210633 0.9067 22 273
ID Description Score Start End Superfamily
5heiD00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9079 23 276 3.40.109.10
5uu6C00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9036 23 273 3.40.109.10
5heiD00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9008 23 276 3.40.109.10
5uu6C00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8887 23 273 3.40.109.10
af_Q2G0Z5_3_251_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8827 24 273 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A1M5MR07-F1-model_v4 Nitroreductase/FMN reductase [NAD(P)H] 0.982 1 276 GO:0016491
AF-A0A1M5MR07-F1-model_v4 Nitroreductase/FMN reductase [NAD(P)H] 0.9785 1 276 GO:0016491
AF-A0A537N6B6-F1-model_v4 NADPH-dependent oxidoreductase 0.966 25 276 GO:0016491
AF-A0A537N6B6-F1-model_v4 NADPH-dependent oxidoreductase 0.9623 25 276 GO:0016491
AF-A0A7V2NLI6-F1-model_v4 NADPH-dependent oxidoreductase 0.962 1 276 GO:0016491

Feature Viewer

pLDDT pTM Quality
90.59 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map