F318338
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 208 | 137 | 208 | 230 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0000232|Ga0496115_0000232_41182_41964 |
| Length | 260 |
| Sequence | VILYGRNPVFEALRGRRANAVKDVWATAPAAREPWLKAARPRIVTSEEIERRCGSSAHQGVCADAGAYPYVSAEQLLAGREPLIVALDQVQDPQNLGSICRSAECAGAAGVVIPERRAAEVTPAVCKASAGAVEHLTLARVRNIADFLAQAREAGCWCYGASGEQDRAQAVQAEAQGGTRPGRGARAPIPYDRPDYAGAGVVLVLGSEGSGLRPRVAGACDELVALPLLGRIESLGVSAAAAAILYEILQSRAAGLDNSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 2 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 4 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 14 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 15 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 16 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 17 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 18 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 19 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 23 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 24 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 25 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 26 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 32 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 33 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 52 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 53 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 54 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 55 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 56 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 57 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 58 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 59 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 60 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 61 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 62 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 63 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 64 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 65 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 66 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 67 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 68 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 69 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 70 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 71 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 72 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 73 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 74 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 75 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 76 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 77 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 78 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 79 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 80 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 81 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 82 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 83 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 84 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 85 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 86 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 87 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 88 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 89 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 119 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 121 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 122 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 123 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 124 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 126 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 127 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 128 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 129 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 130 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 10.58 |
| Rhizosphere | 84.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068869_100342553 | 3300005334 | Bacteria | 1217 |
| 2 | Ga0070660_100057854 | 3300005339 | Bacteria | 3005 |
| 3 | Ga0070692_10002583 | 3300005345 | Bacteria | 7058 |
| 4 | Ga0070669_100107521 | 3300005353 | Bacteria | 2113 |
| 5 | Ga0070659_100000026 | 3300005366 | Bacteria | 143542 |
| 6 | Ga0070709_10147039 | 3300005434 | Bacteria | 1625 |
| 7 | Ga0070709_10251822 | 3300005434 | Bacteria | 1273 |
| 8 | Ga0070714_100000315 | 3300005435 | Bacteria | 36636 |
| 9 | Ga0070714_100010093 | 3300005435 | Bacteria | 7452 |
| 10 | Ga0070714_100172643 | 3300005435 | Bacteria | 1963 |
| 11 | Ga0070714_100229186 | 3300005435 | Bacteria | 1711 |
| 12 | Ga0070714_100369403 | 3300005435 | Bacteria | 1350 |
| 13 | Ga0070714_100680226 | 3300005435 | Bacteria | 992 |
| 14 | Ga0070713_100088603 | 3300005436 | Bacteria | 2656 |
| 15 | Ga0070713_100144640 | 3300005436 | Bacteria | 2109 |
| 16 | Ga0070710_10000008 | 3300005437 | Bacteria | 198148 |
| 17 | Ga0070711_100046668 | 3300005439 | Bacteria | 2953 |
| 18 | Ga0070711_100196787 | 3300005439 | Bacteria | 1553 |
| 19 | Ga0070705_100000935 | 3300005440 | Bacteria | 16369 |
| 20 | Ga0070707_100087218 | 3300005468 | Bacteria | 3019 |
| 21 | Ga0068856_100252372 | 3300005614 | Bacteria | 1779 |
| 22 | Ga0068861_100173423 | 3300005719 | Bacteria | 1789 |
| 23 | Ga0081455_10021269 | 3300005937 | Bacteria | 6087 |
| 24 | Ga0081538_10008221 | 3300005981 | Bacteria | 8896 |
| 25 | Ga0081538_10030778 | 3300005981 | Bacteria | 3635 |
| 26 | Ga0081538_10055208 | 3300005981 | Bacteria | 2341 |
| 27 | Ga0081540_1000314 | 3300005983 | Bacteria | 50231 |
| 28 | Ga0081539_10008852 | 3300005985 | Bacteria | 8606 |
| 29 | Ga0070717_10000204 | 3300006028 | Bacteria | 41488 |
| 30 | Ga0070717_10523166 | 3300006028 | Unclassified | 1073 |
| 31 | Ga0070716_100041914 | 3300006173 | Bacteria | 2553 |
| 32 | Ga0070712_100000153 | 3300006175 | Bacteria | 36937 |
| 33 | Ga0070712_100020819 | 3300006175 | Bacteria | 4297 |
| 34 | Ga0070712_100319258 | 3300006175 | Bacteria | 1262 |
| 35 | Ga0075433_10001378 | 3300006852 | Bacteria | 17864 |
| 36 | Ga0075434_100029421 | 3300006871 | Bacteria | 5405 |
| 37 | Ga0075429_100008885 | 3300006880 | Bacteria | 8735 |
| 38 | Ga0075435_100005134 | 3300007076 | Bacteria | 9101 |
| 39 | Ga0105243_11062723 | 3300009148 | Bacteria | 816 |
| 40 | Ga0157372_10502068 | 3300013307 | Bacteria | 1414 |
| 41 | Ga0157375_10372200 | 3300013308 | Bacteria | 1595 |
| 42 | Ga0157380_10701361 | 3300014326 | Bacteria | 1017 |
| 43 | Ga0157376_10105431 | 3300014969 | Bacteria | 2472 |
| 44 | Ga0213874_10001301 | 3300021377 | Bacteria | 5161 |
| 45 | Ga0213876_10032272 | 3300021384 | Bacteria | 2763 |
| 46 | Ga0213876_10060857 | 3300021384 | Bacteria | 1992 |
| 47 | Ga0207692_10000006 | 3300025898 | Bacteria | 294686 |
| 48 | Ga0207699_10154321 | 3300025906 | Bacteria | 1522 |
| 49 | Ga0207699_10348023 | 3300025906 | Bacteria | 1045 |
| 50 | Ga0207695_10065940 | 3300025913 | Bacteria | 3720 |
| 51 | Ga0207671_10003645 | 3300025914 | Bacteria | 15209 |
| 52 | Ga0207693_10000487 | 3300025915 | Bacteria | 35985 |
| 53 | Ga0207693_10003354 | 3300025915 | Bacteria | 13689 |
| 54 | Ga0207693_10011589 | 3300025915 | Bacteria | 7132 |
| 55 | Ga0207693_10099732 | 3300025915 | Bacteria | 2277 |
| 56 | Ga0207663_10040760 | 3300025916 | Bacteria | 2825 |
| 57 | Ga0207657_10068188 | 3300025919 | Bacteria | 3022 |
| 58 | Ga0207681_10001784 | 3300025923 | Bacteria | 13814 |
| 59 | Ga0207700_10146760 | 3300025928 | Bacteria | 1945 |
| 60 | Ga0207700_10193208 | 3300025928 | Bacteria | 1711 |
| 61 | Ga0207664_10000006 | 3300025929 | Bacteria | 408702 |
| 62 | Ga0207664_10000523 | 3300025929 | Bacteria | 27344 |
| 63 | Ga0207664_10203317 | 3300025929 | Bacteria | 1711 |
| 64 | Ga0207664_10238857 | 3300025929 | Bacteria | 1582 |
| 65 | Ga0207690_10001474 | 3300025932 | Bacteria | 14697 |
| 66 | Ga0207665_10116940 | 3300025939 | Bacteria | 1880 |
| 67 | Ga0207689_10377537 | 3300025942 | Bacteria | 1180 |
| 68 | Ga0207661_10101586 | 3300025944 | Bacteria | 2416 |
| 69 | Ga0207679_10493511 | 3300025945 | Bacteria | 1092 |
| 70 | Ga0207708_10212733 | 3300026075 | Bacteria | 1546 |
| 71 | Ga0207702_10231443 | 3300026078 | Bacteria | 1727 |
| 72 | Ga0207702_10306796 | 3300026078 | Bacteria | 1508 |
| 73 | Ga0207641_10489078 | 3300026088 | Bacteria | 1194 |
| 74 | Ga0265337_1048391 | 3300028556 | Bacteria | 1203 |
| 75 | Ga0265326_10000010 | 3300028558 | Bacteria | 184218 |
| 76 | Ga0265326_10003486 | 3300028558 | Bacteria | 5141 |
| 77 | Ga0265319_1000612 | 3300028563 | Bacteria | 23646 |
| 78 | Ga0265319_1003420 | 3300028563 | Bacteria | 8278 |
| 79 | Ga0265334_10000003 | 3300028573 | Bacteria | 244354 |
| 80 | Ga0265336_10000001 | 3300028666 | Bacteria | 916179 |
| 81 | Ga0265338_10000228 | 3300028800 | Bacteria | 104553 |
| 82 | Ga0265338_10004818 | 3300028800 | Bacteria | 18040 |
| 83 | Ga0265338_10221179 | 3300028800 | Bacteria | 1414 |
| 84 | Ga0265338_10561175 | 3300028800 | Bacteria | 798 |
| 85 | Ga0265320_10125943 | 3300031240 | Bacteria | 1165 |
| 86 | Ga0265340_10000005 | 3300031247 | Bacteria | 204570 |
| 87 | Ga0265327_10089147 | 3300031251 | Bacteria | 1507 |
| 88 | Ga0265316_10111107 | 3300031344 | Bacteria | 2075 |
| 89 | Ga0307405_10105370 | 3300031731 | Bacteria | 1899 |
| 90 | Ga0307413_10109702 | 3300031824 | Bacteria | 1845 |
| 91 | Ga0307410_10018635 | 3300031852 | Bacteria | 4199 |
| 92 | Ga0307410_10342557 | 3300031852 | Bacteria | 1192 |
| 93 | Ga0307406_10070510 | 3300031901 | Bacteria | 2289 |
| 94 | Ga0307406_10165708 | 3300031901 | Bacteria | 1594 |
| 95 | Ga0307406_10208087 | 3300031901 | Bacteria | 1445 |
| 96 | Ga0307407_10129248 | 3300031903 | Bacteria | 1613 |
| 97 | Ga0307412_10550523 | 3300031911 | Bacteria | 969 |
| 98 | Ga0307409_100034166 | 3300031995 | Bacteria | 3709 |
| 99 | Ga0307409_100471775 | 3300031995 | Bacteria | 1216 |
| 100 | Ga0307416_100011147 | 3300032002 | Bacteria | 5979 |
| 101 | Ga0307416_100013530 | 3300032002 | Bacteria | 5550 |
| 102 | Ga0307415_100000250 | 3300032126 | Bacteria | 23226 |
| 103 | Ga0307415_100266357 | 3300032126 | Bacteria | 1401 |
| 104 | Ga0373924_0032220 | 3300035410 | Bacteria | 2111 |
| 105 | Ga0373935_0074631 | 3300035692 | Bacteria | 2193 |
| 106 | Ga0373927_0291121 | 3300035695 | Bacteria | 1075 |
| 107 | Ga0373947_0105249 | 3300035725 | Bacteria | 1778 |
| 108 | Ga0373937_0173161 | 3300036401 | Bacteria | 2025 |
| 109 | Ga0373925_0428550 | 3300037068 | Unclassified | 1081 |
| 110 | Ga0395900_0000770 | 3300037418 | Bacteria | 42662 |
| 111 | Ga0395898_0000955 | 3300037466 | Bacteria | 46041 |
| 112 | Ga0436365_0181654 | 3300039437 | Bacteria | 4503 |
| 113 | Ga0436365_0353181 | 3300039437 | Bacteria | 982 |
| 114 | Ga0436365_1115426 | 3300039437 | Bacteria | 1463 |
| 115 | Ga0436365_1917792 | 3300039437 | Bacteria | 4273 |
| 116 | Ga0436363_0284364 | 3300039450 | Bacteria | 1561 |
| 117 | Ga0436363_0952794 | 3300039450 | Bacteria | 15416 |
| 118 | Ga0436363_1397294 | 3300039450 | Bacteria | 1869 |
| 119 | Ga0436363_1597409 | 3300039450 | Bacteria | 1690 |
| 120 | Ga0436362_0030687 | 3300039453 | Bacteria | 7768 |
| 121 | Ga0436362_0214110 | 3300039453 | Bacteria | 980 |
| 122 | Ga0466969_0020499 | 3300044656 | Bacteria | 3423 |
| 123 | Ga0466965_0033304 | 3300044683 | Bacteria | 2518 |
| 124 | Ga0466966_0159838 | 3300044684 | Bacteria | 1372 |
| 125 | Ga0466963_0094949 | 3300044694 | Bacteria | 2035 |
| 126 | Ga0466963_0312734 | 3300044694 | Bacteria | 1105 |
| 127 | Ga0466968_0014077 | 3300044735 | Bacteria | 3155 |
| 128 | Ga0466968_0069733 | 3300044735 | Bacteria | 1528 |
| 129 | Ga0466957_0198307 | 3300044842 | Bacteria | 1317 |
| 130 | Ga0466959_0040458 | 3300045049 | Bacteria | 3444 |
| 131 | Ga0466959_0618393 | 3300045049 | Bacteria | 728 |
| 132 | Ga0466958_0045667 | 3300045836 | Bacteria | 2643 |
| 133 | Ga0466958_0074469 | 3300045836 | Bacteria | 2081 |
| 134 | Ga0466958_0095282 | 3300045836 | Bacteria | 1845 |
| 135 | Ga0466958_0261226 | 3300045836 | Unclassified | 1108 |
| 136 | Ga0466958_0689710 | 3300045836 | Unclassified | 665 |
| 137 | Ga0495592_0079334 | 3300046454 | Bacteria | 2376 |
| 138 | Ga0495629_0242052 | 3300046459 | Bacteria | 1242 |
| 139 | Ga0495629_0433837 | 3300046459 | Bacteria | 891 |
| 140 | Ga0495651_0471078 | 3300046462 | Bacteria | 808 |
| 141 | Ga0495653_0000551 | 3300046463 | Bacteria | 28652 |
| 142 | Ga0495653_0024254 | 3300046463 | Bacteria | 4891 |
| 143 | Ga0495605_0131815 | 3300046474 | Bacteria | 1127 |
| 144 | Ga0495664_0046619 | 3300046477 | Bacteria | 2572 |
| 145 | Ga0495584_0049773 | 3300046491 | Bacteria | 2111 |
| 146 | Ga0495608_0000897 | 3300046511 | Bacteria | 20877 |
| 147 | Ga0495608_0118343 | 3300046511 | Bacteria | 1700 |
| 148 | Ga0495618_0000076 | 3300046514 | Bacteria | 69851 |
| 149 | Ga0495628_0225279 | 3300046516 | Bacteria | 1407 |
| 150 | Ga0495630_0000233 | 3300046517 | Bacteria | 44258 |
| 151 | Ga0495630_0264962 | 3300046517 | Bacteria | 1313 |
| 152 | Ga0495663_0097672 | 3300046525 | Bacteria | 964 |
| 153 | Ga0495640_0020245 | 3300046533 | Bacteria | 4900 |
| 154 | Ga0495640_0180700 | 3300046533 | Bacteria | 1344 |
| 155 | Ga0495587_0023651 | 3300046536 | Bacteria | 3775 |
| 156 | Ga0495587_0169703 | 3300046536 | Bacteria | 1240 |
| 157 | Ga0495609_0083806 | 3300046538 | Bacteria | 1392 |
| 158 | Ga0495645_0000196 | 3300046543 | Bacteria | 43424 |
| 159 | Ga0495645_0000511 | 3300046543 | Bacteria | 26797 |
| 160 | Ga0495667_0022476 | 3300046559 | Bacteria | 4248 |
| 161 | Ga0495667_0041396 | 3300046559 | Bacteria | 3056 |
| 162 | Ga0495657_0000006 | 3300046675 | Bacteria | 250610 |
| 163 | Ga0495657_0047670 | 3300046675 | Bacteria | 2895 |
| 164 | Ga0495599_0175752 | 3300046678 | Bacteria | 1320 |
| 165 | Ga0495623_0230667 | 3300046679 | Bacteria | 1050 |
| 166 | Ga0495646_0015125 | 3300046680 | Bacteria | 4902 |
| 167 | Ga0495658_0077853 | 3300046683 | Bacteria | 1940 |
| 168 | Ga0495589_0194888 | 3300046794 | Bacteria | 958 |
| 169 | Ga0495600_0082325 | 3300046809 | Bacteria | 2100 |
| 170 | Ga0495604_0000144 | 3300047317 | Bacteria | 61560 |
| 171 | Ga0495604_0044525 | 3300047317 | Bacteria | 3466 |
| 172 | Ga0495676_0036037 | 3300047321 | Bacteria | 4135 |
| 173 | Ga0495680_0006782 | 3300047322 | Bacteria | 10578 |
| 174 | Ga0495680_0399428 | 3300047322 | Unclassified | 949 |
| 175 | Ga0495684_0015073 | 3300047471 | Bacteria | 5953 |
| 176 | Ga0495684_0034774 | 3300047471 | Bacteria | 3866 |
| 177 | Ga0495602_0170082 | 3300048088 | Bacteria | 1692 |
| 178 | Ga0496100_0508788 | 3300048903 | Bacteria | 928 |
| 179 | Ga0496101_0402641 | 3300048904 | Bacteria | 1078 |
| 180 | Ga0496102_0036555 | 3300048905 | Bacteria | 4425 |
| 181 | Ga0496104_0000034 | 3300048907 | Bacteria | 186572 |
| 182 | Ga0496104_0024215 | 3300048907 | Bacteria | 5584 |
| 183 | Ga0496104_0575901 | 3300048907 | Bacteria | 1036 |
| 184 | Ga0496106_0013239 | 3300048909 | Bacteria | 6090 |
| 185 | Ga0496106_0065179 | 3300048909 | Bacteria | 2773 |
| 186 | Ga0496108_0020379 | 3300048911 | Bacteria | 5450 |
| 187 | Ga0496109_0116543 | 3300048912 | Bacteria | 2486 |
| 188 | Ga0496110_0000350 | 3300048913 | Bacteria | 30845 |
| 189 | Ga0496110_0000784 | 3300048913 | Bacteria | 22147 |
| 190 | Ga0496110_0237217 | 3300048913 | Bacteria | 1659 |
| 191 | Ga0496111_0001739 | 3300048914 | Bacteria | 12745 |
| 192 | Ga0496111_0156680 | 3300048914 | Bacteria | 1690 |
| 193 | Ga0496112_0073492 | 3300048915 | Bacteria | 3380 |
| 194 | Ga0496113_0089921 | 3300048916 | Bacteria | 2364 |
| 195 | Ga0496115_0000232 | 3300048918 | Bacteria | 50769 |
| 196 | Ga0496115_0000429 | 3300048918 | Bacteria | 34014 |
| 197 | Ga0496115_0104326 | 3300048918 | Bacteria | 2327 |
| 198 | Ga0496115_0381397 | 3300048918 | Bacteria | 1146 |
| 199 | Ga0496115_0537329 | 3300048918 | Bacteria | 936 |
| 200 | nmdc:mga09592_5175_c1 | 3300050508 | Bacteria | 10599 |
| 201 | nmdc:mga0n895_2415_c1 | 3300050512 | Bacteria | 14567 |
| 202 | nmdc:mga0rr50_23801_c1 | 3300050513 | Bacteria | 4232 |
| 203 | nmdc:mga0a205_1597_c2 | 3300050515 | Bacteria | 18093 |
| 204 | Ga0495601_0000121 | 3300053077 | Bacteria | 43462 |
| 205 | Ga0495612_0000141 | 3300053078 | Bacteria | 30417 |
| 206 | Ga0495619_0077776 | 3300053085 | Bacteria | 2229 |
| 207 | Ga0495619_0313041 | 3300053085 | Bacteria | 1087 |
| 208 | Ga0466962_0009704 | 3300061719 | Bacteria | 4619 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039453 | Ga0436362_0214110 | Ga0436362_0214110_322_888 | 188 |
| 2 | 3300005437 | Ga0070710_10000008 | Ga0070710_10000008177 | 195 |
| 3 | 3300025898 | Ga0207692_10000006 | Ga0207692_10000006174 | 195 |
| 4 | 3300028558 | Ga0265326_10000010 | Ga0265326_1000001065 | 199 |
| 5 | 3300028573 | Ga0265334_10000003 | Ga0265334_10000003113 | 199 |
| 6 | 3300028800 | Ga0265338_10004818 | Ga0265338_1000481818 | 199 |
| 7 | 3300031240 | Ga0265320_10125943 | Ga0265320_101259432 | 199 |
| 8 | 3300028563 | Ga0265319_1003420 | Ga0265319_10034202 | 200 |
| 9 | 3300028800 | Ga0265338_10561175 | Ga0265338_105611751 | 200 |
| 10 | 3300039450 | Ga0436363_1397294 | Ga0436363_1397294_1211_1843 | 200 |
| 11 | 3300028800 | Ga0265338_10221179 | Ga0265338_102211791 | 201 |
| 12 | 3300045836 | Ga0466958_0689710 | Ga0466958_0689710_13_642 | 201 |
| 13 | 3300006880 | Ga0075429_100008885 | Ga0075429_1000088856 | 205 |
| 14 | 3300046462 | Ga0495651_0471078 | Ga0495651_0471078_123_782 | 205 |
| 15 | 3300050508 | nmdc:mga09592_5175_c1 | nmdc:mga09592_5175_c1_4197_4883 | 205 |
| 16 | 3300005440 | Ga0070705_100000935 | Ga0070705_1000009352 | 208 |
| 17 | 3300046794 | Ga0495589_0194888 | Ga0495589_0194888_18_656 | 208 |
| 18 | 3300046683 | Ga0495658_0077853 | Ga0495658_0077853_878_1531 | 210 |
| 19 | 3300005434 | Ga0070709_10147039 | Ga0070709_101470392 | 212 |
| 20 | 3300005435 | Ga0070714_100172643 | Ga0070714_1001726433 | 212 |
| 21 | 3300005435 | Ga0070714_100369403 | Ga0070714_1003694032 | 212 |
| 22 | 3300005436 | Ga0070713_100088603 | Ga0070713_1000886031 | 212 |
| 23 | 3300005436 | Ga0070713_100144640 | Ga0070713_1001446402 | 212 |
| 24 | 3300006173 | Ga0070716_100041914 | Ga0070716_1000419141 | 212 |
| 25 | 3300006175 | Ga0070712_100020819 | Ga0070712_1000208193 | 212 |
| 26 | 3300031901 | Ga0307406_10208087 | Ga0307406_102080872 | 212 |
| 27 | 3300037418 | Ga0395900_0000770 | Ga0395900_0000770_31560_32252 | 212 |
| 28 | 3300037466 | Ga0395898_0000955 | Ga0395898_0000955_21733_22425 | 212 |
| 29 | 3300044656 | Ga0466969_0020499 | Ga0466969_0020499_2102_2794 | 212 |
| 30 | 3300044684 | Ga0466966_0159838 | Ga0466966_0159838_481_1173 | 212 |
| 31 | 3300045049 | Ga0466959_0040458 | Ga0466959_0040458_252_944 | 212 |
| 32 | 3300045836 | Ga0466958_0095282 | Ga0466958_0095282_393_1085 | 212 |
| 33 | 3300005614 | Ga0068856_100252372 | Ga0068856_1002523722 | 213 |
| 34 | 3300025906 | Ga0207699_10154321 | Ga0207699_101543211 | 213 |
| 35 | 3300025915 | Ga0207693_10003354 | Ga0207693_100033549 | 213 |
| 36 | 3300025928 | Ga0207700_10146760 | Ga0207700_101467601 | 213 |
| 37 | 3300025928 | Ga0207700_10193208 | Ga0207700_101932081 | 213 |
| 38 | 3300025929 | Ga0207664_10000523 | Ga0207664_1000052326 | 213 |
| 39 | 3300025939 | Ga0207665_10116940 | Ga0207665_101169402 | 213 |
| 40 | 3300026078 | Ga0207702_10306796 | Ga0207702_103067962 | 213 |
| 41 | 3300035410 | Ga0373924_0032220 | Ga0373924_0032220_166_867 | 213 |
| 42 | 3300036401 | Ga0373937_0173161 | Ga0373937_0173161_546_1247 | 213 |
| 43 | 3300046454 | Ga0495592_0079334 | Ga0495592_0079334_1165_1866 | 213 |
| 44 | 3300046459 | Ga0495629_0242052 | Ga0495629_0242052_136_837 | 213 |
| 45 | 3300046463 | Ga0495653_0024254 | Ga0495653_0024254_1954_2655 | 213 |
| 46 | 3300046477 | Ga0495664_0046619 | Ga0495664_0046619_1850_2551 | 213 |
| 47 | 3300046511 | Ga0495608_0000897 | Ga0495608_0000897_18877_19578 | 213 |
| 48 | 3300046516 | Ga0495628_0225279 | Ga0495628_0225279_506_1207 | 213 |
| 49 | 3300046517 | Ga0495630_0264962 | Ga0495630_0264962_483_1184 | 213 |
| 50 | 3300046533 | Ga0495640_0180700 | Ga0495640_0180700_508_1209 | 213 |
| 51 | 3300046536 | Ga0495587_0023651 | Ga0495587_0023651_507_1208 | 213 |
| 52 | 3300046559 | Ga0495667_0022476 | Ga0495667_0022476_2975_3676 | 213 |
| 53 | 3300046675 | Ga0495657_0047670 | Ga0495657_0047670_1986_2687 | 213 |
| 54 | 3300046678 | Ga0495599_0175752 | Ga0495599_0175752_141_842 | 213 |
| 55 | 3300046679 | Ga0495623_0230667 | Ga0495623_0230667_306_1007 | 213 |
| 56 | 3300046680 | Ga0495646_0015125 | Ga0495646_0015125_1574_2275 | 213 |
| 57 | 3300047317 | Ga0495604_0044525 | Ga0495604_0044525_2307_3008 | 213 |
| 58 | 3300047322 | Ga0495680_0006782 | Ga0495680_0006782_7563_8264 | 213 |
| 59 | 3300048088 | Ga0495602_0170082 | Ga0495602_0170082_459_1160 | 213 |
| 60 | 3300048907 | Ga0496104_0024215 | Ga0496104_0024215_3417_4118 | 213 |
| 61 | 3300048909 | Ga0496106_0013239 | Ga0496106_0013239_196_846 | 213 |
| 62 | 3300053085 | Ga0495619_0077776 | Ga0495619_0077776_865_1566 | 213 |
| 63 | 3300048918 | Ga0496115_0381397 | Ga0496115_0381397_95_796 | 214 |
| 64 | 3300044735 | Ga0466968_0014077 | Ga0466968_0014077_2356_3054 | 215 |
| 65 | 3300045049 | Ga0466959_0618393 | Ga0466959_0618393_16_714 | 215 |
| 66 | 3300039437 | Ga0436365_0353181 | Ga0436365_0353181_162_890 | 216 |
| 67 | 3300005435 | Ga0070714_100010093 | Ga0070714_1000100937 | 218 |
| 68 | 3300005468 | Ga0070707_100087218 | Ga0070707_1000872183 | 218 |
| 69 | 3300044694 | Ga0466963_0312734 | Ga0466963_0312734_113_832 | 218 |
| 70 | 3300039437 | Ga0436365_1115426 | Ga0436365_1115426_323_1084 | 219 |
| 71 | 3300044683 | Ga0466965_0033304 | Ga0466965_0033304_508_1191 | 219 |
| 72 | 3300044735 | Ga0466968_0069733 | Ga0466968_0069733_239_922 | 219 |
| 73 | 3300005435 | Ga0070714_100000315 | Ga0070714_1000003156 | 222 |
| 74 | 3300014326 | Ga0157380_10701361 | Ga0157380_107013611 | 222 |
| 75 | 3300025929 | Ga0207664_10000006 | Ga0207664_10000006395 | 222 |
| 76 | 3300026075 | Ga0207708_10212733 | Ga0207708_102127332 | 222 |
| 77 | 3300039450 | Ga0436363_0284364 | Ga0436363_0284364_223_933 | 222 |
| 78 | 3300045836 | Ga0466958_0261226 | Ga0466958_0261226_416_1096 | 222 |
| 79 | 3300005339 | Ga0070660_100057854 | Ga0070660_1000578542 | 223 |
| 80 | 3300005345 | Ga0070692_10002583 | Ga0070692_100025838 | 223 |
| 81 | 3300005366 | Ga0070659_100000026 | Ga0070659_10000002610 | 223 |
| 82 | 3300005435 | Ga0070714_100229186 | Ga0070714_1002291862 | 223 |
| 83 | 3300005439 | Ga0070711_100046668 | Ga0070711_1000466682 | 223 |
| 84 | 3300006028 | Ga0070717_10523166 | Ga0070717_105231662 | 223 |
| 85 | 3300009148 | Ga0105243_11062723 | Ga0105243_110627231 | 223 |
| 86 | 3300025916 | Ga0207663_10040760 | Ga0207663_100407604 | 223 |
| 87 | 3300025919 | Ga0207657_10068188 | Ga0207657_100681883 | 223 |
| 88 | 3300025929 | Ga0207664_10203317 | Ga0207664_102033172 | 223 |
| 89 | 3300025932 | Ga0207690_10001474 | Ga0207690_100014745 | 223 |
| 90 | 3300031251 | Ga0265327_10089147 | Ga0265327_100891472 | 223 |
| 91 | 3300045836 | Ga0466958_0074469 | Ga0466958_0074469_630_1337 | 223 |
| 92 | 3300046463 | Ga0495653_0000551 | Ga0495653_0000551_799_1518 | 223 |
| 93 | 3300046514 | Ga0495618_0000076 | Ga0495618_0000076_58208_58927 | 223 |
| 94 | 3300046517 | Ga0495630_0000233 | Ga0495630_0000233_31466_32194 | 223 |
| 95 | 3300046543 | Ga0495645_0000196 | Ga0495645_0000196_10089_10808 | 223 |
| 96 | 3300046675 | Ga0495657_0000006 | Ga0495657_0000006_64402_65130 | 223 |
| 97 | 3300047471 | Ga0495684_0034774 | Ga0495684_0034774_209_937 | 223 |
| 98 | 3300053077 | Ga0495601_0000121 | Ga0495601_0000121_35412_36131 | 223 |
| 99 | 3300053078 | Ga0495612_0000141 | Ga0495612_0000141_8391_9143 | 223 |
| 100 | 3300005353 | Ga0070669_100107521 | Ga0070669_1001075211 | 224 |
| 101 | 3300005719 | Ga0068861_100173423 | Ga0068861_1001734232 | 224 |
| 102 | 3300005981 | Ga0081538_10008221 | Ga0081538_100082215 | 224 |
| 103 | 3300005981 | Ga0081538_10030778 | Ga0081538_100307783 | 224 |
| 104 | 3300005981 | Ga0081538_10055208 | Ga0081538_100552084 | 224 |
| 105 | 3300014969 | Ga0157376_10105431 | Ga0157376_101054312 | 224 |
| 106 | 3300025915 | Ga0207693_10099732 | Ga0207693_100997322 | 224 |
| 107 | 3300025923 | Ga0207681_10001784 | Ga0207681_1000178412 | 224 |
| 108 | 3300025944 | Ga0207661_10101586 | Ga0207661_101015863 | 224 |
| 109 | 3300031731 | Ga0307405_10105370 | Ga0307405_101053702 | 224 |
| 110 | 3300031824 | Ga0307413_10109702 | Ga0307413_101097022 | 224 |
| 111 | 3300031852 | Ga0307410_10018635 | Ga0307410_100186356 | 224 |
| 112 | 3300031852 | Ga0307410_10342557 | Ga0307410_103425572 | 224 |
| 113 | 3300031901 | Ga0307406_10070510 | Ga0307406_100705102 | 224 |
| 114 | 3300031903 | Ga0307407_10129248 | Ga0307407_101292482 | 224 |
| 115 | 3300031911 | Ga0307412_10550523 | Ga0307412_105505232 | 224 |
| 116 | 3300031995 | Ga0307409_100034166 | Ga0307409_1000341662 | 224 |
| 117 | 3300031995 | Ga0307409_100471775 | Ga0307409_1004717752 | 224 |
| 118 | 3300032002 | Ga0307416_100011147 | Ga0307416_1000111475 | 224 |
| 119 | 3300032002 | Ga0307416_100013530 | Ga0307416_1000135304 | 224 |
| 120 | 3300032126 | Ga0307415_100000250 | Ga0307415_10000025019 | 224 |
| 121 | 3300044694 | Ga0466963_0094949 | Ga0466963_0094949_470_1156 | 224 |
| 122 | 3300048907 | Ga0496104_0575901 | Ga0496104_0575901_296_982 | 224 |
| 123 | 3300048912 | Ga0496109_0116543 | Ga0496109_0116543_1747_2439 | 224 |
| 124 | 3300032126 | Ga0307415_100266357 | Ga0307415_1002663571 | 225 |
| 125 | 3300044842 | Ga0466957_0198307 | Ga0466957_0198307_14_703 | 225 |
| 126 | 3300045836 | Ga0466958_0045667 | Ga0466958_0045667_1839_2528 | 225 |
| 127 | 3300061719 | Ga0466962_0009704 | Ga0466962_0009704_2042_2731 | 225 |
| 128 | 3300005334 | Ga0068869_100342553 | Ga0068869_1003425532 | 226 |
| 129 | 3300005434 | Ga0070709_10251822 | Ga0070709_102518222 | 226 |
| 130 | 3300005435 | Ga0070714_100680226 | Ga0070714_1006802262 | 226 |
| 131 | 3300005439 | Ga0070711_100196787 | Ga0070711_1001967872 | 226 |
| 132 | 3300005937 | Ga0081455_10021269 | Ga0081455_100212694 | 226 |
| 133 | 3300005983 | Ga0081540_1000314 | Ga0081540_100031418 | 226 |
| 134 | 3300005985 | Ga0081539_10008852 | Ga0081539_100088521 | 226 |
| 135 | 3300006028 | Ga0070717_10000204 | Ga0070717_1000020411 | 226 |
| 136 | 3300006175 | Ga0070712_100000153 | Ga0070712_10000015340 | 226 |
| 137 | 3300006175 | Ga0070712_100319258 | Ga0070712_1003192582 | 226 |
| 138 | 3300006852 | Ga0075433_10001378 | Ga0075433_1000137814 | 226 |
| 139 | 3300006871 | Ga0075434_100029421 | Ga0075434_1000294212 | 226 |
| 140 | 3300007076 | Ga0075435_100005134 | Ga0075435_1000051344 | 226 |
| 141 | 3300013307 | Ga0157372_10502068 | Ga0157372_105020682 | 226 |
| 142 | 3300013308 | Ga0157375_10372200 | Ga0157375_103722002 | 226 |
| 143 | 3300021377 | Ga0213874_10001301 | Ga0213874_100013012 | 226 |
| 144 | 3300021384 | Ga0213876_10032272 | Ga0213876_100322722 | 226 |
| 145 | 3300021384 | Ga0213876_10060857 | Ga0213876_100608572 | 226 |
| 146 | 3300025906 | Ga0207699_10348023 | Ga0207699_103480232 | 226 |
| 147 | 3300025913 | Ga0207695_10065940 | Ga0207695_100659402 | 226 |
| 148 | 3300025914 | Ga0207671_10003645 | Ga0207671_1000364512 | 226 |
| 149 | 3300025915 | Ga0207693_10000487 | Ga0207693_100004872 | 226 |
| 150 | 3300025915 | Ga0207693_10011589 | Ga0207693_100115894 | 226 |
| 151 | 3300025929 | Ga0207664_10238857 | Ga0207664_102388572 | 226 |
| 152 | 3300025942 | Ga0207689_10377537 | Ga0207689_103775372 | 226 |
| 153 | 3300025945 | Ga0207679_10493511 | Ga0207679_104935112 | 226 |
| 154 | 3300026078 | Ga0207702_10231443 | Ga0207702_102314432 | 226 |
| 155 | 3300026088 | Ga0207641_10489078 | Ga0207641_104890782 | 226 |
| 156 | 3300028556 | Ga0265337_1048391 | Ga0265337_10483912 | 226 |
| 157 | 3300028558 | Ga0265326_10003486 | Ga0265326_100034862 | 226 |
| 158 | 3300028563 | Ga0265319_1000612 | Ga0265319_10006122 | 226 |
| 159 | 3300028666 | Ga0265336_10000001 | Ga0265336_10000001103 | 226 |
| 160 | 3300028800 | Ga0265338_10000228 | Ga0265338_1000022810 | 226 |
| 161 | 3300031247 | Ga0265340_10000005 | Ga0265340_10000005103 | 226 |
| 162 | 3300031344 | Ga0265316_10111107 | Ga0265316_101111071 | 226 |
| 163 | 3300031901 | Ga0307406_10165708 | Ga0307406_101657082 | 226 |
| 164 | 3300035692 | Ga0373935_0074631 | Ga0373935_0074631_32_739 | 226 |
| 165 | 3300035695 | Ga0373927_0291121 | Ga0373927_0291121_204_911 | 226 |
| 166 | 3300035725 | Ga0373947_0105249 | Ga0373947_0105249_896_1597 | 226 |
| 167 | 3300037068 | Ga0373925_0428550 | Ga0373925_0428550_174_908 | 226 |
| 168 | 3300039437 | Ga0436365_0181654 | Ga0436365_0181654_2397_3092 | 226 |
| 169 | 3300039437 | Ga0436365_1917792 | Ga0436365_1917792_1668_2402 | 226 |
| 170 | 3300039450 | Ga0436363_0952794 | Ga0436363_0952794_2514_3209 | 226 |
| 171 | 3300039450 | Ga0436363_1597409 | Ga0436363_1597409_121_837 | 226 |
| 172 | 3300039453 | Ga0436362_0030687 | Ga0436362_0030687_6288_7022 | 226 |
| 173 | 3300046459 | Ga0495629_0433837 | Ga0495629_0433837_103_804 | 226 |
| 174 | 3300046474 | Ga0495605_0131815 | Ga0495605_0131815_207_902 | 226 |
| 175 | 3300046491 | Ga0495584_0049773 | Ga0495584_0049773_348_1043 | 226 |
| 176 | 3300046511 | Ga0495608_0118343 | Ga0495608_0118343_898_1629 | 226 |
| 177 | 3300046525 | Ga0495663_0097672 | Ga0495663_0097672_80_775 | 226 |
| 178 | 3300046533 | Ga0495640_0020245 | Ga0495640_0020245_4138_4839 | 226 |
| 179 | 3300046536 | Ga0495587_0169703 | Ga0495587_0169703_437_1138 | 226 |
| 180 | 3300046538 | Ga0495609_0083806 | Ga0495609_0083806_503_1198 | 226 |
| 181 | 3300046543 | Ga0495645_0000511 | Ga0495645_0000511_19235_19954 | 226 |
| 182 | 3300046559 | Ga0495667_0041396 | Ga0495667_0041396_1851_2552 | 226 |
| 183 | 3300046809 | Ga0495600_0082325 | Ga0495600_0082325_1089_1790 | 226 |
| 184 | 3300047317 | Ga0495604_0000144 | Ga0495604_0000144_30770_31486 | 226 |
| 185 | 3300047321 | Ga0495676_0036037 | Ga0495676_0036037_1155_1889 | 226 |
| 186 | 3300047322 | Ga0495680_0399428 | Ga0495680_0399428_19_720 | 226 |
| 187 | 3300047471 | Ga0495684_0015073 | Ga0495684_0015073_2420_3142 | 226 |
| 188 | 3300048903 | Ga0496100_0508788 | Ga0496100_0508788_78_860 | 226 |
| 189 | 3300048904 | Ga0496101_0402641 | Ga0496101_0402641_34_741 | 226 |
| 190 | 3300048905 | Ga0496102_0036555 | Ga0496102_0036555_2847_3554 | 226 |
| 191 | 3300048907 | Ga0496104_0000034 | Ga0496104_0000034_100903_101619 | 226 |
| 192 | 3300048909 | Ga0496106_0065179 | Ga0496106_0065179_1713_2420 | 226 |
| 193 | 3300048911 | Ga0496108_0020379 | Ga0496108_0020379_1012_1719 | 226 |
| 194 | 3300048913 | Ga0496110_0000350 | Ga0496110_0000350_5305_6012 | 226 |
| 195 | 3300048913 | Ga0496110_0000784 | Ga0496110_0000784_20305_21021 | 226 |
| 196 | 3300048913 | Ga0496110_0237217 | Ga0496110_0237217_697_1404 | 226 |
| 197 | 3300048914 | Ga0496111_0001739 | Ga0496111_0001739_7285_8001 | 226 |
| 198 | 3300048914 | Ga0496111_0156680 | Ga0496111_0156680_571_1278 | 226 |
| 199 | 3300048915 | Ga0496112_0073492 | Ga0496112_0073492_2627_3334 | 226 |
| 200 | 3300048916 | Ga0496113_0089921 | Ga0496113_0089921_310_1017 | 226 |
| 201 | 3300048918 | Ga0496115_0000232 | Ga0496115_0000232_41182_41964 | 226 |
| 202 | 3300048918 | Ga0496115_0000429 | Ga0496115_0000429_29446_30228 | 226 |
| 203 | 3300048918 | Ga0496115_0104326 | Ga0496115_0104326_1242_1949 | 226 |
| 204 | 3300048918 | Ga0496115_0537329 | Ga0496115_0537329_15_752 | 226 |
| 205 | 3300050512 | nmdc:mga0n895_2415_c1 | nmdc:mga0n895_2415_c1_13399_14127 | 226 |
| 206 | 3300050513 | nmdc:mga0rr50_23801_c1 | nmdc:mga0rr50_23801_c1_902_1630 | 226 |
| 207 | 3300050515 | nmdc:mga0a205_1597_c2 | nmdc:mga0a205_1597_c2_11198_11926 | 226 |
| 208 | 3300053085 | Ga0495619_0313041 | Ga0495619_0313041_34_765 | 226 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1gz0-assembly4.cif.gz_E | 23s ribosomal rna g2251 2'o-methyltransferase rlmb | 0.9573 | 63 | 223 |
| 1gz0-assembly4.cif.gz_E | 23s ribosomal rna g2251 2'o-methyltransferase rlmb | 0.924 | 63 | 223 |
| 2ha8-assembly1.cif.gz_B | methyltransferase domain of human tar (hiv-1) rna binding protein 1 | 0.8975 | 77 | 222 |
| 5co4-assembly1.cif.gz_A | structural insights into the 2-oh methylation of c/u34 on trna | 0.8952 | 75 | 226 |
| 5co4-assembly1.cif.gz_A | structural insights into the 2-oh methylation of c/u34 on trna | 0.8788 | 75 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WFY5_148_322_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9578 | 69 | 226 | 3.40.1280.10 |
| af_Q2G2M3_73_246_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9508 | 60 | 222 | 3.40.1280.10 |
| af_Q76NT0_373_525_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9389 | 76 | 220 | 3.40.1280.10 |
| af_P9WFY3_121_283_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9363 | 68 | 223 | 3.40.1280.10 |
| af_P25270_234_411_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9288 | 76 | 220 | 3.40.1280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-R7HLT5-F1-model_v4 | RNA methyltransferase TrmH family group 3 | 0.9738 | 78 | 224 |
GO:0003723
GO:0005829 GO:0006396 GO:0008173 GO:0032259 |
| AF-A0A3E2D6Q3-F1-model_v4 | deleted | 0.9723 | 81 | 224 |
|
| AF-A0A3A5IZ75-F1-model_v4 | deleted | 0.9713 | 79 | 222 |
|
| AF-A0A1F4U3W0-F1-model_v4 | 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB | 0.9693 | 75 | 224 |
GO:0003723
GO:0005829 GO:0006396 GO:0008173 GO:0032259 |
| AF-A0A1F9D5I0-F1-model_v4 | 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB | 0.9689 | 78 | 224 |
GO:0003723
GO:0005829 GO:0006396 GO:0008173 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar