F318298

General Info

Members Datasets Scaffolds Average Seq Length
208 147 205 227

Family's Representative Sequence

Representative Sequence 3300047469|Ga0495673_0024237|Ga0495673_0024237_1098_1847
Length 249
Sequence MELLMARLMPRRACLFQHPPPFDPAMSAFQTSRFRTVVFDLDGTLADTAPDLTASLNHTLGKLGRPAVPAEDVRHMVGHGVRALLRNGLAATGEVSEELIDEGFPIFFNYYAAHIADHTRPFPGVEEALAALEADGVKIAVCTNKLEALTFDLLAALGWKDRFAAVVGGDTLPVRKPDPAPLFEAIARAGGEGPAAFVGDSITDTDTAKAAGLPCVALSFGFSDRPPSELGADRLIDHWDELIPALASL

Samples

Sample ID Description Type Environment
1 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
2 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
3 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
102 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
103 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
104 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
105 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
106 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
122 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
123 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
130 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
131 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
132 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
144 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
145 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
146 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.6
Metatranscriptomes 0.96
Isolates 1.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.85
Nodule 0
Rhizoplane 1.44
Rhizosphere 83.17
Stem 0
Stem Tuber 0
Unclassified 11.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1006352 3300001915 Bacteria 2378
2 JGI24737J22298_10004343 3300001990 Bacteria 4950
3 JGI24737J22298_10007894 3300001990 Bacteria 3583
4 JGI24737J22298_10028005 3300001990 Bacteria 1773
5 JGI24743J22301_10011853 3300001991 Bacteria 1578
6 JGI24735J21928_10000526 3300002067 Bacteria 13543
7 JGI24735J21928_10002785 3300002067 Bacteria 6037
8 JGI24735J21928_10040715 3300002067 Bacteria 1355
9 JGI24735J21928_10100054 3300002067 Bacteria 832
10 JGI24744J21845_10000194 3300002077 Bacteria 9347
11 rootH1_10046480 3300003316 Bacteria 4251
12 rootH2_10280733 3300003320 Bacteria 1423
13 Ga0055542_1003702 3300003762 Bacteria 4000
14 Ga0070658_10003163 3300005327 Bacteria 13593
15 Ga0070676_10043962 3300005328 Bacteria 2598
16 Ga0068869_100018341 3300005334 Bacteria 4762
17 Ga0070680_100050334 3300005336 Bacteria 3398
18 Ga0068868_100012870 3300005338 Bacteria 6120
19 Ga0070660_100000561 3300005339 Bacteria 24963
20 Ga0070660_100001369 3300005339 Bacteria 16556
21 Ga0070660_100027705 3300005339 Bacteria 4231
22 Ga0070661_100000064 3300005344 Bacteria 84753
23 Ga0070661_100273419 3300005344 Bacteria 1309
24 Ga0070675_100000664 3300005354 Bacteria 23789
25 Ga0070671_100002574 3300005355 Bacteria 14066
26 Ga0070671_100300426 3300005355 Bacteria 1367
27 Ga0070673_100000007 3300005364 Bacteria 177157
28 Ga0070667_100000302 3300005367 Bacteria 55150
29 Ga0070662_100030414 3300005457 Bacteria 3777
30 Ga0070662_100131112 3300005457 Bacteria 1933
31 Ga0070681_10246069 3300005458 Bacteria 1701
32 Ga0068867_100000134 3300005459 Bacteria 47761
33 Ga0070679_100000015 3300005530 Bacteria 142672
34 Ga0070679_100148012 3300005530 Bacteria 2326
35 Ga0068853_100063129 3300005539 Bacteria 3208
36 Ga0068853_100299951 3300005539 Bacteria 1485
37 Ga0068853_100396559 3300005539 Bacteria 1291
38 Ga0070672_100085591 3300005543 Bacteria 2534
39 Ga0070693_100091212 3300005547 Bacteria 1837
40 Ga0068857_100376502 3300005577 Bacteria 1317
41 Ga0068854_100074815 3300005578 Bacteria 2485
42 Ga0068852_100001105 3300005616 Bacteria 17765
43 Ga0068863_100004768 3300005841 Bacteria 13361
44 Ga0068860_100000416 3300005843 Bacteria 55156
45 Ga0068862_100025747 3300005844 Bacteria 4941
46 Ga0075370_10056189 3300006353 Bacteria 2237
47 Ga0068865_100000008 3300006881 Bacteria 177158
48 Ga0105240_10029040 3300009093 Bacteria 7213
49 Ga0105245_10252774 3300009098 Bacteria 1713
50 Ga0105243_10000615 3300009148 Bacteria 35494
51 Ga0105242_10000437 3300009176 Bacteria 33251
52 Ga0105248_10022431 3300009177 Bacteria 7002
53 Ga0105237_10434786 3300009545 Bacteria 1318
54 Ga0105238_10092140 3300009551 Bacteria 3018
55 Ga0105239_10170493 3300010375 Bacteria 2433
56 Ga0105239_10533986 3300010375 Bacteria 1335
57 Ga0105246_10228359 3300011119 Bacteria 1464
58 Ga0157373_10110638 3300013100 Bacteria 1931
59 Ga0157373_10236611 3300013100 Bacteria 1290
60 Ga0157371_10152254 3300013102 Bacteria 1650
61 Ga0157370_10000527 3300013104 Bacteria 47825
62 Ga0157369_10051503 3300013105 Bacteria 4455
63 Ga0157372_10018298 3300013307 Bacteria 7532
64 Ga0157372_10139478 3300013307 Bacteria 2792
65 Ga0157372_10245548 3300013307 Bacteria 2078
66 Ga0157372_10948057 3300013307 Bacteria 998
67 Ga0157377_10235545 3300014745 Bacteria 1179
68 Ga0157376_10000315 3300014969 Bacteria 32437
69 Ga0206354_10967945 3300020081 Bacteria 3161
70 Ga0206353_11261817 3300020082 Bacteria 25116
71 Ga0209148_1000858 3300025254 Bacteria 21270
72 Ga0209676_1001881 3300025292 Bacteria 17151
73 Ga0207647_10000706 3300025904 Bacteria 26190
74 Ga0207647_10001778 3300025904 Bacteria 16531
75 Ga0207647_10194294 3300025904 Bacteria 1175
76 Ga0207645_10001217 3300025907 Bacteria 21219
77 Ga0207645_10019757 3300025907 Bacteria 4413
78 Ga0207705_10000022 3300025909 Bacteria 302232
79 Ga0207705_10000116 3300025909 Bacteria 89237
80 Ga0207705_10030175 3300025909 Bacteria 3868
81 Ga0207695_10163569 3300025913 Bacteria 2155
82 Ga0207657_10001820 3300025919 Bacteria 22995
83 Ga0207657_10002277 3300025919 Bacteria 20811
84 Ga0207657_10073476 3300025919 Bacteria 2889
85 Ga0207657_10285219 3300025919 Bacteria 1310
86 Ga0207649_10000102 3300025920 Bacteria 70205
87 Ga0207659_10002169 3300025926 Bacteria 11660
88 Ga0207687_10007030 3300025927 Bacteria 7420
89 Ga0207644_10009380 3300025931 Bacteria 6428
90 Ga0207644_10254831 3300025931 Bacteria 1401
91 Ga0207706_10005743 3300025933 Bacteria 11555
92 Ga0207706_10062586 3300025933 Bacteria 3277
93 Ga0207706_10085938 3300025933 Bacteria 2765
94 Ga0207686_10000908 3300025934 Bacteria 17774
95 Ga0207709_10000399 3300025935 Bacteria 42600
96 Ga0207704_10000013 3300025938 Bacteria 170478
97 Ga0207691_10239626 3300025940 Bacteria 1568
98 Ga0207711_10037967 3300025941 Bacteria 4095
99 Ga0207689_10027430 3300025942 Bacteria 4767
100 Ga0207667_10000113 3300025949 Bacteria 131083
101 Ga0207651_10000013 3300025960 Bacteria 177573
102 Ga0207668_10392209 3300025972 Bacteria 1171
103 Ga0207640_10017681 3300025981 Bacteria 4176
104 Ga0207658_10000263 3300025986 Bacteria 55175
105 Ga0207677_10007087 3300026023 Bacteria 6171
106 Ga0207639_10141698 3300026041 Bacteria 2004
107 Ga0207639_10148700 3300026041 Bacteria 1960
108 Ga0207639_10320572 3300026041 Bacteria 1376
109 Ga0207702_10078025 3300026078 Bacteria 2866
110 Ga0207641_10004136 3300026088 Bacteria 12646
111 Ga0207648_10000382 3300026089 Bacteria 48961
112 Ga0207674_10034918 3300026116 Bacteria 5251
113 Ga0207698_10000433 3300026142 Bacteria 24089
114 Ga0268265_10074915 3300028380 Bacteria 2649
115 Ga0268264_10000184 3300028381 Bacteria 131402
116 Ga0307405_10001872 3300031731 Bacteria 9036
117 Ga0307413_10039539 3300031824 Bacteria 2744
118 Ga0307413_10102572 3300031824 Bacteria 1894
119 Ga0307410_10069537 3300031852 Bacteria 2436
120 Ga0307406_10001286 3300031901 Bacteria 14068
121 Ga0307406_10007349 3300031901 Bacteria 6105
122 Ga0307412_10005177 3300031911 Bacteria 7306
123 Ga0307416_100057004 3300032002 Bacteria 3157
124 Ga0307414_10200998 3300032004 Bacteria 1621
125 Ga0307414_10863008 3300032004 Bacteria 828
126 Ga0307411_10095604 3300032005 Bacteria 2086
127 Ga0307411_10300472 3300032005 Bacteria 1287
128 Ga0307510_10236003 3300033180 Bacteria 1327
129 Ga0395900_0051281 3300037418 Bacteria 4251
130 Ga0395905_0093463 3300037471 Bacteria 2821
131 Ga0395901_0023347 3300038443 Bacteria 6339
132 Ga0436365_0188271 3300039437 Bacteria 2506
133 Ga0436365_1186027 3300039437 Bacteria 1567
134 Ga0451802_0517091 3300041460 Bacteria 2228
135 Ga0451806_526296 3300041462 Bacteria 2648
136 Ga0451807_1394378 3300041486 Bacteria 1351
137 Ga0439448_0003022 3300042005 Bacteria 4621
138 Ga0439448_0004065 3300042005 Bacteria 4112
139 Ga0439448_0012334 3300042005 Bacteria 2557
140 Ga0439448_0012457 3300042005 Bacteria 2545
141 Ga0439455_0000053 3300042012 Bacteria 10335
142 Ga0439455_0002183 3300042012 Bacteria 3502
143 Ga0439455_0003643 3300042012 Bacteria 2970
144 Ga0439455_0023311 3300042012 Bacteria 1489
145 Ga0439455_0049465 3300042012 Bacteria 1095
146 Ga0439458_0000111 3300042157 Bacteria 16357
147 Ga0439458_0000384 3300042157 Bacteria 11121
148 Ga0439458_0002641 3300042157 Bacteria 4323
149 Ga0466972_0003112 3300044658 Bacteria 8234
150 Ga0466965_0039132 3300044683 Bacteria 2330
151 Ga0466964_0001546 3300044706 Bacteria 7911
152 Ga0466964_0041031 3300044706 Bacteria 1870
153 Ga0466968_0020218 3300044735 Bacteria 2685
154 Ga0466968_0125200 3300044735 Bacteria 1165
155 Ga0466970_0012301 3300044765 Bacteria 4373
156 Ga0466970_0232718 3300044765 Bacteria 1030
157 Ga0466957_0426778 3300044842 Bacteria 910
158 Ga0466960_0000830 3300044901 Bacteria 10881
159 Ga0466959_0014145 3300045049 Bacteria 5792
160 Ga0495638_0026921 3300046460 Bacteria 3725
161 Ga0495583_0001959 3300046506 Bacteria 18914
162 Ga0495648_0089435 3300046524 Bacteria 1728
163 Ga0495611_0037162 3300046648 Bacteria 2163
164 Ga0495625_0066495 3300046660 Bacteria 2539
165 Ga0495661_0071393 3300046665 Bacteria 2029
166 Ga0495670_0070938 3300046691 Bacteria 1763
167 Ga0495687_060374 3300047443 Bacteria 1564
168 Ga0495673_0017908 3300047469 Bacteria 3584
169 Ga0495673_0024237 3300047469 Bacteria 2937
170 Ga0495686_0000197 3300047472 Bacteria 112818
171 Ga0496117_0012179 3300048920 Bacteria 7614
172 Ga0496117_0013424 3300048920 Bacteria 7149
173 Ga0496118_0001632 3300048921 Bacteria 33061
174 Ga0496118_0381655 3300048921 Bacteria 739
175 Ga0496119_0042388 3300048922 Bacteria 2886
176 Ga0496121_0009282 3300048924 Bacteria 11347
177 Ga0496122_0030836 3300048925 Bacteria 4481
178 Ga0496122_0046617 3300048925 Bacteria 3354
179 Ga0496122_0230318 3300048925 Bacteria 1054
180 Ga0496123_0000670 3300048926 Bacteria 56630
181 Ga0496123_0013415 3300048926 Bacteria 6882
182 Ga0496123_0058266 3300048926 Bacteria 2507
183 Ga0496124_0005418 3300048927 Bacteria 14369
184 Ga0496124_0059737 3300048927 Bacteria 3201
185 Ga0496125_0303969 3300048928 Bacteria 976
186 Ga0496126_0502907 3300048929 Bacteria 968
187 Ga0495682_0011735 3300049460 Bacteria 3367
188 Ga0501032_0074627 3300049569 Bacteria 2260
189 Ga0501032_0475479 3300049569 Bacteria 799
190 Ga0501033_0018095 3300049570 Bacteria 5324
191 Ga0501034_0159280 3300049571 Bacteria 2229
192 Ga0501034_0218295 3300049571 Bacteria 1860
193 Ga0501043_0071892 3300049579 Bacteria 2717
194 Ga0501043_0173678 3300049579 Bacteria 1681
195 Ga0501047_0000631 3300049581 Bacteria 37077
196 Ga0501083_0082470 3300049744 Bacteria 2131
197 Ga0501083_0290651 3300049744 Bacteria 1063
198 Ga0501282_003180 3300049778 Bacteria 1774
199 Ga0501044_0059161 3300049823 Bacteria 3927
200 Ga0501044_0235874 3300049823 Bacteria 1775
201 nmdc:mga07m45_224375_c1 3300050496 Bacteria 1093
202 Ga0500555_000889 3300053103 Bacteria 10630
203 Ga0500658_0010828 3300053134 Bacteria 3367
204 Ga0500611_001396 3300053727 Bacteria 2648
205 Ga0501082_0117880 3300060353 Bacteria 2300

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0059737 Ga0496124_0059737_2626_3189 187
2 3300025292 Ga0209676_1001881 Ga0209676_100188115 193
3 3300025913 Ga0207695_10163569 Ga0207695_101635692 205
4 3300037418 Ga0395900_0051281 Ga0395900_0051281_16_681 209
5 3300044683 Ga0466965_0039132 Ga0466965_0039132_1126_1791 209
6 3300044765 Ga0466970_0012301 Ga0466970_0012301_271_936 209
7 3300045049 Ga0466959_0014145 Ga0466959_0014145_4317_4982 209
8 3300005336 Ga0070680_100050334 Ga0070680_1000503342 211
9 3300005458 Ga0070681_10246069 Ga0070681_102460692 211
10 3300005530 Ga0070679_100000015 Ga0070679_100000015123 211
11 3300020081 Ga0206354_10967945 Ga0206354_109679453 215
12 3300020082 Ga0206353_11261817 Ga0206353_1126181714 215
13 3300039437 Ga0436365_1186027 Ga0436365_1186027_97_756 217
14 3300049744 Ga0501083_0082470 Ga0501083_0082470_439_1119 217
15 3300049744 Ga0501083_0290651 Ga0501083_0290651_46_726 217
16 3300060353 Ga0501082_0117880 Ga0501082_0117880_1242_1922 217
17 3300006353 Ga0075370_10056189 Ga0075370_100561892 218
18 3300031901 Ga0307406_10001286 Ga0307406_1000128611 218
19 3300037471 Ga0395905_0093463 Ga0395905_0093463_1501_2193 218
20 3300038443 Ga0395901_0023347 Ga0395901_0023347_3256_3948 218
21 3300041486 Ga0451807_1394378 Ga0451807_1394378_241_924 218
22 3300050496 nmdc:mga07m45_224375_c1 nmdc:mga07m45_224375_c1_46_717 218
23 3300053727 Ga0500611_001396 Ga0500611_001396_513_1196 218
24 iso_pu_bacteria 2643221541 2643727103 218
25 iso_pu_bacteria 2643221606 2644046248 218
26 iso_pu_bacteria 2643221671 2644396012 218
27 3300025941 Ga0207711_10037967 Ga0207711_100379672 220
28 3300032004 Ga0307414_10863008 Ga0307414_108630081 220
29 3300039437 Ga0436365_0188271 Ga0436365_0188271_572_1267 220
30 3300048929 Ga0496126_0502907 Ga0496126_0502907_137_802 220
31 3300049570 Ga0501033_0018095 Ga0501033_0018095_2102_2776 220
32 3300049579 Ga0501043_0071892 Ga0501043_0071892_1623_2297 220
33 3300049823 Ga0501044_0059161 Ga0501044_0059161_524_1198 220
34 3300001990 JGI24737J22298_10007894 JGI24737J22298_100078944 221
35 3300001990 JGI24737J22298_10028005 JGI24737J22298_100280052 221
36 3300002067 JGI24735J21928_10000526 JGI24735J21928_100005262 221
37 3300002067 JGI24735J21928_10002785 JGI24735J21928_100027854 221
38 3300002067 JGI24735J21928_10100054 JGI24735J21928_101000541 221
39 3300003316 rootH1_10046480 rootH1_100464802 221
40 3300003320 rootH2_10280733 rootH2_102807332 221
41 3300005327 Ga0070658_10003163 Ga0070658_100031639 221
42 3300005339 Ga0070660_100000561 Ga0070660_10000056118 221
43 3300005344 Ga0070661_100000064 Ga0070661_10000006477 221
44 3300005355 Ga0070671_100002574 Ga0070671_1000025749 221
45 3300005367 Ga0070667_100000302 Ga0070667_1000003023 221
46 3300005457 Ga0070662_100030414 Ga0070662_1000304143 221
47 3300005539 Ga0068853_100396559 Ga0068853_1003965591 221
48 3300005547 Ga0070693_100091212 Ga0070693_1000912123 221
49 3300005616 Ga0068852_100001105 Ga0068852_10000110513 221
50 3300005841 Ga0068863_100004768 Ga0068863_1000047688 221
51 3300005843 Ga0068860_100000416 Ga0068860_1000004163 221
52 3300005844 Ga0068862_100025747 Ga0068862_1000257472 221
53 3300009098 Ga0105245_10252774 Ga0105245_102527742 221
54 3300009148 Ga0105243_10000615 Ga0105243_1000061534 221
55 3300009176 Ga0105242_10000437 Ga0105242_1000043726 221
56 3300009545 Ga0105237_10434786 Ga0105237_104347862 221
57 3300009551 Ga0105238_10092140 Ga0105238_100921402 221
58 3300010375 Ga0105239_10533986 Ga0105239_105339862 221
59 3300011119 Ga0105246_10228359 Ga0105246_102283591 221
60 3300013100 Ga0157373_10110638 Ga0157373_101106382 221
61 3300013100 Ga0157373_10236611 Ga0157373_102366112 221
62 3300013102 Ga0157371_10152254 Ga0157371_101522542 221
63 3300013105 Ga0157369_10051503 Ga0157369_100515034 221
64 3300013307 Ga0157372_10018298 Ga0157372_100182985 221
65 3300013307 Ga0157372_10139478 Ga0157372_101394782 221
66 3300013307 Ga0157372_10245548 Ga0157372_102455482 221
67 3300014745 Ga0157377_10235545 Ga0157377_102355451 221
68 3300014969 Ga0157376_10000315 Ga0157376_1000031518 221
69 3300025254 Ga0209148_1000858 Ga0209148_100085817 221
70 3300025904 Ga0207647_10000706 Ga0207647_1000070620 221
71 3300025904 Ga0207647_10001778 Ga0207647_100017785 221
72 3300025904 Ga0207647_10194294 Ga0207647_101942942 221
73 3300025909 Ga0207705_10030175 Ga0207705_100301754 221
74 3300025919 Ga0207657_10285219 Ga0207657_102852192 221
75 3300025920 Ga0207649_10000102 Ga0207649_1000010266 221
76 3300025931 Ga0207644_10009380 Ga0207644_100093806 221
77 3300025933 Ga0207706_10005743 Ga0207706_100057439 221
78 3300025933 Ga0207706_10085938 Ga0207706_100859383 221
79 3300025972 Ga0207668_10392209 Ga0207668_103922092 221
80 3300025986 Ga0207658_10000263 Ga0207658_1000026356 221
81 3300026078 Ga0207702_10078025 Ga0207702_100780252 221
82 3300026088 Ga0207641_10004136 Ga0207641_100041363 221
83 3300026142 Ga0207698_10000433 Ga0207698_1000043310 221
84 3300028380 Ga0268265_10074915 Ga0268265_100749153 221
85 3300028381 Ga0268264_10000184 Ga0268264_1000018456 221
86 3300031731 Ga0307405_10001872 Ga0307405_100018726 221
87 3300031824 Ga0307413_10039539 Ga0307413_100395393 221
88 3300031824 Ga0307413_10102572 Ga0307413_101025722 221
89 3300031852 Ga0307410_10069537 Ga0307410_100695372 221
90 3300031901 Ga0307406_10007349 Ga0307406_100073493 221
91 3300031911 Ga0307412_10005177 Ga0307412_100051773 221
92 3300032002 Ga0307416_100057004 Ga0307416_1000570043 221
93 3300032004 Ga0307414_10200998 Ga0307414_102009982 221
94 3300032005 Ga0307411_10095604 Ga0307411_100956042 221
95 3300032005 Ga0307411_10300472 Ga0307411_103004722 221
96 3300033180 Ga0307510_10236003 Ga0307510_102360032 221
97 3300041462 Ga0451806_526296 Ga0451806_526296_1759_2424 221
98 3300042005 Ga0439448_0003022 Ga0439448_0003022_32_697 221
99 3300042005 Ga0439448_0004065 Ga0439448_0004065_2192_2857 221
100 3300042005 Ga0439448_0012334 Ga0439448_0012334_232_897 221
101 3300042005 Ga0439448_0012457 Ga0439448_0012457_1322_1987 221
102 3300042012 Ga0439455_0000053 Ga0439455_0000053_2489_3154 221
103 3300042012 Ga0439455_0002183 Ga0439455_0002183_29_694 221
104 3300042012 Ga0439455_0003643 Ga0439455_0003643_783_1448 221
105 3300042012 Ga0439455_0023311 Ga0439455_0023311_104_769 221
106 3300042012 Ga0439455_0049465 Ga0439455_0049465_166_831 221
107 3300042157 Ga0439458_0000111 Ga0439458_0000111_15012_15677 221
108 3300042157 Ga0439458_0000384 Ga0439458_0000384_7495_8160 221
109 3300042157 Ga0439458_0002641 Ga0439458_0002641_2120_2785 221
110 3300044658 Ga0466972_0003112 Ga0466972_0003112_2635_3300 221
111 3300044706 Ga0466964_0001546 Ga0466964_0001546_404_1069 221
112 3300044706 Ga0466964_0041031 Ga0466964_0041031_72_737 221
113 3300044735 Ga0466968_0020218 Ga0466968_0020218_168_833 221
114 3300044901 Ga0466960_0000830 Ga0466960_0000830_5025_5690 221
115 3300046460 Ga0495638_0026921 Ga0495638_0026921_1262_1930 221
116 3300046506 Ga0495583_0001959 Ga0495583_0001959_7028_7696 221
117 3300046524 Ga0495648_0089435 Ga0495648_0089435_936_1601 221
118 3300046648 Ga0495611_0037162 Ga0495611_0037162_1029_1697 221
119 3300046660 Ga0495625_0066495 Ga0495625_0066495_958_1623 221
120 3300046665 Ga0495661_0071393 Ga0495661_0071393_413_1081 221
121 3300046691 Ga0495670_0070938 Ga0495670_0070938_823_1491 221
122 3300047443 Ga0495687_060374 Ga0495687_060374_14_679 221
123 3300047469 Ga0495673_0017908 Ga0495673_0017908_800_1468 221
124 3300048920 Ga0496117_0012179 Ga0496117_0012179_6393_7058 221
125 3300048920 Ga0496117_0013424 Ga0496117_0013424_2704_3375 221
126 3300048921 Ga0496118_0001632 Ga0496118_0001632_29407_30078 221
127 3300048921 Ga0496118_0381655 Ga0496118_0381655_19_684 221
128 3300048924 Ga0496121_0009282 Ga0496121_0009282_7516_8181 221
129 3300048925 Ga0496122_0030836 Ga0496122_0030836_1388_2053 221
130 3300048925 Ga0496122_0046617 Ga0496122_0046617_693_1361 221
131 3300048925 Ga0496122_0230318 Ga0496122_0230318_93_764 221
132 3300048926 Ga0496123_0000670 Ga0496123_0000670_11715_12383 221
133 3300048926 Ga0496123_0013415 Ga0496123_0013415_5988_6653 221
134 3300048926 Ga0496123_0058266 Ga0496123_0058266_550_1218 221
135 3300048927 Ga0496124_0005418 Ga0496124_0005418_11944_12612 221
136 3300048928 Ga0496125_0303969 Ga0496125_0303969_34_714 221
137 3300049460 Ga0495682_0011735 Ga0495682_0011735_266_934 221
138 3300049569 Ga0501032_0475479 Ga0501032_0475479_74_748 221
139 3300049571 Ga0501034_0159280 Ga0501034_0159280_573_1247 221
140 3300053103 Ga0500555_000889 Ga0500555_000889_1007_1675 221
141 3300010375 Ga0105239_10170493 Ga0105239_101704932 222
142 3300049778 Ga0501282_003180 Ga0501282_003180_508_1179 222
143 3300053134 Ga0500658_0010828 Ga0500658_0010828_2116_2787 222
144 3300009177 Ga0105248_10022431 Ga0105248_100224313 223
145 3300005457 Ga0070662_100131112 Ga0070662_1001311122 225
146 3300005539 Ga0068853_100063129 Ga0068853_1000631293 225
147 3300005577 Ga0068857_100376502 Ga0068857_1003765022 225
148 3300005578 Ga0068854_100074815 Ga0068854_1000748154 225
149 3300025933 Ga0207706_10062586 Ga0207706_100625863 225
150 3300025981 Ga0207640_10017681 Ga0207640_100176812 225
151 3300026041 Ga0207639_10148700 Ga0207639_101487002 225
152 3300026116 Ga0207674_10034918 Ga0207674_100349185 225
153 3300049569 Ga0501032_0074627 Ga0501032_0074627_1287_1979 226
154 3300049571 Ga0501034_0218295 Ga0501034_0218295_858_1550 226
155 3300049579 Ga0501043_0173678 Ga0501043_0173678_540_1232 226
156 3300049581 Ga0501047_0000631 Ga0501047_0000631_9002_9694 226
157 3300049823 Ga0501044_0235874 Ga0501044_0235874_191_883 226
158 3300041460 Ga0451802_0517091 Ga0451802_0517091_1430_2113 227
159 3300009093 Ga0105240_10029040 Ga0105240_100290406 228
160 3300044735 Ga0466968_0125200 Ga0466968_0125200_228_938 236
161 3300005530 Ga0070679_100148012 Ga0070679_1001480122 241
162 3300013307 Ga0157372_10948057 Ga0157372_109480572 243
163 3300047469 Ga0495673_0024237 Ga0495673_0024237_1098_1847 243
164 3300047472 Ga0495686_0000197 Ga0495686_0000197_47631_48380 243
165 3300048922 Ga0496119_0042388 Ga0496119_0042388_922_1671 243
166 3300001915 JGI24741J21665_1006352 JGI24741J21665_10063523 244
167 3300001990 JGI24737J22298_10004343 JGI24737J22298_100043432 244
168 3300001991 JGI24743J22301_10011853 JGI24743J22301_100118532 244
169 3300002067 JGI24735J21928_10040715 JGI24735J21928_100407151 244
170 3300002077 JGI24744J21845_10000194 JGI24744J21845_100001945 244
171 3300003762 Ga0055542_1003702 Ga0055542_10037024 244
172 3300005328 Ga0070676_10043962 Ga0070676_100439622 244
173 3300005334 Ga0068869_100018341 Ga0068869_1000183414 244
174 3300005338 Ga0068868_100012870 Ga0068868_1000128707 244
175 3300005339 Ga0070660_100001369 Ga0070660_10000136916 244
176 3300005339 Ga0070660_100027705 Ga0070660_1000277052 244
177 3300005344 Ga0070661_100273419 Ga0070661_1002734191 244
178 3300005354 Ga0070675_100000664 Ga0070675_10000066417 244
179 3300005355 Ga0070671_100300426 Ga0070671_1003004262 244
180 3300005364 Ga0070673_100000007 Ga0070673_100000007126 244
181 3300005459 Ga0068867_100000134 Ga0068867_10000013433 244
182 3300005539 Ga0068853_100299951 Ga0068853_1002999512 244
183 3300005543 Ga0070672_100085591 Ga0070672_1000855912 244
184 3300006881 Ga0068865_100000008 Ga0068865_10000000834 244
185 3300013104 Ga0157370_10000527 Ga0157370_1000052717 244
186 3300025907 Ga0207645_10001217 Ga0207645_100012178 244
187 3300025907 Ga0207645_10019757 Ga0207645_100197572 244
188 3300025909 Ga0207705_10000022 Ga0207705_1000002217 244
189 3300025909 Ga0207705_10000116 Ga0207705_1000011616 244
190 3300025919 Ga0207657_10001820 Ga0207657_100018206 244
191 3300025919 Ga0207657_10002277 Ga0207657_100022779 244
192 3300025919 Ga0207657_10073476 Ga0207657_100734762 244
193 3300025926 Ga0207659_10002169 Ga0207659_100021697 244
194 3300025927 Ga0207687_10007030 Ga0207687_100070305 244
195 3300025931 Ga0207644_10254831 Ga0207644_102548312 244
196 3300025934 Ga0207686_10000908 Ga0207686_100009082 244
197 3300025935 Ga0207709_10000399 Ga0207709_1000039914 244
198 3300025938 Ga0207704_10000013 Ga0207704_1000001329 244
199 3300025940 Ga0207691_10239626 Ga0207691_102396262 244
200 3300025942 Ga0207689_10027430 Ga0207689_100274302 244
201 3300025949 Ga0207667_10000113 Ga0207667_1000011333 244
202 3300025960 Ga0207651_10000013 Ga0207651_10000013127 244
203 3300026023 Ga0207677_10007087 Ga0207677_100070872 244
204 3300026041 Ga0207639_10141698 Ga0207639_101416982 244
205 3300026041 Ga0207639_10320572 Ga0207639_103205721 244
206 3300026089 Ga0207648_10000382 Ga0207648_1000038234 244
207 3300044765 Ga0466970_0232718 Ga0466970_0232718_91_825 244
208 3300044842 Ga0466957_0426778 Ga0466957_0426778_77_811 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

34

212

0.96

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

37

218

0.94

PF12710

HAD

haloacid dehalogenase-like hydrolase

37

209

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hsz-assembly2.cif.gz_B crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution 0.9213 23 239
2hi0-assembly2.cif.gz_B crystal structure of putative phosphoglycolate phosphatase (yp_619066.1) from lactobacillus delbrueckii subsp. bulgaricus atcc baa-365 at 1.51 a resolution 0.8932 29 240
2ah5-assembly1.cif.gz_A hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae 0.8894 29 239
3d6j-assembly1.cif.gz_A crystal structure of putative haloacid dehalogenase-like hydrolase from bacteroides fragilis 0.8869 29 236
2hsz-assembly2.cif.gz_B crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution 0.886 23 239
ID Description Score Start End Superfamily
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9641 117 226 3.40.50.1000
2fi1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9081 117 209 3.40.50.1000
af_D7SFJ0_151_278_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9075 115 232 3.40.50.1000
3kzxA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9067 115 243 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9005 117 226 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A6C1SVL6-F1-model_v4 Phosphoglycolate phosphatase (PGP) (PGPase) (EC 3.1.3.18) 0.9798 29 244 GO:0005829
GO:0005975
GO:0006281
GO:0008967
GO:0046295
GO:0046872
AF-A0A2E6E0E0-F1-model_v4 phosphoglycolate phosphatase (EC 3.1.3.18) 0.9798 29 243 GO:0005829
GO:0006281
GO:0008967
AF-A0A661FXP3-F1-model_v4 phosphoglycolate phosphatase (EC 3.1.3.18) 0.9771 30 243 GO:0005829
GO:0005975
GO:0006281
GO:0008967
AF-A0A846N137-F1-model_v4 phosphoglycolate phosphatase (EC 3.1.3.18) 0.9763 31 243 GO:0005829
GO:0006281
GO:0008967
AF-A0A2E9E6S7-F1-model_v4 Phosphoglycolate phosphatase (PGP) (PGPase) (EC 3.1.3.18) 0.976 29 243 GO:0005829
GO:0005975
GO:0006281
GO:0008967
GO:0046295
GO:0046872

Feature Viewer

pLDDT pTM Quality
90.87 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map