F318338

General Info

Members Datasets Scaffolds Average Seq Length
208 137 208 230

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0000232|Ga0496115_0000232_41182_41964
Length 260
Sequence VILYGRNPVFEALRGRRANAVKDVWATAPAAREPWLKAARPRIVTSEEIERRCGSSAHQGVCADAGAYPYVSAEQLLAGREPLIVALDQVQDPQNLGSICRSAECAGAAGVVIPERRAAEVTPAVCKASAGAVEHLTLARVRNIADFLAQAREAGCWCYGASGEQDRAQAVQAEAQGGTRPGRGARAPIPYDRPDYAGAGVVLVLGSEGSGLRPRVAGACDELVALPLLGRIESLGVSAAAAAILYEILQSRAAGLDNSP

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
32 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
33 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
52 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
53 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
54 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
55 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
71 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
72 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
80 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
81 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
82 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
96 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
97 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
108 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
109 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
136 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
137 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.58
Rhizosphere 84.13
Stem 0
Stem Tuber 0
Unclassified 5.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100342553 3300005334 Bacteria 1217
2 Ga0070660_100057854 3300005339 Bacteria 3005
3 Ga0070692_10002583 3300005345 Bacteria 7058
4 Ga0070669_100107521 3300005353 Bacteria 2113
5 Ga0070659_100000026 3300005366 Bacteria 143542
6 Ga0070709_10147039 3300005434 Bacteria 1625
7 Ga0070709_10251822 3300005434 Bacteria 1273
8 Ga0070714_100000315 3300005435 Bacteria 36636
9 Ga0070714_100010093 3300005435 Bacteria 7452
10 Ga0070714_100172643 3300005435 Bacteria 1963
11 Ga0070714_100229186 3300005435 Bacteria 1711
12 Ga0070714_100369403 3300005435 Bacteria 1350
13 Ga0070714_100680226 3300005435 Bacteria 992
14 Ga0070713_100088603 3300005436 Bacteria 2656
15 Ga0070713_100144640 3300005436 Bacteria 2109
16 Ga0070710_10000008 3300005437 Bacteria 198148
17 Ga0070711_100046668 3300005439 Bacteria 2953
18 Ga0070711_100196787 3300005439 Bacteria 1553
19 Ga0070705_100000935 3300005440 Bacteria 16369
20 Ga0070707_100087218 3300005468 Bacteria 3019
21 Ga0068856_100252372 3300005614 Bacteria 1779
22 Ga0068861_100173423 3300005719 Bacteria 1789
23 Ga0081455_10021269 3300005937 Bacteria 6087
24 Ga0081538_10008221 3300005981 Bacteria 8896
25 Ga0081538_10030778 3300005981 Bacteria 3635
26 Ga0081538_10055208 3300005981 Bacteria 2341
27 Ga0081540_1000314 3300005983 Bacteria 50231
28 Ga0081539_10008852 3300005985 Bacteria 8606
29 Ga0070717_10000204 3300006028 Bacteria 41488
30 Ga0070717_10523166 3300006028 Unclassified 1073
31 Ga0070716_100041914 3300006173 Bacteria 2553
32 Ga0070712_100000153 3300006175 Bacteria 36937
33 Ga0070712_100020819 3300006175 Bacteria 4297
34 Ga0070712_100319258 3300006175 Bacteria 1262
35 Ga0075433_10001378 3300006852 Bacteria 17864
36 Ga0075434_100029421 3300006871 Bacteria 5405
37 Ga0075429_100008885 3300006880 Bacteria 8735
38 Ga0075435_100005134 3300007076 Bacteria 9101
39 Ga0105243_11062723 3300009148 Bacteria 816
40 Ga0157372_10502068 3300013307 Bacteria 1414
41 Ga0157375_10372200 3300013308 Bacteria 1595
42 Ga0157380_10701361 3300014326 Bacteria 1017
43 Ga0157376_10105431 3300014969 Bacteria 2472
44 Ga0213874_10001301 3300021377 Bacteria 5161
45 Ga0213876_10032272 3300021384 Bacteria 2763
46 Ga0213876_10060857 3300021384 Bacteria 1992
47 Ga0207692_10000006 3300025898 Bacteria 294686
48 Ga0207699_10154321 3300025906 Bacteria 1522
49 Ga0207699_10348023 3300025906 Bacteria 1045
50 Ga0207695_10065940 3300025913 Bacteria 3720
51 Ga0207671_10003645 3300025914 Bacteria 15209
52 Ga0207693_10000487 3300025915 Bacteria 35985
53 Ga0207693_10003354 3300025915 Bacteria 13689
54 Ga0207693_10011589 3300025915 Bacteria 7132
55 Ga0207693_10099732 3300025915 Bacteria 2277
56 Ga0207663_10040760 3300025916 Bacteria 2825
57 Ga0207657_10068188 3300025919 Bacteria 3022
58 Ga0207681_10001784 3300025923 Bacteria 13814
59 Ga0207700_10146760 3300025928 Bacteria 1945
60 Ga0207700_10193208 3300025928 Bacteria 1711
61 Ga0207664_10000006 3300025929 Bacteria 408702
62 Ga0207664_10000523 3300025929 Bacteria 27344
63 Ga0207664_10203317 3300025929 Bacteria 1711
64 Ga0207664_10238857 3300025929 Bacteria 1582
65 Ga0207690_10001474 3300025932 Bacteria 14697
66 Ga0207665_10116940 3300025939 Bacteria 1880
67 Ga0207689_10377537 3300025942 Bacteria 1180
68 Ga0207661_10101586 3300025944 Bacteria 2416
69 Ga0207679_10493511 3300025945 Bacteria 1092
70 Ga0207708_10212733 3300026075 Bacteria 1546
71 Ga0207702_10231443 3300026078 Bacteria 1727
72 Ga0207702_10306796 3300026078 Bacteria 1508
73 Ga0207641_10489078 3300026088 Bacteria 1194
74 Ga0265337_1048391 3300028556 Bacteria 1203
75 Ga0265326_10000010 3300028558 Bacteria 184218
76 Ga0265326_10003486 3300028558 Bacteria 5141
77 Ga0265319_1000612 3300028563 Bacteria 23646
78 Ga0265319_1003420 3300028563 Bacteria 8278
79 Ga0265334_10000003 3300028573 Bacteria 244354
80 Ga0265336_10000001 3300028666 Bacteria 916179
81 Ga0265338_10000228 3300028800 Bacteria 104553
82 Ga0265338_10004818 3300028800 Bacteria 18040
83 Ga0265338_10221179 3300028800 Bacteria 1414
84 Ga0265338_10561175 3300028800 Bacteria 798
85 Ga0265320_10125943 3300031240 Bacteria 1165
86 Ga0265340_10000005 3300031247 Bacteria 204570
87 Ga0265327_10089147 3300031251 Bacteria 1507
88 Ga0265316_10111107 3300031344 Bacteria 2075
89 Ga0307405_10105370 3300031731 Bacteria 1899
90 Ga0307413_10109702 3300031824 Bacteria 1845
91 Ga0307410_10018635 3300031852 Bacteria 4199
92 Ga0307410_10342557 3300031852 Bacteria 1192
93 Ga0307406_10070510 3300031901 Bacteria 2289
94 Ga0307406_10165708 3300031901 Bacteria 1594
95 Ga0307406_10208087 3300031901 Bacteria 1445
96 Ga0307407_10129248 3300031903 Bacteria 1613
97 Ga0307412_10550523 3300031911 Bacteria 969
98 Ga0307409_100034166 3300031995 Bacteria 3709
99 Ga0307409_100471775 3300031995 Bacteria 1216
100 Ga0307416_100011147 3300032002 Bacteria 5979
101 Ga0307416_100013530 3300032002 Bacteria 5550
102 Ga0307415_100000250 3300032126 Bacteria 23226
103 Ga0307415_100266357 3300032126 Bacteria 1401
104 Ga0373924_0032220 3300035410 Bacteria 2111
105 Ga0373935_0074631 3300035692 Bacteria 2193
106 Ga0373927_0291121 3300035695 Bacteria 1075
107 Ga0373947_0105249 3300035725 Bacteria 1778
108 Ga0373937_0173161 3300036401 Bacteria 2025
109 Ga0373925_0428550 3300037068 Unclassified 1081
110 Ga0395900_0000770 3300037418 Bacteria 42662
111 Ga0395898_0000955 3300037466 Bacteria 46041
112 Ga0436365_0181654 3300039437 Bacteria 4503
113 Ga0436365_0353181 3300039437 Bacteria 982
114 Ga0436365_1115426 3300039437 Bacteria 1463
115 Ga0436365_1917792 3300039437 Bacteria 4273
116 Ga0436363_0284364 3300039450 Bacteria 1561
117 Ga0436363_0952794 3300039450 Bacteria 15416
118 Ga0436363_1397294 3300039450 Bacteria 1869
119 Ga0436363_1597409 3300039450 Bacteria 1690
120 Ga0436362_0030687 3300039453 Bacteria 7768
121 Ga0436362_0214110 3300039453 Bacteria 980
122 Ga0466969_0020499 3300044656 Bacteria 3423
123 Ga0466965_0033304 3300044683 Bacteria 2518
124 Ga0466966_0159838 3300044684 Bacteria 1372
125 Ga0466963_0094949 3300044694 Bacteria 2035
126 Ga0466963_0312734 3300044694 Bacteria 1105
127 Ga0466968_0014077 3300044735 Bacteria 3155
128 Ga0466968_0069733 3300044735 Bacteria 1528
129 Ga0466957_0198307 3300044842 Bacteria 1317
130 Ga0466959_0040458 3300045049 Bacteria 3444
131 Ga0466959_0618393 3300045049 Bacteria 728
132 Ga0466958_0045667 3300045836 Bacteria 2643
133 Ga0466958_0074469 3300045836 Bacteria 2081
134 Ga0466958_0095282 3300045836 Bacteria 1845
135 Ga0466958_0261226 3300045836 Unclassified 1108
136 Ga0466958_0689710 3300045836 Unclassified 665
137 Ga0495592_0079334 3300046454 Bacteria 2376
138 Ga0495629_0242052 3300046459 Bacteria 1242
139 Ga0495629_0433837 3300046459 Bacteria 891
140 Ga0495651_0471078 3300046462 Bacteria 808
141 Ga0495653_0000551 3300046463 Bacteria 28652
142 Ga0495653_0024254 3300046463 Bacteria 4891
143 Ga0495605_0131815 3300046474 Bacteria 1127
144 Ga0495664_0046619 3300046477 Bacteria 2572
145 Ga0495584_0049773 3300046491 Bacteria 2111
146 Ga0495608_0000897 3300046511 Bacteria 20877
147 Ga0495608_0118343 3300046511 Bacteria 1700
148 Ga0495618_0000076 3300046514 Bacteria 69851
149 Ga0495628_0225279 3300046516 Bacteria 1407
150 Ga0495630_0000233 3300046517 Bacteria 44258
151 Ga0495630_0264962 3300046517 Bacteria 1313
152 Ga0495663_0097672 3300046525 Bacteria 964
153 Ga0495640_0020245 3300046533 Bacteria 4900
154 Ga0495640_0180700 3300046533 Bacteria 1344
155 Ga0495587_0023651 3300046536 Bacteria 3775
156 Ga0495587_0169703 3300046536 Bacteria 1240
157 Ga0495609_0083806 3300046538 Bacteria 1392
158 Ga0495645_0000196 3300046543 Bacteria 43424
159 Ga0495645_0000511 3300046543 Bacteria 26797
160 Ga0495667_0022476 3300046559 Bacteria 4248
161 Ga0495667_0041396 3300046559 Bacteria 3056
162 Ga0495657_0000006 3300046675 Bacteria 250610
163 Ga0495657_0047670 3300046675 Bacteria 2895
164 Ga0495599_0175752 3300046678 Bacteria 1320
165 Ga0495623_0230667 3300046679 Bacteria 1050
166 Ga0495646_0015125 3300046680 Bacteria 4902
167 Ga0495658_0077853 3300046683 Bacteria 1940
168 Ga0495589_0194888 3300046794 Bacteria 958
169 Ga0495600_0082325 3300046809 Bacteria 2100
170 Ga0495604_0000144 3300047317 Bacteria 61560
171 Ga0495604_0044525 3300047317 Bacteria 3466
172 Ga0495676_0036037 3300047321 Bacteria 4135
173 Ga0495680_0006782 3300047322 Bacteria 10578
174 Ga0495680_0399428 3300047322 Unclassified 949
175 Ga0495684_0015073 3300047471 Bacteria 5953
176 Ga0495684_0034774 3300047471 Bacteria 3866
177 Ga0495602_0170082 3300048088 Bacteria 1692
178 Ga0496100_0508788 3300048903 Bacteria 928
179 Ga0496101_0402641 3300048904 Bacteria 1078
180 Ga0496102_0036555 3300048905 Bacteria 4425
181 Ga0496104_0000034 3300048907 Bacteria 186572
182 Ga0496104_0024215 3300048907 Bacteria 5584
183 Ga0496104_0575901 3300048907 Bacteria 1036
184 Ga0496106_0013239 3300048909 Bacteria 6090
185 Ga0496106_0065179 3300048909 Bacteria 2773
186 Ga0496108_0020379 3300048911 Bacteria 5450
187 Ga0496109_0116543 3300048912 Bacteria 2486
188 Ga0496110_0000350 3300048913 Bacteria 30845
189 Ga0496110_0000784 3300048913 Bacteria 22147
190 Ga0496110_0237217 3300048913 Bacteria 1659
191 Ga0496111_0001739 3300048914 Bacteria 12745
192 Ga0496111_0156680 3300048914 Bacteria 1690
193 Ga0496112_0073492 3300048915 Bacteria 3380
194 Ga0496113_0089921 3300048916 Bacteria 2364
195 Ga0496115_0000232 3300048918 Bacteria 50769
196 Ga0496115_0000429 3300048918 Bacteria 34014
197 Ga0496115_0104326 3300048918 Bacteria 2327
198 Ga0496115_0381397 3300048918 Bacteria 1146
199 Ga0496115_0537329 3300048918 Bacteria 936
200 nmdc:mga09592_5175_c1 3300050508 Bacteria 10599
201 nmdc:mga0n895_2415_c1 3300050512 Bacteria 14567
202 nmdc:mga0rr50_23801_c1 3300050513 Bacteria 4232
203 nmdc:mga0a205_1597_c2 3300050515 Bacteria 18093
204 Ga0495601_0000121 3300053077 Bacteria 43462
205 Ga0495612_0000141 3300053078 Bacteria 30417
206 Ga0495619_0077776 3300053085 Bacteria 2229
207 Ga0495619_0313041 3300053085 Bacteria 1087
208 Ga0466962_0009704 3300061719 Bacteria 4619

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_0214110 Ga0436362_0214110_322_888 188
2 3300005437 Ga0070710_10000008 Ga0070710_10000008177 195
3 3300025898 Ga0207692_10000006 Ga0207692_10000006174 195
4 3300028558 Ga0265326_10000010 Ga0265326_1000001065 199
5 3300028573 Ga0265334_10000003 Ga0265334_10000003113 199
6 3300028800 Ga0265338_10004818 Ga0265338_1000481818 199
7 3300031240 Ga0265320_10125943 Ga0265320_101259432 199
8 3300028563 Ga0265319_1003420 Ga0265319_10034202 200
9 3300028800 Ga0265338_10561175 Ga0265338_105611751 200
10 3300039450 Ga0436363_1397294 Ga0436363_1397294_1211_1843 200
11 3300028800 Ga0265338_10221179 Ga0265338_102211791 201
12 3300045836 Ga0466958_0689710 Ga0466958_0689710_13_642 201
13 3300006880 Ga0075429_100008885 Ga0075429_1000088856 205
14 3300046462 Ga0495651_0471078 Ga0495651_0471078_123_782 205
15 3300050508 nmdc:mga09592_5175_c1 nmdc:mga09592_5175_c1_4197_4883 205
16 3300005440 Ga0070705_100000935 Ga0070705_1000009352 208
17 3300046794 Ga0495589_0194888 Ga0495589_0194888_18_656 208
18 3300046683 Ga0495658_0077853 Ga0495658_0077853_878_1531 210
19 3300005434 Ga0070709_10147039 Ga0070709_101470392 212
20 3300005435 Ga0070714_100172643 Ga0070714_1001726433 212
21 3300005435 Ga0070714_100369403 Ga0070714_1003694032 212
22 3300005436 Ga0070713_100088603 Ga0070713_1000886031 212
23 3300005436 Ga0070713_100144640 Ga0070713_1001446402 212
24 3300006173 Ga0070716_100041914 Ga0070716_1000419141 212
25 3300006175 Ga0070712_100020819 Ga0070712_1000208193 212
26 3300031901 Ga0307406_10208087 Ga0307406_102080872 212
27 3300037418 Ga0395900_0000770 Ga0395900_0000770_31560_32252 212
28 3300037466 Ga0395898_0000955 Ga0395898_0000955_21733_22425 212
29 3300044656 Ga0466969_0020499 Ga0466969_0020499_2102_2794 212
30 3300044684 Ga0466966_0159838 Ga0466966_0159838_481_1173 212
31 3300045049 Ga0466959_0040458 Ga0466959_0040458_252_944 212
32 3300045836 Ga0466958_0095282 Ga0466958_0095282_393_1085 212
33 3300005614 Ga0068856_100252372 Ga0068856_1002523722 213
34 3300025906 Ga0207699_10154321 Ga0207699_101543211 213
35 3300025915 Ga0207693_10003354 Ga0207693_100033549 213
36 3300025928 Ga0207700_10146760 Ga0207700_101467601 213
37 3300025928 Ga0207700_10193208 Ga0207700_101932081 213
38 3300025929 Ga0207664_10000523 Ga0207664_1000052326 213
39 3300025939 Ga0207665_10116940 Ga0207665_101169402 213
40 3300026078 Ga0207702_10306796 Ga0207702_103067962 213
41 3300035410 Ga0373924_0032220 Ga0373924_0032220_166_867 213
42 3300036401 Ga0373937_0173161 Ga0373937_0173161_546_1247 213
43 3300046454 Ga0495592_0079334 Ga0495592_0079334_1165_1866 213
44 3300046459 Ga0495629_0242052 Ga0495629_0242052_136_837 213
45 3300046463 Ga0495653_0024254 Ga0495653_0024254_1954_2655 213
46 3300046477 Ga0495664_0046619 Ga0495664_0046619_1850_2551 213
47 3300046511 Ga0495608_0000897 Ga0495608_0000897_18877_19578 213
48 3300046516 Ga0495628_0225279 Ga0495628_0225279_506_1207 213
49 3300046517 Ga0495630_0264962 Ga0495630_0264962_483_1184 213
50 3300046533 Ga0495640_0180700 Ga0495640_0180700_508_1209 213
51 3300046536 Ga0495587_0023651 Ga0495587_0023651_507_1208 213
52 3300046559 Ga0495667_0022476 Ga0495667_0022476_2975_3676 213
53 3300046675 Ga0495657_0047670 Ga0495657_0047670_1986_2687 213
54 3300046678 Ga0495599_0175752 Ga0495599_0175752_141_842 213
55 3300046679 Ga0495623_0230667 Ga0495623_0230667_306_1007 213
56 3300046680 Ga0495646_0015125 Ga0495646_0015125_1574_2275 213
57 3300047317 Ga0495604_0044525 Ga0495604_0044525_2307_3008 213
58 3300047322 Ga0495680_0006782 Ga0495680_0006782_7563_8264 213
59 3300048088 Ga0495602_0170082 Ga0495602_0170082_459_1160 213
60 3300048907 Ga0496104_0024215 Ga0496104_0024215_3417_4118 213
61 3300048909 Ga0496106_0013239 Ga0496106_0013239_196_846 213
62 3300053085 Ga0495619_0077776 Ga0495619_0077776_865_1566 213
63 3300048918 Ga0496115_0381397 Ga0496115_0381397_95_796 214
64 3300044735 Ga0466968_0014077 Ga0466968_0014077_2356_3054 215
65 3300045049 Ga0466959_0618393 Ga0466959_0618393_16_714 215
66 3300039437 Ga0436365_0353181 Ga0436365_0353181_162_890 216
67 3300005435 Ga0070714_100010093 Ga0070714_1000100937 218
68 3300005468 Ga0070707_100087218 Ga0070707_1000872183 218
69 3300044694 Ga0466963_0312734 Ga0466963_0312734_113_832 218
70 3300039437 Ga0436365_1115426 Ga0436365_1115426_323_1084 219
71 3300044683 Ga0466965_0033304 Ga0466965_0033304_508_1191 219
72 3300044735 Ga0466968_0069733 Ga0466968_0069733_239_922 219
73 3300005435 Ga0070714_100000315 Ga0070714_1000003156 222
74 3300014326 Ga0157380_10701361 Ga0157380_107013611 222
75 3300025929 Ga0207664_10000006 Ga0207664_10000006395 222
76 3300026075 Ga0207708_10212733 Ga0207708_102127332 222
77 3300039450 Ga0436363_0284364 Ga0436363_0284364_223_933 222
78 3300045836 Ga0466958_0261226 Ga0466958_0261226_416_1096 222
79 3300005339 Ga0070660_100057854 Ga0070660_1000578542 223
80 3300005345 Ga0070692_10002583 Ga0070692_100025838 223
81 3300005366 Ga0070659_100000026 Ga0070659_10000002610 223
82 3300005435 Ga0070714_100229186 Ga0070714_1002291862 223
83 3300005439 Ga0070711_100046668 Ga0070711_1000466682 223
84 3300006028 Ga0070717_10523166 Ga0070717_105231662 223
85 3300009148 Ga0105243_11062723 Ga0105243_110627231 223
86 3300025916 Ga0207663_10040760 Ga0207663_100407604 223
87 3300025919 Ga0207657_10068188 Ga0207657_100681883 223
88 3300025929 Ga0207664_10203317 Ga0207664_102033172 223
89 3300025932 Ga0207690_10001474 Ga0207690_100014745 223
90 3300031251 Ga0265327_10089147 Ga0265327_100891472 223
91 3300045836 Ga0466958_0074469 Ga0466958_0074469_630_1337 223
92 3300046463 Ga0495653_0000551 Ga0495653_0000551_799_1518 223
93 3300046514 Ga0495618_0000076 Ga0495618_0000076_58208_58927 223
94 3300046517 Ga0495630_0000233 Ga0495630_0000233_31466_32194 223
95 3300046543 Ga0495645_0000196 Ga0495645_0000196_10089_10808 223
96 3300046675 Ga0495657_0000006 Ga0495657_0000006_64402_65130 223
97 3300047471 Ga0495684_0034774 Ga0495684_0034774_209_937 223
98 3300053077 Ga0495601_0000121 Ga0495601_0000121_35412_36131 223
99 3300053078 Ga0495612_0000141 Ga0495612_0000141_8391_9143 223
100 3300005353 Ga0070669_100107521 Ga0070669_1001075211 224
101 3300005719 Ga0068861_100173423 Ga0068861_1001734232 224
102 3300005981 Ga0081538_10008221 Ga0081538_100082215 224
103 3300005981 Ga0081538_10030778 Ga0081538_100307783 224
104 3300005981 Ga0081538_10055208 Ga0081538_100552084 224
105 3300014969 Ga0157376_10105431 Ga0157376_101054312 224
106 3300025915 Ga0207693_10099732 Ga0207693_100997322 224
107 3300025923 Ga0207681_10001784 Ga0207681_1000178412 224
108 3300025944 Ga0207661_10101586 Ga0207661_101015863 224
109 3300031731 Ga0307405_10105370 Ga0307405_101053702 224
110 3300031824 Ga0307413_10109702 Ga0307413_101097022 224
111 3300031852 Ga0307410_10018635 Ga0307410_100186356 224
112 3300031852 Ga0307410_10342557 Ga0307410_103425572 224
113 3300031901 Ga0307406_10070510 Ga0307406_100705102 224
114 3300031903 Ga0307407_10129248 Ga0307407_101292482 224
115 3300031911 Ga0307412_10550523 Ga0307412_105505232 224
116 3300031995 Ga0307409_100034166 Ga0307409_1000341662 224
117 3300031995 Ga0307409_100471775 Ga0307409_1004717752 224
118 3300032002 Ga0307416_100011147 Ga0307416_1000111475 224
119 3300032002 Ga0307416_100013530 Ga0307416_1000135304 224
120 3300032126 Ga0307415_100000250 Ga0307415_10000025019 224
121 3300044694 Ga0466963_0094949 Ga0466963_0094949_470_1156 224
122 3300048907 Ga0496104_0575901 Ga0496104_0575901_296_982 224
123 3300048912 Ga0496109_0116543 Ga0496109_0116543_1747_2439 224
124 3300032126 Ga0307415_100266357 Ga0307415_1002663571 225
125 3300044842 Ga0466957_0198307 Ga0466957_0198307_14_703 225
126 3300045836 Ga0466958_0045667 Ga0466958_0045667_1839_2528 225
127 3300061719 Ga0466962_0009704 Ga0466962_0009704_2042_2731 225
128 3300005334 Ga0068869_100342553 Ga0068869_1003425532 226
129 3300005434 Ga0070709_10251822 Ga0070709_102518222 226
130 3300005435 Ga0070714_100680226 Ga0070714_1006802262 226
131 3300005439 Ga0070711_100196787 Ga0070711_1001967872 226
132 3300005937 Ga0081455_10021269 Ga0081455_100212694 226
133 3300005983 Ga0081540_1000314 Ga0081540_100031418 226
134 3300005985 Ga0081539_10008852 Ga0081539_100088521 226
135 3300006028 Ga0070717_10000204 Ga0070717_1000020411 226
136 3300006175 Ga0070712_100000153 Ga0070712_10000015340 226
137 3300006175 Ga0070712_100319258 Ga0070712_1003192582 226
138 3300006852 Ga0075433_10001378 Ga0075433_1000137814 226
139 3300006871 Ga0075434_100029421 Ga0075434_1000294212 226
140 3300007076 Ga0075435_100005134 Ga0075435_1000051344 226
141 3300013307 Ga0157372_10502068 Ga0157372_105020682 226
142 3300013308 Ga0157375_10372200 Ga0157375_103722002 226
143 3300021377 Ga0213874_10001301 Ga0213874_100013012 226
144 3300021384 Ga0213876_10032272 Ga0213876_100322722 226
145 3300021384 Ga0213876_10060857 Ga0213876_100608572 226
146 3300025906 Ga0207699_10348023 Ga0207699_103480232 226
147 3300025913 Ga0207695_10065940 Ga0207695_100659402 226
148 3300025914 Ga0207671_10003645 Ga0207671_1000364512 226
149 3300025915 Ga0207693_10000487 Ga0207693_100004872 226
150 3300025915 Ga0207693_10011589 Ga0207693_100115894 226
151 3300025929 Ga0207664_10238857 Ga0207664_102388572 226
152 3300025942 Ga0207689_10377537 Ga0207689_103775372 226
153 3300025945 Ga0207679_10493511 Ga0207679_104935112 226
154 3300026078 Ga0207702_10231443 Ga0207702_102314432 226
155 3300026088 Ga0207641_10489078 Ga0207641_104890782 226
156 3300028556 Ga0265337_1048391 Ga0265337_10483912 226
157 3300028558 Ga0265326_10003486 Ga0265326_100034862 226
158 3300028563 Ga0265319_1000612 Ga0265319_10006122 226
159 3300028666 Ga0265336_10000001 Ga0265336_10000001103 226
160 3300028800 Ga0265338_10000228 Ga0265338_1000022810 226
161 3300031247 Ga0265340_10000005 Ga0265340_10000005103 226
162 3300031344 Ga0265316_10111107 Ga0265316_101111071 226
163 3300031901 Ga0307406_10165708 Ga0307406_101657082 226
164 3300035692 Ga0373935_0074631 Ga0373935_0074631_32_739 226
165 3300035695 Ga0373927_0291121 Ga0373927_0291121_204_911 226
166 3300035725 Ga0373947_0105249 Ga0373947_0105249_896_1597 226
167 3300037068 Ga0373925_0428550 Ga0373925_0428550_174_908 226
168 3300039437 Ga0436365_0181654 Ga0436365_0181654_2397_3092 226
169 3300039437 Ga0436365_1917792 Ga0436365_1917792_1668_2402 226
170 3300039450 Ga0436363_0952794 Ga0436363_0952794_2514_3209 226
171 3300039450 Ga0436363_1597409 Ga0436363_1597409_121_837 226
172 3300039453 Ga0436362_0030687 Ga0436362_0030687_6288_7022 226
173 3300046459 Ga0495629_0433837 Ga0495629_0433837_103_804 226
174 3300046474 Ga0495605_0131815 Ga0495605_0131815_207_902 226
175 3300046491 Ga0495584_0049773 Ga0495584_0049773_348_1043 226
176 3300046511 Ga0495608_0118343 Ga0495608_0118343_898_1629 226
177 3300046525 Ga0495663_0097672 Ga0495663_0097672_80_775 226
178 3300046533 Ga0495640_0020245 Ga0495640_0020245_4138_4839 226
179 3300046536 Ga0495587_0169703 Ga0495587_0169703_437_1138 226
180 3300046538 Ga0495609_0083806 Ga0495609_0083806_503_1198 226
181 3300046543 Ga0495645_0000511 Ga0495645_0000511_19235_19954 226
182 3300046559 Ga0495667_0041396 Ga0495667_0041396_1851_2552 226
183 3300046809 Ga0495600_0082325 Ga0495600_0082325_1089_1790 226
184 3300047317 Ga0495604_0000144 Ga0495604_0000144_30770_31486 226
185 3300047321 Ga0495676_0036037 Ga0495676_0036037_1155_1889 226
186 3300047322 Ga0495680_0399428 Ga0495680_0399428_19_720 226
187 3300047471 Ga0495684_0015073 Ga0495684_0015073_2420_3142 226
188 3300048903 Ga0496100_0508788 Ga0496100_0508788_78_860 226
189 3300048904 Ga0496101_0402641 Ga0496101_0402641_34_741 226
190 3300048905 Ga0496102_0036555 Ga0496102_0036555_2847_3554 226
191 3300048907 Ga0496104_0000034 Ga0496104_0000034_100903_101619 226
192 3300048909 Ga0496106_0065179 Ga0496106_0065179_1713_2420 226
193 3300048911 Ga0496108_0020379 Ga0496108_0020379_1012_1719 226
194 3300048913 Ga0496110_0000350 Ga0496110_0000350_5305_6012 226
195 3300048913 Ga0496110_0000784 Ga0496110_0000784_20305_21021 226
196 3300048913 Ga0496110_0237217 Ga0496110_0237217_697_1404 226
197 3300048914 Ga0496111_0001739 Ga0496111_0001739_7285_8001 226
198 3300048914 Ga0496111_0156680 Ga0496111_0156680_571_1278 226
199 3300048915 Ga0496112_0073492 Ga0496112_0073492_2627_3334 226
200 3300048916 Ga0496113_0089921 Ga0496113_0089921_310_1017 226
201 3300048918 Ga0496115_0000232 Ga0496115_0000232_41182_41964 226
202 3300048918 Ga0496115_0000429 Ga0496115_0000429_29446_30228 226
203 3300048918 Ga0496115_0104326 Ga0496115_0104326_1242_1949 226
204 3300048918 Ga0496115_0537329 Ga0496115_0537329_15_752 226
205 3300050512 nmdc:mga0n895_2415_c1 nmdc:mga0n895_2415_c1_13399_14127 226
206 3300050513 nmdc:mga0rr50_23801_c1 nmdc:mga0rr50_23801_c1_902_1630 226
207 3300050515 nmdc:mga0a205_1597_c2 nmdc:mga0a205_1597_c2_11198_11926 226
208 3300053085 Ga0495619_0313041 Ga0495619_0313041_34_765 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08032

SpoU_sub_bind

RNA 2'-O ribose methyltransferase substrate binding

2

71

0.91

PF00588

SpoU_methylase

SpoU rRNA Methylase family

82

246

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.9573 63 223
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.924 63 223
2ha8-assembly1.cif.gz_B methyltransferase domain of human tar (hiv-1) rna binding protein 1 0.8975 77 222
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.8952 75 226
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.8788 75 226
ID Description Score Start End Superfamily
af_P9WFY5_148_322_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9578 69 226 3.40.1280.10
af_Q2G2M3_73_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9508 60 222 3.40.1280.10
af_Q76NT0_373_525_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9389 76 220 3.40.1280.10
af_P9WFY3_121_283_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9363 68 223 3.40.1280.10
af_P25270_234_411_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9288 76 220 3.40.1280.10
ID Description Score Start End GO Terms
AF-R7HLT5-F1-model_v4 RNA methyltransferase TrmH family group 3 0.9738 78 224 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A3E2D6Q3-F1-model_v4 deleted 0.9723 81 224
AF-A0A3A5IZ75-F1-model_v4 deleted 0.9713 79 222
AF-A0A1F4U3W0-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9693 75 224 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A1F9D5I0-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9689 78 224 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259

Feature Viewer

pLDDT pTM Quality
94.31 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map