F318298
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 208 | 147 | 205 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300047469|Ga0495673_0024237|Ga0495673_0024237_1098_1847 |
| Length | 249 |
| Sequence | MELLMARLMPRRACLFQHPPPFDPAMSAFQTSRFRTVVFDLDGTLADTAPDLTASLNHTLGKLGRPAVPAEDVRHMVGHGVRALLRNGLAATGEVSEELIDEGFPIFFNYYAAHIADHTRPFPGVEEALAALEADGVKIAVCTNKLEALTFDLLAALGWKDRFAAVVGGDTLPVRKPDPAPLFEAIARAGGEGPAAFVGDSITDTDTAKAAGLPCVALSFGFSDRPPSELGADRLIDHWDELIPALASL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 2 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 3 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 37 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 38 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 55 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 56 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 89 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 90 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 91 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 92 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 93 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 94 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 95 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 96 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 97 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 98 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 99 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 100 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 101 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 102 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 103 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 104 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 105 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 106 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 107 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 108 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 109 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 110 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 111 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 112 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 113 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 114 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 115 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 126 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 127 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 128 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 129 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 130 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 131 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 132 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 133 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 134 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 142 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 144 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 145 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 146 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 147 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.6 |
| Metatranscriptomes | 0.96 |
| Isolates | 1.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.85 |
| Nodule | 0 |
| Rhizoplane | 1.44 |
| Rhizosphere | 83.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1006352 | 3300001915 | Bacteria | 2378 |
| 2 | JGI24737J22298_10004343 | 3300001990 | Bacteria | 4950 |
| 3 | JGI24737J22298_10007894 | 3300001990 | Bacteria | 3583 |
| 4 | JGI24737J22298_10028005 | 3300001990 | Bacteria | 1773 |
| 5 | JGI24743J22301_10011853 | 3300001991 | Bacteria | 1578 |
| 6 | JGI24735J21928_10000526 | 3300002067 | Bacteria | 13543 |
| 7 | JGI24735J21928_10002785 | 3300002067 | Bacteria | 6037 |
| 8 | JGI24735J21928_10040715 | 3300002067 | Bacteria | 1355 |
| 9 | JGI24735J21928_10100054 | 3300002067 | Bacteria | 832 |
| 10 | JGI24744J21845_10000194 | 3300002077 | Bacteria | 9347 |
| 11 | rootH1_10046480 | 3300003316 | Bacteria | 4251 |
| 12 | rootH2_10280733 | 3300003320 | Bacteria | 1423 |
| 13 | Ga0055542_1003702 | 3300003762 | Bacteria | 4000 |
| 14 | Ga0070658_10003163 | 3300005327 | Bacteria | 13593 |
| 15 | Ga0070676_10043962 | 3300005328 | Bacteria | 2598 |
| 16 | Ga0068869_100018341 | 3300005334 | Bacteria | 4762 |
| 17 | Ga0070680_100050334 | 3300005336 | Bacteria | 3398 |
| 18 | Ga0068868_100012870 | 3300005338 | Bacteria | 6120 |
| 19 | Ga0070660_100000561 | 3300005339 | Bacteria | 24963 |
| 20 | Ga0070660_100001369 | 3300005339 | Bacteria | 16556 |
| 21 | Ga0070660_100027705 | 3300005339 | Bacteria | 4231 |
| 22 | Ga0070661_100000064 | 3300005344 | Bacteria | 84753 |
| 23 | Ga0070661_100273419 | 3300005344 | Bacteria | 1309 |
| 24 | Ga0070675_100000664 | 3300005354 | Bacteria | 23789 |
| 25 | Ga0070671_100002574 | 3300005355 | Bacteria | 14066 |
| 26 | Ga0070671_100300426 | 3300005355 | Bacteria | 1367 |
| 27 | Ga0070673_100000007 | 3300005364 | Bacteria | 177157 |
| 28 | Ga0070667_100000302 | 3300005367 | Bacteria | 55150 |
| 29 | Ga0070662_100030414 | 3300005457 | Bacteria | 3777 |
| 30 | Ga0070662_100131112 | 3300005457 | Bacteria | 1933 |
| 31 | Ga0070681_10246069 | 3300005458 | Bacteria | 1701 |
| 32 | Ga0068867_100000134 | 3300005459 | Bacteria | 47761 |
| 33 | Ga0070679_100000015 | 3300005530 | Bacteria | 142672 |
| 34 | Ga0070679_100148012 | 3300005530 | Bacteria | 2326 |
| 35 | Ga0068853_100063129 | 3300005539 | Bacteria | 3208 |
| 36 | Ga0068853_100299951 | 3300005539 | Bacteria | 1485 |
| 37 | Ga0068853_100396559 | 3300005539 | Bacteria | 1291 |
| 38 | Ga0070672_100085591 | 3300005543 | Bacteria | 2534 |
| 39 | Ga0070693_100091212 | 3300005547 | Bacteria | 1837 |
| 40 | Ga0068857_100376502 | 3300005577 | Bacteria | 1317 |
| 41 | Ga0068854_100074815 | 3300005578 | Bacteria | 2485 |
| 42 | Ga0068852_100001105 | 3300005616 | Bacteria | 17765 |
| 43 | Ga0068863_100004768 | 3300005841 | Bacteria | 13361 |
| 44 | Ga0068860_100000416 | 3300005843 | Bacteria | 55156 |
| 45 | Ga0068862_100025747 | 3300005844 | Bacteria | 4941 |
| 46 | Ga0075370_10056189 | 3300006353 | Bacteria | 2237 |
| 47 | Ga0068865_100000008 | 3300006881 | Bacteria | 177158 |
| 48 | Ga0105240_10029040 | 3300009093 | Bacteria | 7213 |
| 49 | Ga0105245_10252774 | 3300009098 | Bacteria | 1713 |
| 50 | Ga0105243_10000615 | 3300009148 | Bacteria | 35494 |
| 51 | Ga0105242_10000437 | 3300009176 | Bacteria | 33251 |
| 52 | Ga0105248_10022431 | 3300009177 | Bacteria | 7002 |
| 53 | Ga0105237_10434786 | 3300009545 | Bacteria | 1318 |
| 54 | Ga0105238_10092140 | 3300009551 | Bacteria | 3018 |
| 55 | Ga0105239_10170493 | 3300010375 | Bacteria | 2433 |
| 56 | Ga0105239_10533986 | 3300010375 | Bacteria | 1335 |
| 57 | Ga0105246_10228359 | 3300011119 | Bacteria | 1464 |
| 58 | Ga0157373_10110638 | 3300013100 | Bacteria | 1931 |
| 59 | Ga0157373_10236611 | 3300013100 | Bacteria | 1290 |
| 60 | Ga0157371_10152254 | 3300013102 | Bacteria | 1650 |
| 61 | Ga0157370_10000527 | 3300013104 | Bacteria | 47825 |
| 62 | Ga0157369_10051503 | 3300013105 | Bacteria | 4455 |
| 63 | Ga0157372_10018298 | 3300013307 | Bacteria | 7532 |
| 64 | Ga0157372_10139478 | 3300013307 | Bacteria | 2792 |
| 65 | Ga0157372_10245548 | 3300013307 | Bacteria | 2078 |
| 66 | Ga0157372_10948057 | 3300013307 | Bacteria | 998 |
| 67 | Ga0157377_10235545 | 3300014745 | Bacteria | 1179 |
| 68 | Ga0157376_10000315 | 3300014969 | Bacteria | 32437 |
| 69 | Ga0206354_10967945 | 3300020081 | Bacteria | 3161 |
| 70 | Ga0206353_11261817 | 3300020082 | Bacteria | 25116 |
| 71 | Ga0209148_1000858 | 3300025254 | Bacteria | 21270 |
| 72 | Ga0209676_1001881 | 3300025292 | Bacteria | 17151 |
| 73 | Ga0207647_10000706 | 3300025904 | Bacteria | 26190 |
| 74 | Ga0207647_10001778 | 3300025904 | Bacteria | 16531 |
| 75 | Ga0207647_10194294 | 3300025904 | Bacteria | 1175 |
| 76 | Ga0207645_10001217 | 3300025907 | Bacteria | 21219 |
| 77 | Ga0207645_10019757 | 3300025907 | Bacteria | 4413 |
| 78 | Ga0207705_10000022 | 3300025909 | Bacteria | 302232 |
| 79 | Ga0207705_10000116 | 3300025909 | Bacteria | 89237 |
| 80 | Ga0207705_10030175 | 3300025909 | Bacteria | 3868 |
| 81 | Ga0207695_10163569 | 3300025913 | Bacteria | 2155 |
| 82 | Ga0207657_10001820 | 3300025919 | Bacteria | 22995 |
| 83 | Ga0207657_10002277 | 3300025919 | Bacteria | 20811 |
| 84 | Ga0207657_10073476 | 3300025919 | Bacteria | 2889 |
| 85 | Ga0207657_10285219 | 3300025919 | Bacteria | 1310 |
| 86 | Ga0207649_10000102 | 3300025920 | Bacteria | 70205 |
| 87 | Ga0207659_10002169 | 3300025926 | Bacteria | 11660 |
| 88 | Ga0207687_10007030 | 3300025927 | Bacteria | 7420 |
| 89 | Ga0207644_10009380 | 3300025931 | Bacteria | 6428 |
| 90 | Ga0207644_10254831 | 3300025931 | Bacteria | 1401 |
| 91 | Ga0207706_10005743 | 3300025933 | Bacteria | 11555 |
| 92 | Ga0207706_10062586 | 3300025933 | Bacteria | 3277 |
| 93 | Ga0207706_10085938 | 3300025933 | Bacteria | 2765 |
| 94 | Ga0207686_10000908 | 3300025934 | Bacteria | 17774 |
| 95 | Ga0207709_10000399 | 3300025935 | Bacteria | 42600 |
| 96 | Ga0207704_10000013 | 3300025938 | Bacteria | 170478 |
| 97 | Ga0207691_10239626 | 3300025940 | Bacteria | 1568 |
| 98 | Ga0207711_10037967 | 3300025941 | Bacteria | 4095 |
| 99 | Ga0207689_10027430 | 3300025942 | Bacteria | 4767 |
| 100 | Ga0207667_10000113 | 3300025949 | Bacteria | 131083 |
| 101 | Ga0207651_10000013 | 3300025960 | Bacteria | 177573 |
| 102 | Ga0207668_10392209 | 3300025972 | Bacteria | 1171 |
| 103 | Ga0207640_10017681 | 3300025981 | Bacteria | 4176 |
| 104 | Ga0207658_10000263 | 3300025986 | Bacteria | 55175 |
| 105 | Ga0207677_10007087 | 3300026023 | Bacteria | 6171 |
| 106 | Ga0207639_10141698 | 3300026041 | Bacteria | 2004 |
| 107 | Ga0207639_10148700 | 3300026041 | Bacteria | 1960 |
| 108 | Ga0207639_10320572 | 3300026041 | Bacteria | 1376 |
| 109 | Ga0207702_10078025 | 3300026078 | Bacteria | 2866 |
| 110 | Ga0207641_10004136 | 3300026088 | Bacteria | 12646 |
| 111 | Ga0207648_10000382 | 3300026089 | Bacteria | 48961 |
| 112 | Ga0207674_10034918 | 3300026116 | Bacteria | 5251 |
| 113 | Ga0207698_10000433 | 3300026142 | Bacteria | 24089 |
| 114 | Ga0268265_10074915 | 3300028380 | Bacteria | 2649 |
| 115 | Ga0268264_10000184 | 3300028381 | Bacteria | 131402 |
| 116 | Ga0307405_10001872 | 3300031731 | Bacteria | 9036 |
| 117 | Ga0307413_10039539 | 3300031824 | Bacteria | 2744 |
| 118 | Ga0307413_10102572 | 3300031824 | Bacteria | 1894 |
| 119 | Ga0307410_10069537 | 3300031852 | Bacteria | 2436 |
| 120 | Ga0307406_10001286 | 3300031901 | Bacteria | 14068 |
| 121 | Ga0307406_10007349 | 3300031901 | Bacteria | 6105 |
| 122 | Ga0307412_10005177 | 3300031911 | Bacteria | 7306 |
| 123 | Ga0307416_100057004 | 3300032002 | Bacteria | 3157 |
| 124 | Ga0307414_10200998 | 3300032004 | Bacteria | 1621 |
| 125 | Ga0307414_10863008 | 3300032004 | Bacteria | 828 |
| 126 | Ga0307411_10095604 | 3300032005 | Bacteria | 2086 |
| 127 | Ga0307411_10300472 | 3300032005 | Bacteria | 1287 |
| 128 | Ga0307510_10236003 | 3300033180 | Bacteria | 1327 |
| 129 | Ga0395900_0051281 | 3300037418 | Bacteria | 4251 |
| 130 | Ga0395905_0093463 | 3300037471 | Bacteria | 2821 |
| 131 | Ga0395901_0023347 | 3300038443 | Bacteria | 6339 |
| 132 | Ga0436365_0188271 | 3300039437 | Bacteria | 2506 |
| 133 | Ga0436365_1186027 | 3300039437 | Bacteria | 1567 |
| 134 | Ga0451802_0517091 | 3300041460 | Bacteria | 2228 |
| 135 | Ga0451806_526296 | 3300041462 | Bacteria | 2648 |
| 136 | Ga0451807_1394378 | 3300041486 | Bacteria | 1351 |
| 137 | Ga0439448_0003022 | 3300042005 | Bacteria | 4621 |
| 138 | Ga0439448_0004065 | 3300042005 | Bacteria | 4112 |
| 139 | Ga0439448_0012334 | 3300042005 | Bacteria | 2557 |
| 140 | Ga0439448_0012457 | 3300042005 | Bacteria | 2545 |
| 141 | Ga0439455_0000053 | 3300042012 | Bacteria | 10335 |
| 142 | Ga0439455_0002183 | 3300042012 | Bacteria | 3502 |
| 143 | Ga0439455_0003643 | 3300042012 | Bacteria | 2970 |
| 144 | Ga0439455_0023311 | 3300042012 | Bacteria | 1489 |
| 145 | Ga0439455_0049465 | 3300042012 | Bacteria | 1095 |
| 146 | Ga0439458_0000111 | 3300042157 | Bacteria | 16357 |
| 147 | Ga0439458_0000384 | 3300042157 | Bacteria | 11121 |
| 148 | Ga0439458_0002641 | 3300042157 | Bacteria | 4323 |
| 149 | Ga0466972_0003112 | 3300044658 | Bacteria | 8234 |
| 150 | Ga0466965_0039132 | 3300044683 | Bacteria | 2330 |
| 151 | Ga0466964_0001546 | 3300044706 | Bacteria | 7911 |
| 152 | Ga0466964_0041031 | 3300044706 | Bacteria | 1870 |
| 153 | Ga0466968_0020218 | 3300044735 | Bacteria | 2685 |
| 154 | Ga0466968_0125200 | 3300044735 | Bacteria | 1165 |
| 155 | Ga0466970_0012301 | 3300044765 | Bacteria | 4373 |
| 156 | Ga0466970_0232718 | 3300044765 | Bacteria | 1030 |
| 157 | Ga0466957_0426778 | 3300044842 | Bacteria | 910 |
| 158 | Ga0466960_0000830 | 3300044901 | Bacteria | 10881 |
| 159 | Ga0466959_0014145 | 3300045049 | Bacteria | 5792 |
| 160 | Ga0495638_0026921 | 3300046460 | Bacteria | 3725 |
| 161 | Ga0495583_0001959 | 3300046506 | Bacteria | 18914 |
| 162 | Ga0495648_0089435 | 3300046524 | Bacteria | 1728 |
| 163 | Ga0495611_0037162 | 3300046648 | Bacteria | 2163 |
| 164 | Ga0495625_0066495 | 3300046660 | Bacteria | 2539 |
| 165 | Ga0495661_0071393 | 3300046665 | Bacteria | 2029 |
| 166 | Ga0495670_0070938 | 3300046691 | Bacteria | 1763 |
| 167 | Ga0495687_060374 | 3300047443 | Bacteria | 1564 |
| 168 | Ga0495673_0017908 | 3300047469 | Bacteria | 3584 |
| 169 | Ga0495673_0024237 | 3300047469 | Bacteria | 2937 |
| 170 | Ga0495686_0000197 | 3300047472 | Bacteria | 112818 |
| 171 | Ga0496117_0012179 | 3300048920 | Bacteria | 7614 |
| 172 | Ga0496117_0013424 | 3300048920 | Bacteria | 7149 |
| 173 | Ga0496118_0001632 | 3300048921 | Bacteria | 33061 |
| 174 | Ga0496118_0381655 | 3300048921 | Bacteria | 739 |
| 175 | Ga0496119_0042388 | 3300048922 | Bacteria | 2886 |
| 176 | Ga0496121_0009282 | 3300048924 | Bacteria | 11347 |
| 177 | Ga0496122_0030836 | 3300048925 | Bacteria | 4481 |
| 178 | Ga0496122_0046617 | 3300048925 | Bacteria | 3354 |
| 179 | Ga0496122_0230318 | 3300048925 | Bacteria | 1054 |
| 180 | Ga0496123_0000670 | 3300048926 | Bacteria | 56630 |
| 181 | Ga0496123_0013415 | 3300048926 | Bacteria | 6882 |
| 182 | Ga0496123_0058266 | 3300048926 | Bacteria | 2507 |
| 183 | Ga0496124_0005418 | 3300048927 | Bacteria | 14369 |
| 184 | Ga0496124_0059737 | 3300048927 | Bacteria | 3201 |
| 185 | Ga0496125_0303969 | 3300048928 | Bacteria | 976 |
| 186 | Ga0496126_0502907 | 3300048929 | Bacteria | 968 |
| 187 | Ga0495682_0011735 | 3300049460 | Bacteria | 3367 |
| 188 | Ga0501032_0074627 | 3300049569 | Bacteria | 2260 |
| 189 | Ga0501032_0475479 | 3300049569 | Bacteria | 799 |
| 190 | Ga0501033_0018095 | 3300049570 | Bacteria | 5324 |
| 191 | Ga0501034_0159280 | 3300049571 | Bacteria | 2229 |
| 192 | Ga0501034_0218295 | 3300049571 | Bacteria | 1860 |
| 193 | Ga0501043_0071892 | 3300049579 | Bacteria | 2717 |
| 194 | Ga0501043_0173678 | 3300049579 | Bacteria | 1681 |
| 195 | Ga0501047_0000631 | 3300049581 | Bacteria | 37077 |
| 196 | Ga0501083_0082470 | 3300049744 | Bacteria | 2131 |
| 197 | Ga0501083_0290651 | 3300049744 | Bacteria | 1063 |
| 198 | Ga0501282_003180 | 3300049778 | Bacteria | 1774 |
| 199 | Ga0501044_0059161 | 3300049823 | Bacteria | 3927 |
| 200 | Ga0501044_0235874 | 3300049823 | Bacteria | 1775 |
| 201 | nmdc:mga07m45_224375_c1 | 3300050496 | Bacteria | 1093 |
| 202 | Ga0500555_000889 | 3300053103 | Bacteria | 10630 |
| 203 | Ga0500658_0010828 | 3300053134 | Bacteria | 3367 |
| 204 | Ga0500611_001396 | 3300053727 | Bacteria | 2648 |
| 205 | Ga0501082_0117880 | 3300060353 | Bacteria | 2300 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048927 | Ga0496124_0059737 | Ga0496124_0059737_2626_3189 | 187 |
| 2 | 3300025292 | Ga0209676_1001881 | Ga0209676_100188115 | 193 |
| 3 | 3300025913 | Ga0207695_10163569 | Ga0207695_101635692 | 205 |
| 4 | 3300037418 | Ga0395900_0051281 | Ga0395900_0051281_16_681 | 209 |
| 5 | 3300044683 | Ga0466965_0039132 | Ga0466965_0039132_1126_1791 | 209 |
| 6 | 3300044765 | Ga0466970_0012301 | Ga0466970_0012301_271_936 | 209 |
| 7 | 3300045049 | Ga0466959_0014145 | Ga0466959_0014145_4317_4982 | 209 |
| 8 | 3300005336 | Ga0070680_100050334 | Ga0070680_1000503342 | 211 |
| 9 | 3300005458 | Ga0070681_10246069 | Ga0070681_102460692 | 211 |
| 10 | 3300005530 | Ga0070679_100000015 | Ga0070679_100000015123 | 211 |
| 11 | 3300020081 | Ga0206354_10967945 | Ga0206354_109679453 | 215 |
| 12 | 3300020082 | Ga0206353_11261817 | Ga0206353_1126181714 | 215 |
| 13 | 3300039437 | Ga0436365_1186027 | Ga0436365_1186027_97_756 | 217 |
| 14 | 3300049744 | Ga0501083_0082470 | Ga0501083_0082470_439_1119 | 217 |
| 15 | 3300049744 | Ga0501083_0290651 | Ga0501083_0290651_46_726 | 217 |
| 16 | 3300060353 | Ga0501082_0117880 | Ga0501082_0117880_1242_1922 | 217 |
| 17 | 3300006353 | Ga0075370_10056189 | Ga0075370_100561892 | 218 |
| 18 | 3300031901 | Ga0307406_10001286 | Ga0307406_1000128611 | 218 |
| 19 | 3300037471 | Ga0395905_0093463 | Ga0395905_0093463_1501_2193 | 218 |
| 20 | 3300038443 | Ga0395901_0023347 | Ga0395901_0023347_3256_3948 | 218 |
| 21 | 3300041486 | Ga0451807_1394378 | Ga0451807_1394378_241_924 | 218 |
| 22 | 3300050496 | nmdc:mga07m45_224375_c1 | nmdc:mga07m45_224375_c1_46_717 | 218 |
| 23 | 3300053727 | Ga0500611_001396 | Ga0500611_001396_513_1196 | 218 |
| 24 | iso_pu_bacteria | 2643221541 | 2643727103 | 218 |
| 25 | iso_pu_bacteria | 2643221606 | 2644046248 | 218 |
| 26 | iso_pu_bacteria | 2643221671 | 2644396012 | 218 |
| 27 | 3300025941 | Ga0207711_10037967 | Ga0207711_100379672 | 220 |
| 28 | 3300032004 | Ga0307414_10863008 | Ga0307414_108630081 | 220 |
| 29 | 3300039437 | Ga0436365_0188271 | Ga0436365_0188271_572_1267 | 220 |
| 30 | 3300048929 | Ga0496126_0502907 | Ga0496126_0502907_137_802 | 220 |
| 31 | 3300049570 | Ga0501033_0018095 | Ga0501033_0018095_2102_2776 | 220 |
| 32 | 3300049579 | Ga0501043_0071892 | Ga0501043_0071892_1623_2297 | 220 |
| 33 | 3300049823 | Ga0501044_0059161 | Ga0501044_0059161_524_1198 | 220 |
| 34 | 3300001990 | JGI24737J22298_10007894 | JGI24737J22298_100078944 | 221 |
| 35 | 3300001990 | JGI24737J22298_10028005 | JGI24737J22298_100280052 | 221 |
| 36 | 3300002067 | JGI24735J21928_10000526 | JGI24735J21928_100005262 | 221 |
| 37 | 3300002067 | JGI24735J21928_10002785 | JGI24735J21928_100027854 | 221 |
| 38 | 3300002067 | JGI24735J21928_10100054 | JGI24735J21928_101000541 | 221 |
| 39 | 3300003316 | rootH1_10046480 | rootH1_100464802 | 221 |
| 40 | 3300003320 | rootH2_10280733 | rootH2_102807332 | 221 |
| 41 | 3300005327 | Ga0070658_10003163 | Ga0070658_100031639 | 221 |
| 42 | 3300005339 | Ga0070660_100000561 | Ga0070660_10000056118 | 221 |
| 43 | 3300005344 | Ga0070661_100000064 | Ga0070661_10000006477 | 221 |
| 44 | 3300005355 | Ga0070671_100002574 | Ga0070671_1000025749 | 221 |
| 45 | 3300005367 | Ga0070667_100000302 | Ga0070667_1000003023 | 221 |
| 46 | 3300005457 | Ga0070662_100030414 | Ga0070662_1000304143 | 221 |
| 47 | 3300005539 | Ga0068853_100396559 | Ga0068853_1003965591 | 221 |
| 48 | 3300005547 | Ga0070693_100091212 | Ga0070693_1000912123 | 221 |
| 49 | 3300005616 | Ga0068852_100001105 | Ga0068852_10000110513 | 221 |
| 50 | 3300005841 | Ga0068863_100004768 | Ga0068863_1000047688 | 221 |
| 51 | 3300005843 | Ga0068860_100000416 | Ga0068860_1000004163 | 221 |
| 52 | 3300005844 | Ga0068862_100025747 | Ga0068862_1000257472 | 221 |
| 53 | 3300009098 | Ga0105245_10252774 | Ga0105245_102527742 | 221 |
| 54 | 3300009148 | Ga0105243_10000615 | Ga0105243_1000061534 | 221 |
| 55 | 3300009176 | Ga0105242_10000437 | Ga0105242_1000043726 | 221 |
| 56 | 3300009545 | Ga0105237_10434786 | Ga0105237_104347862 | 221 |
| 57 | 3300009551 | Ga0105238_10092140 | Ga0105238_100921402 | 221 |
| 58 | 3300010375 | Ga0105239_10533986 | Ga0105239_105339862 | 221 |
| 59 | 3300011119 | Ga0105246_10228359 | Ga0105246_102283591 | 221 |
| 60 | 3300013100 | Ga0157373_10110638 | Ga0157373_101106382 | 221 |
| 61 | 3300013100 | Ga0157373_10236611 | Ga0157373_102366112 | 221 |
| 62 | 3300013102 | Ga0157371_10152254 | Ga0157371_101522542 | 221 |
| 63 | 3300013105 | Ga0157369_10051503 | Ga0157369_100515034 | 221 |
| 64 | 3300013307 | Ga0157372_10018298 | Ga0157372_100182985 | 221 |
| 65 | 3300013307 | Ga0157372_10139478 | Ga0157372_101394782 | 221 |
| 66 | 3300013307 | Ga0157372_10245548 | Ga0157372_102455482 | 221 |
| 67 | 3300014745 | Ga0157377_10235545 | Ga0157377_102355451 | 221 |
| 68 | 3300014969 | Ga0157376_10000315 | Ga0157376_1000031518 | 221 |
| 69 | 3300025254 | Ga0209148_1000858 | Ga0209148_100085817 | 221 |
| 70 | 3300025904 | Ga0207647_10000706 | Ga0207647_1000070620 | 221 |
| 71 | 3300025904 | Ga0207647_10001778 | Ga0207647_100017785 | 221 |
| 72 | 3300025904 | Ga0207647_10194294 | Ga0207647_101942942 | 221 |
| 73 | 3300025909 | Ga0207705_10030175 | Ga0207705_100301754 | 221 |
| 74 | 3300025919 | Ga0207657_10285219 | Ga0207657_102852192 | 221 |
| 75 | 3300025920 | Ga0207649_10000102 | Ga0207649_1000010266 | 221 |
| 76 | 3300025931 | Ga0207644_10009380 | Ga0207644_100093806 | 221 |
| 77 | 3300025933 | Ga0207706_10005743 | Ga0207706_100057439 | 221 |
| 78 | 3300025933 | Ga0207706_10085938 | Ga0207706_100859383 | 221 |
| 79 | 3300025972 | Ga0207668_10392209 | Ga0207668_103922092 | 221 |
| 80 | 3300025986 | Ga0207658_10000263 | Ga0207658_1000026356 | 221 |
| 81 | 3300026078 | Ga0207702_10078025 | Ga0207702_100780252 | 221 |
| 82 | 3300026088 | Ga0207641_10004136 | Ga0207641_100041363 | 221 |
| 83 | 3300026142 | Ga0207698_10000433 | Ga0207698_1000043310 | 221 |
| 84 | 3300028380 | Ga0268265_10074915 | Ga0268265_100749153 | 221 |
| 85 | 3300028381 | Ga0268264_10000184 | Ga0268264_1000018456 | 221 |
| 86 | 3300031731 | Ga0307405_10001872 | Ga0307405_100018726 | 221 |
| 87 | 3300031824 | Ga0307413_10039539 | Ga0307413_100395393 | 221 |
| 88 | 3300031824 | Ga0307413_10102572 | Ga0307413_101025722 | 221 |
| 89 | 3300031852 | Ga0307410_10069537 | Ga0307410_100695372 | 221 |
| 90 | 3300031901 | Ga0307406_10007349 | Ga0307406_100073493 | 221 |
| 91 | 3300031911 | Ga0307412_10005177 | Ga0307412_100051773 | 221 |
| 92 | 3300032002 | Ga0307416_100057004 | Ga0307416_1000570043 | 221 |
| 93 | 3300032004 | Ga0307414_10200998 | Ga0307414_102009982 | 221 |
| 94 | 3300032005 | Ga0307411_10095604 | Ga0307411_100956042 | 221 |
| 95 | 3300032005 | Ga0307411_10300472 | Ga0307411_103004722 | 221 |
| 96 | 3300033180 | Ga0307510_10236003 | Ga0307510_102360032 | 221 |
| 97 | 3300041462 | Ga0451806_526296 | Ga0451806_526296_1759_2424 | 221 |
| 98 | 3300042005 | Ga0439448_0003022 | Ga0439448_0003022_32_697 | 221 |
| 99 | 3300042005 | Ga0439448_0004065 | Ga0439448_0004065_2192_2857 | 221 |
| 100 | 3300042005 | Ga0439448_0012334 | Ga0439448_0012334_232_897 | 221 |
| 101 | 3300042005 | Ga0439448_0012457 | Ga0439448_0012457_1322_1987 | 221 |
| 102 | 3300042012 | Ga0439455_0000053 | Ga0439455_0000053_2489_3154 | 221 |
| 103 | 3300042012 | Ga0439455_0002183 | Ga0439455_0002183_29_694 | 221 |
| 104 | 3300042012 | Ga0439455_0003643 | Ga0439455_0003643_783_1448 | 221 |
| 105 | 3300042012 | Ga0439455_0023311 | Ga0439455_0023311_104_769 | 221 |
| 106 | 3300042012 | Ga0439455_0049465 | Ga0439455_0049465_166_831 | 221 |
| 107 | 3300042157 | Ga0439458_0000111 | Ga0439458_0000111_15012_15677 | 221 |
| 108 | 3300042157 | Ga0439458_0000384 | Ga0439458_0000384_7495_8160 | 221 |
| 109 | 3300042157 | Ga0439458_0002641 | Ga0439458_0002641_2120_2785 | 221 |
| 110 | 3300044658 | Ga0466972_0003112 | Ga0466972_0003112_2635_3300 | 221 |
| 111 | 3300044706 | Ga0466964_0001546 | Ga0466964_0001546_404_1069 | 221 |
| 112 | 3300044706 | Ga0466964_0041031 | Ga0466964_0041031_72_737 | 221 |
| 113 | 3300044735 | Ga0466968_0020218 | Ga0466968_0020218_168_833 | 221 |
| 114 | 3300044901 | Ga0466960_0000830 | Ga0466960_0000830_5025_5690 | 221 |
| 115 | 3300046460 | Ga0495638_0026921 | Ga0495638_0026921_1262_1930 | 221 |
| 116 | 3300046506 | Ga0495583_0001959 | Ga0495583_0001959_7028_7696 | 221 |
| 117 | 3300046524 | Ga0495648_0089435 | Ga0495648_0089435_936_1601 | 221 |
| 118 | 3300046648 | Ga0495611_0037162 | Ga0495611_0037162_1029_1697 | 221 |
| 119 | 3300046660 | Ga0495625_0066495 | Ga0495625_0066495_958_1623 | 221 |
| 120 | 3300046665 | Ga0495661_0071393 | Ga0495661_0071393_413_1081 | 221 |
| 121 | 3300046691 | Ga0495670_0070938 | Ga0495670_0070938_823_1491 | 221 |
| 122 | 3300047443 | Ga0495687_060374 | Ga0495687_060374_14_679 | 221 |
| 123 | 3300047469 | Ga0495673_0017908 | Ga0495673_0017908_800_1468 | 221 |
| 124 | 3300048920 | Ga0496117_0012179 | Ga0496117_0012179_6393_7058 | 221 |
| 125 | 3300048920 | Ga0496117_0013424 | Ga0496117_0013424_2704_3375 | 221 |
| 126 | 3300048921 | Ga0496118_0001632 | Ga0496118_0001632_29407_30078 | 221 |
| 127 | 3300048921 | Ga0496118_0381655 | Ga0496118_0381655_19_684 | 221 |
| 128 | 3300048924 | Ga0496121_0009282 | Ga0496121_0009282_7516_8181 | 221 |
| 129 | 3300048925 | Ga0496122_0030836 | Ga0496122_0030836_1388_2053 | 221 |
| 130 | 3300048925 | Ga0496122_0046617 | Ga0496122_0046617_693_1361 | 221 |
| 131 | 3300048925 | Ga0496122_0230318 | Ga0496122_0230318_93_764 | 221 |
| 132 | 3300048926 | Ga0496123_0000670 | Ga0496123_0000670_11715_12383 | 221 |
| 133 | 3300048926 | Ga0496123_0013415 | Ga0496123_0013415_5988_6653 | 221 |
| 134 | 3300048926 | Ga0496123_0058266 | Ga0496123_0058266_550_1218 | 221 |
| 135 | 3300048927 | Ga0496124_0005418 | Ga0496124_0005418_11944_12612 | 221 |
| 136 | 3300048928 | Ga0496125_0303969 | Ga0496125_0303969_34_714 | 221 |
| 137 | 3300049460 | Ga0495682_0011735 | Ga0495682_0011735_266_934 | 221 |
| 138 | 3300049569 | Ga0501032_0475479 | Ga0501032_0475479_74_748 | 221 |
| 139 | 3300049571 | Ga0501034_0159280 | Ga0501034_0159280_573_1247 | 221 |
| 140 | 3300053103 | Ga0500555_000889 | Ga0500555_000889_1007_1675 | 221 |
| 141 | 3300010375 | Ga0105239_10170493 | Ga0105239_101704932 | 222 |
| 142 | 3300049778 | Ga0501282_003180 | Ga0501282_003180_508_1179 | 222 |
| 143 | 3300053134 | Ga0500658_0010828 | Ga0500658_0010828_2116_2787 | 222 |
| 144 | 3300009177 | Ga0105248_10022431 | Ga0105248_100224313 | 223 |
| 145 | 3300005457 | Ga0070662_100131112 | Ga0070662_1001311122 | 225 |
| 146 | 3300005539 | Ga0068853_100063129 | Ga0068853_1000631293 | 225 |
| 147 | 3300005577 | Ga0068857_100376502 | Ga0068857_1003765022 | 225 |
| 148 | 3300005578 | Ga0068854_100074815 | Ga0068854_1000748154 | 225 |
| 149 | 3300025933 | Ga0207706_10062586 | Ga0207706_100625863 | 225 |
| 150 | 3300025981 | Ga0207640_10017681 | Ga0207640_100176812 | 225 |
| 151 | 3300026041 | Ga0207639_10148700 | Ga0207639_101487002 | 225 |
| 152 | 3300026116 | Ga0207674_10034918 | Ga0207674_100349185 | 225 |
| 153 | 3300049569 | Ga0501032_0074627 | Ga0501032_0074627_1287_1979 | 226 |
| 154 | 3300049571 | Ga0501034_0218295 | Ga0501034_0218295_858_1550 | 226 |
| 155 | 3300049579 | Ga0501043_0173678 | Ga0501043_0173678_540_1232 | 226 |
| 156 | 3300049581 | Ga0501047_0000631 | Ga0501047_0000631_9002_9694 | 226 |
| 157 | 3300049823 | Ga0501044_0235874 | Ga0501044_0235874_191_883 | 226 |
| 158 | 3300041460 | Ga0451802_0517091 | Ga0451802_0517091_1430_2113 | 227 |
| 159 | 3300009093 | Ga0105240_10029040 | Ga0105240_100290406 | 228 |
| 160 | 3300044735 | Ga0466968_0125200 | Ga0466968_0125200_228_938 | 236 |
| 161 | 3300005530 | Ga0070679_100148012 | Ga0070679_1001480122 | 241 |
| 162 | 3300013307 | Ga0157372_10948057 | Ga0157372_109480572 | 243 |
| 163 | 3300047469 | Ga0495673_0024237 | Ga0495673_0024237_1098_1847 | 243 |
| 164 | 3300047472 | Ga0495686_0000197 | Ga0495686_0000197_47631_48380 | 243 |
| 165 | 3300048922 | Ga0496119_0042388 | Ga0496119_0042388_922_1671 | 243 |
| 166 | 3300001915 | JGI24741J21665_1006352 | JGI24741J21665_10063523 | 244 |
| 167 | 3300001990 | JGI24737J22298_10004343 | JGI24737J22298_100043432 | 244 |
| 168 | 3300001991 | JGI24743J22301_10011853 | JGI24743J22301_100118532 | 244 |
| 169 | 3300002067 | JGI24735J21928_10040715 | JGI24735J21928_100407151 | 244 |
| 170 | 3300002077 | JGI24744J21845_10000194 | JGI24744J21845_100001945 | 244 |
| 171 | 3300003762 | Ga0055542_1003702 | Ga0055542_10037024 | 244 |
| 172 | 3300005328 | Ga0070676_10043962 | Ga0070676_100439622 | 244 |
| 173 | 3300005334 | Ga0068869_100018341 | Ga0068869_1000183414 | 244 |
| 174 | 3300005338 | Ga0068868_100012870 | Ga0068868_1000128707 | 244 |
| 175 | 3300005339 | Ga0070660_100001369 | Ga0070660_10000136916 | 244 |
| 176 | 3300005339 | Ga0070660_100027705 | Ga0070660_1000277052 | 244 |
| 177 | 3300005344 | Ga0070661_100273419 | Ga0070661_1002734191 | 244 |
| 178 | 3300005354 | Ga0070675_100000664 | Ga0070675_10000066417 | 244 |
| 179 | 3300005355 | Ga0070671_100300426 | Ga0070671_1003004262 | 244 |
| 180 | 3300005364 | Ga0070673_100000007 | Ga0070673_100000007126 | 244 |
| 181 | 3300005459 | Ga0068867_100000134 | Ga0068867_10000013433 | 244 |
| 182 | 3300005539 | Ga0068853_100299951 | Ga0068853_1002999512 | 244 |
| 183 | 3300005543 | Ga0070672_100085591 | Ga0070672_1000855912 | 244 |
| 184 | 3300006881 | Ga0068865_100000008 | Ga0068865_10000000834 | 244 |
| 185 | 3300013104 | Ga0157370_10000527 | Ga0157370_1000052717 | 244 |
| 186 | 3300025907 | Ga0207645_10001217 | Ga0207645_100012178 | 244 |
| 187 | 3300025907 | Ga0207645_10019757 | Ga0207645_100197572 | 244 |
| 188 | 3300025909 | Ga0207705_10000022 | Ga0207705_1000002217 | 244 |
| 189 | 3300025909 | Ga0207705_10000116 | Ga0207705_1000011616 | 244 |
| 190 | 3300025919 | Ga0207657_10001820 | Ga0207657_100018206 | 244 |
| 191 | 3300025919 | Ga0207657_10002277 | Ga0207657_100022779 | 244 |
| 192 | 3300025919 | Ga0207657_10073476 | Ga0207657_100734762 | 244 |
| 193 | 3300025926 | Ga0207659_10002169 | Ga0207659_100021697 | 244 |
| 194 | 3300025927 | Ga0207687_10007030 | Ga0207687_100070305 | 244 |
| 195 | 3300025931 | Ga0207644_10254831 | Ga0207644_102548312 | 244 |
| 196 | 3300025934 | Ga0207686_10000908 | Ga0207686_100009082 | 244 |
| 197 | 3300025935 | Ga0207709_10000399 | Ga0207709_1000039914 | 244 |
| 198 | 3300025938 | Ga0207704_10000013 | Ga0207704_1000001329 | 244 |
| 199 | 3300025940 | Ga0207691_10239626 | Ga0207691_102396262 | 244 |
| 200 | 3300025942 | Ga0207689_10027430 | Ga0207689_100274302 | 244 |
| 201 | 3300025949 | Ga0207667_10000113 | Ga0207667_1000011333 | 244 |
| 202 | 3300025960 | Ga0207651_10000013 | Ga0207651_10000013127 | 244 |
| 203 | 3300026023 | Ga0207677_10007087 | Ga0207677_100070872 | 244 |
| 204 | 3300026041 | Ga0207639_10141698 | Ga0207639_101416982 | 244 |
| 205 | 3300026041 | Ga0207639_10320572 | Ga0207639_103205721 | 244 |
| 206 | 3300026089 | Ga0207648_10000382 | Ga0207648_1000038234 | 244 |
| 207 | 3300044765 | Ga0466970_0232718 | Ga0466970_0232718_91_825 | 244 |
| 208 | 3300044842 | Ga0466957_0426778 | Ga0466957_0426778_77_811 | 244 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hsz-assembly2.cif.gz_B | crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution | 0.9213 | 23 | 239 |
| 2hi0-assembly2.cif.gz_B | crystal structure of putative phosphoglycolate phosphatase (yp_619066.1) from lactobacillus delbrueckii subsp. bulgaricus atcc baa-365 at 1.51 a resolution | 0.8932 | 29 | 240 |
| 2ah5-assembly1.cif.gz_A | hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae | 0.8894 | 29 | 239 |
| 3d6j-assembly1.cif.gz_A | crystal structure of putative haloacid dehalogenase-like hydrolase from bacteroides fragilis | 0.8869 | 29 | 236 |
| 2hsz-assembly2.cif.gz_B | crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution | 0.886 | 23 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P32662_111_227_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9641 | 117 | 226 | 3.40.50.1000 |
| 2fi1A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9081 | 117 | 209 | 3.40.50.1000 |
| af_D7SFJ0_151_278_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9075 | 115 | 232 | 3.40.50.1000 |
| 3kzxA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9067 | 115 | 243 | 3.40.50.1000 |
| af_P32662_111_227_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9005 | 117 | 226 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6C1SVL6-F1-model_v4 | Phosphoglycolate phosphatase (PGP) (PGPase) (EC 3.1.3.18) | 0.9798 | 29 | 244 |
GO:0005829
GO:0005975 GO:0006281 GO:0008967 GO:0046295 GO:0046872 |
| AF-A0A2E6E0E0-F1-model_v4 | phosphoglycolate phosphatase (EC 3.1.3.18) | 0.9798 | 29 | 243 |
GO:0005829
GO:0006281 GO:0008967 |
| AF-A0A661FXP3-F1-model_v4 | phosphoglycolate phosphatase (EC 3.1.3.18) | 0.9771 | 30 | 243 |
GO:0005829
GO:0005975 GO:0006281 GO:0008967 |
| AF-A0A846N137-F1-model_v4 | phosphoglycolate phosphatase (EC 3.1.3.18) | 0.9763 | 31 | 243 |
GO:0005829
GO:0006281 GO:0008967 |
| AF-A0A2E9E6S7-F1-model_v4 | Phosphoglycolate phosphatase (PGP) (PGPase) (EC 3.1.3.18) | 0.976 | 29 | 243 |
GO:0005829
GO:0005975 GO:0006281 GO:0008967 GO:0046295 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar