F318264

General Info

Members Datasets Scaffolds Average Seq Length
208 159 203 121

Family's Representative Sequence

Representative Sequence 3300046538|Ga0495609_0002974|Ga0495609_0002974_8249_8611
Length 115
Sequence MIKTYKLYTGADGHSHVQTGTVAEGLFNQASSIRFQESPPHSFLDWHNAPTEQYVITLSGTIEFETRPGETFVILIALDTTGTSHKWKLVDNQPWRRAYVAFDPGHEINFVPDLV

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
3 2919404418 Luteibacter sp. 3190 Isolate Unclassified
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
87 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
88 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
89 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
90 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
91 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
92 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
93 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
103 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
104 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
105 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
106 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
107 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
108 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
115 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
116 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
119 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
120 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
121 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
144 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
145 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
146 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
147 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
148 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
149 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
150 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
151 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
152 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
153 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
156 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
157 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
158 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
159 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.67
Metatranscriptomes 1.92
Isolates 2.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.19
Nodule 0
Rhizoplane 3.85
Rhizosphere 64.9
Stem 0
Stem Tuber 0
Unclassified 11.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000005 3300002737 Bacteria 435925
2 rootH2_10268797 3300003320 Bacteria 2028
3 rootL2_10177546 3300003322 Bacteria 1218
4 rootL2_10209493 3300003322 Bacteria 2584
5 Ga0055540_1002878 3300003792 Bacteria 8735
6 Ga0065714_10070076 3300005288 Bacteria 3978
7 Ga0065704_10028335 3300005289 Bacteria 1006
8 Ga0065707_10102086 3300005295 Bacteria 2827
9 Ga0070658_10195163 3300005327 Unclassified 1707
10 Ga0070666_10156380 3300005335 Bacteria 1592
11 Ga0070682_100183399 3300005337 Bacteria 1464
12 Ga0068868_101253294 3300005338 Bacteria 687
13 Ga0070709_11092983 3300005434 Bacteria 637
14 Ga0070714_100000518 3300005435 Bacteria 27963
15 Ga0070714_100867358 3300005435 Bacteria 876
16 Ga0070713_100514565 3300005436 Bacteria 1130
17 Ga0070711_100010040 3300005439 Bacteria 5845
18 Ga0070711_100781654 3300005439 Unclassified 809
19 Ga0070708_100492428 3300005445 Bacteria 1156
20 Ga0070707_101388552 3300005468 Unclassified 669
21 Ga0070699_101052980 3300005518 Unclassified 746
22 Ga0070697_100497977 3300005536 Bacteria 1065
23 Ga0070697_100653434 3300005536 Bacteria 926
24 Ga0070665_100421126 3300005548 Bacteria 1344
25 Ga0068855_100130153 3300005563 Bacteria 2875
26 Ga0068854_100126323 3300005578 Bacteria 1948
27 Ga0081455_10012790 3300005937 Bacteria 8340
28 Ga0081538_10123908 3300005981 Bacteria 1234
29 Ga0081540_1011203 3300005983 Bacteria 6012
30 Ga0070717_10016132 3300006028 Bacteria 5786
31 Ga0070717_10979189 3300006028 Bacteria 770
32 Ga0075365_10140730 3300006038 Bacteria 1675
33 Ga0075364_10116149 3300006051 Bacteria 1789
34 Ga0070716_100028486 3300006173 Bacteria 3009
35 Ga0070716_100094246 3300006173 Bacteria 1820
36 Ga0070716_101370072 3300006173 Bacteria 574
37 Ga0070712_100004346 3300006175 Bacteria 8733
38 Ga0070712_100466402 3300006175 Bacteria 1054
39 Ga0075367_10257377 3300006178 Bacteria 1095
40 Ga0075369_10023845 3300006186 Bacteria 2532
41 Ga0075369_10064817 3300006186 Bacteria 1600
42 Ga0075369_10232698 3300006186 Bacteria 854
43 Ga0075427_10014661 3300006194 Bacteria 1204
44 Ga0075370_10286742 3300006353 Unclassified 978
45 Ga0068871_101038471 3300006358 Bacteria 764
46 Ga0075428_100338692 3300006844 Bacteria 1615
47 Ga0075433_10189732 3300006852 Bacteria 1828
48 Ga0075433_10838539 3300006852 Unclassified 802
49 Ga0075434_100071839 3300006871 Bacteria 3452
50 Ga0075436_100073052 3300006914 Bacteria 2373
51 Ga0075435_100346012 3300007076 Bacteria 1274
52 Ga0075435_100360790 3300007076 Bacteria 1246
53 Ga0105240_10203555 3300009093 Bacteria 2318
54 Ga0114129_10574486 3300009147 Bacteria 1463
55 Ga0114129_10663159 3300009147 Bacteria 1345
56 Ga0105243_11268456 3300009148 Unclassified 753
57 Ga0105237_10058298 3300009545 Bacteria 3865
58 Ga0105237_10062350 3300009545 Bacteria 3728
59 Ga0105237_10067223 3300009545 Bacteria 3578
60 Ga0105237_10645673 3300009545 Bacteria 1065
61 Ga0105239_10005256 3300010375 Bacteria 15230
62 Ga0105239_10027199 3300010375 Bacteria 6296
63 Ga0157370_11075584 3300013104 Unclassified 727
64 Ga0163162_10597278 3300013306 Bacteria 1230
65 Ga0163162_10663836 3300013306 Bacteria 1166
66 Ga0213872_10003285 3300021361 Bacteria 9026
67 Ga0213872_10010061 3300021361 Bacteria 4511
68 Ga0213872_10082905 3300021361 Bacteria 1439
69 Ga0213872_10094278 3300021361 Bacteria 1337
70 Ga0209437_100043 3300025233 Bacteria 440454
71 Ga0209129_1006197 3300025258 Bacteria 3955
72 Ga0209673_1008599 3300025273 Bacteria 4526
73 Ga0209051_1001267 3300025303 Bacteria 22548
74 Ga0209051_1005430 3300025303 Bacteria 7453
75 Ga0207680_10282111 3300025903 Bacteria 1154
76 Ga0207699_10172317 3300025906 Bacteria 1449
77 Ga0207699_10746224 3300025906 Bacteria 718
78 Ga0207705_10212107 3300025909 Unclassified 1469
79 Ga0207671_10014667 3300025914 Bacteria 6181
80 Ga0207671_10027061 3300025914 Bacteria 4290
81 Ga0207671_10758310 3300025914 Unclassified 771
82 Ga0207693_10052211 3300025915 Bacteria 3206
83 Ga0207693_10738264 3300025915 Unclassified 761
84 Ga0207663_10007528 3300025916 Bacteria 5652
85 Ga0207663_10212447 3300025916 Bacteria 1403
86 Ga0207681_10022285 3300025923 Unclassified 4039
87 Ga0207664_10002687 3300025929 Bacteria 11799
88 Ga0207664_10750578 3300025929 Bacteria 877
89 Ga0207665_10083300 3300025939 Bacteria 2206
90 Ga0207665_10239775 3300025939 Bacteria 1335
91 Ga0207667_10040254 3300025949 Bacteria 4977
92 Ga0207640_10006215 3300025981 Bacteria 6541
93 Ga0207674_10803880 3300026116 Bacteria 908
94 Ga0209813_10168282 3300027866 Bacteria 794
95 Ga0268266_10460834 3300028379 Bacteria 1209
96 Ga0307515_10187594 3300028794 Bacteria 1991
97 Ga0265762_1013860 3300030760 Bacteria 1451
98 Ga0265767_120063 3300030836 Unclassified 503
99 Ga0265770_1038890 3300030878 Unclassified 825
100 Ga0265760_10131360 3300031090 Unclassified 810
101 Ga0307412_10001126 3300031911 Bacteria 15317
102 Ga0307510_10353665 3300033180 Bacteria 919
103 Ga0395900_1054782 3300037418 Bacteria 731
104 Ga0436364_1058574 3300037853 Bacteria 811
105 Ga0436365_0508751 3300039437 Bacteria 1224
106 Ga0436365_1637432 3300039437 Bacteria 1363
107 Ga0436360_0244377 3300039438 Bacteria 2102
108 Ga0436361_0049148 3300039447 Bacteria 10974
109 Ga0436361_0196861 3300039447 Bacteria 21764
110 Ga0436361_0609193 3300039447 Bacteria 2842
111 Ga0436361_1101476 3300039447 Bacteria 7882
112 Ga0436361_1113856 3300039447 Unclassified 1135
113 Ga0436363_0086053 3300039450 Unclassified 700
114 Ga0436362_0739189 3300039453 Unclassified 662
115 Ga0451787_393750 3300041441 Bacteria 1206
116 Ga0451789_0947245 3300041443 Bacteria 1782
117 Ga0451791_0967417 3300041451 Bacteria 824
118 Ga0451793_0436903 3300041452 Unclassified 767
119 Ga0451793_1316674 3300041452 Bacteria 699
120 Ga0451795_1511579 3300041456 Bacteria 1076
121 Ga0451800_0814939 3300041459 Bacteria 536
122 Ga0451802_1931279 3300041460 Bacteria 976
123 Ga0451851_0872640 3300041507 Unclassified 948
124 Ga0495603_0604425 3300046455 Bacteria 628
125 Ga0495629_0244184 3300046459 Bacteria 1236
126 Ga0495638_0567165 3300046460 Bacteria 562
127 Ga0495585_0000770 3300046492 Bacteria 28347
128 Ga0495606_0031424 3300046507 Bacteria 3692
129 Ga0495606_0425481 3300046507 Bacteria 686
130 Ga0495608_0654309 3300046511 Bacteria 628
131 Ga0495618_0891273 3300046514 Unclassified 514
132 Ga0495628_0311944 3300046516 Bacteria 1162
133 Ga0495632_0000003 3300046519 Bacteria 396071
134 Ga0495663_0183722 3300046525 Bacteria 725
135 Ga0495642_0143287 3300046528 Bacteria 1032
136 Ga0495654_0091206 3300046530 Bacteria 1414
137 Ga0495609_0002974 3300046538 Bacteria 10009
138 Ga0495622_0040823 3300046557 Bacteria 2158
139 Ga0495633_0000021 3300046558 Bacteria 227171
140 Ga0495668_0000075 3300046616 Bacteria 163092
141 Ga0495625_0000439 3300046660 Bacteria 62433
142 Ga0495625_0000905 3300046660 Bacteria 39943
143 Ga0495625_0009948 3300046660 Bacteria 7910
144 Ga0495625_0067135 3300046660 Bacteria 2525
145 Ga0495658_0010176 3300046683 Bacteria 4702
146 Ga0495670_0403003 3300046691 Bacteria 739
147 Ga0495600_0300585 3300046809 Bacteria 1013
148 Ga0495687_222186 3300047443 Unclassified 583
149 Ga0495677_0158790 3300047445 Bacteria 872
150 Ga0495679_010073 3300047446 Bacteria 3738
151 Ga0495686_0000111 3300047472 Bacteria 168708
152 Ga0495614_0082784 3300048089 Bacteria 1391
153 Ga0495615_0171298 3300048090 Bacteria 657
154 Ga0496116_0287741 3300048919 Bacteria 791
155 Ga0496116_0463910 3300048919 Bacteria 538
156 Ga0496120_0061679 3300048923 Bacteria 2091
157 Ga0496122_0151415 3300048925 Bacteria 1431
158 Ga0496123_0015231 3300048926 Bacteria 6321
159 Ga0496123_0068718 3300048926 Bacteria 2229
160 Ga0496124_0001133 3300048927 Bacteria 41858
161 Ga0496124_0001352 3300048927 Bacteria 36711
162 Ga0496124_0013343 3300048927 Bacteria 8029
163 Ga0496124_0233887 3300048927 Bacteria 1372
164 Ga0496125_0317005 3300048928 Bacteria 947
165 Ga0501034_0052135 3300049571 Bacteria 4123
166 Ga0501036_0638157 3300049572 Bacteria 882
167 Ga0501039_0097649 3300049575 Bacteria 2291
168 Ga0501047_0026032 3300049581 Bacteria 5625
169 Ga0501035_0010548 3300049822 Bacteria 8560
170 Ga0501044_0003598 3300049823 Bacteria 17440
171 nmdc:mga03683_295281_c1 3300050489 Bacteria 759
172 nmdc:mga00v17_311685_c1 3300050491 Bacteria 1022
173 nmdc:mga00v17_381579_c1 3300050491 Bacteria 916
174 nmdc:mga00v17_67785_c1 3300050491 Bacteria 2205
175 nmdc:mga0yw44_205927_c1 3300050492 Bacteria 1300
176 nmdc:mga0yw44_67521_c1 3300050492 Bacteria 2210
177 nmdc:mga0k408_635_c1 3300050493 Bacteria 19349
178 nmdc:mga06z11_234456_c1 3300050494 Bacteria 1076
179 nmdc:mga07m45_251411_c1 3300050496 Bacteria 1028
180 nmdc:mga09592_36526_c1 3300050508 Bacteria 4116
181 nmdc:mga0n895_388883_c1 3300050512 Bacteria 1411
182 nmdc:mga0n895_450517_c1 3300050512 Bacteria 1299
183 nmdc:mga0rr50_297391_c1 3300050513 Bacteria 1350
184 nmdc:mga08x19_55515_c1 3300050514 Bacteria 2553
185 nmdc:mga0a205_775527_c1 3300050515 Unclassified 807
186 nmdc:mga0sz30_203422_c1 3300050516 Bacteria 879
187 Ga0500583_0210407 3300053092 Bacteria 965
188 Ga0500569_005753 3300053109 Bacteria 2680
189 Ga0500608_129498 3300053122 Bacteria 1133
190 Ga0500614_015923 3300053123 Bacteria 1681
191 Ga0500618_000092 3300053125 Bacteria 73216
192 Ga0500658_0002417 3300053134 Bacteria 7228
193 Ga0500561_0032305 3300053137 Bacteria 1329
194 Ga0500561_0107740 3300053137 Unclassified 841
195 Ga0500577_0000431 3300053142 Bacteria 10785
196 Ga0500579_174493 3300053143 Bacteria 865
197 Ga0500590_039434 3300053148 Bacteria 2435
198 Ga0500616_0014757 3300053153 Bacteria 4482
199 Ga0500619_252153 3300053154 Bacteria 581
200 Ga0500624_000423 3300053157 Bacteria 12913
201 Ga0500633_0080212 3300053160 Unclassified 1180
202 Ga0500634_0098499 3300053161 Bacteria 1469
203 Ga0500636_0125562 3300053177 Bacteria 1435

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300033180 Ga0307510_10353665 Ga0307510_103536652 94
2 3300046538 Ga0495609_0002974 Ga0495609_0002974_8249_8611 115
3 3300046691 Ga0495670_0403003 Ga0495670_0403003_28_390 115
4 3300048919 Ga0496116_0287741 Ga0496116_0287741_295_672 115
5 3300048919 Ga0496116_0463910 Ga0496116_0463910_11_388 115
6 3300048923 Ga0496120_0061679 Ga0496120_0061679_1184_1561 115
7 3300048925 Ga0496122_0151415 Ga0496122_0151415_122_499 115
8 3300048926 Ga0496123_0015231 Ga0496123_0015231_2157_2534 115
9 3300048926 Ga0496123_0068718 Ga0496123_0068718_246_623 115
10 3300048927 Ga0496124_0001133 Ga0496124_0001133_3773_4150 115
11 3300048927 Ga0496124_0001352 Ga0496124_0001352_18764_19141 115
12 3300048927 Ga0496124_0013343 Ga0496124_0013343_3882_4259 115
13 3300048928 Ga0496125_0317005 Ga0496125_0317005_206_583 115
14 3300049571 Ga0501034_0052135 Ga0501034_0052135_3161_3538 115
15 3300049572 Ga0501036_0638157 Ga0501036_0638157_473_850 115
16 3300049575 Ga0501039_0097649 Ga0501039_0097649_60_437 115
17 3300049581 Ga0501047_0026032 Ga0501047_0026032_3071_3448 115
18 3300049822 Ga0501035_0010548 Ga0501035_0010548_6384_6761 115
19 3300049823 Ga0501044_0003598 Ga0501044_0003598_8498_8875 115
20 3300050516 nmdc:mga0sz30_203422_c1 nmdc:mga0sz30_203422_c1_464_841 115
21 iso_pu_bacteria 2643221687 2644487638 116
22 iso_pu_bacteria 2884338543 2884340845 117
23 iso_pu_bacteria 2919404418 2919405706 117
24 iso_pu_bacteria 2919437846 2919442975 117
25 iso_pu_bacteria 2928526807 2928529414 117
26 3300005335 Ga0070666_10156380 Ga0070666_101563802 118
27 3300005548 Ga0070665_100421126 Ga0070665_1004211262 118
28 3300009545 Ga0105237_10645673 Ga0105237_106456732 118
29 3300021361 Ga0213872_10082905 Ga0213872_100829052 118
30 3300025903 Ga0207680_10282111 Ga0207680_102821112 118
31 3300025914 Ga0207671_10758310 Ga0207671_107583102 118
32 3300025923 Ga0207681_10022285 Ga0207681_100222852 118
33 3300028379 Ga0268266_10460834 Ga0268266_104608342 118
34 3300039447 Ga0436361_0609193 Ga0436361_0609193_1865_2221 118
35 3300046519 Ga0495632_0000003 Ga0495632_0000003_310993_311376 118
36 3300046528 Ga0495642_0143287 Ga0495642_0143287_431_826 118
37 3300053092 Ga0500583_0210407 Ga0500583_0210407_70_426 118
38 3300053109 Ga0500569_005753 Ga0500569_005753_1892_2248 118
39 3300053134 Ga0500658_0002417 Ga0500658_0002417_5829_6185 118
40 3300053137 Ga0500561_0107740 Ga0500561_0107740_248_604 118
41 3300053142 Ga0500577_0000431 Ga0500577_0000431_4663_5019 118
42 3300053148 Ga0500590_039434 Ga0500590_039434_383_739 118
43 3300053153 Ga0500616_0014757 Ga0500616_0014757_1566_1922 118
44 3300053160 Ga0500633_0080212 Ga0500633_0080212_537_893 118
45 3300053177 Ga0500636_0125562 Ga0500636_0125562_702_1058 118
46 3300005435 Ga0070714_100000518 Ga0070714_10000051828 119
47 3300006028 Ga0070717_10979189 Ga0070717_109791892 119
48 3300021361 Ga0213872_10094278 Ga0213872_100942782 119
49 3300025929 Ga0207664_10002687 Ga0207664_100026876 119
50 3300039437 Ga0436365_1637432 Ga0436365_1637432_101_460 119
51 3300039447 Ga0436361_1101476 Ga0436361_1101476_6171_6530 119
52 3300003792 Ga0055540_1002878 Ga0055540_10028789 120
53 3300005288 Ga0065714_10070076 Ga0065714_100700764 120
54 3300005289 Ga0065704_10028335 Ga0065704_100283352 120
55 3300005295 Ga0065707_10102086 Ga0065707_101020862 120
56 3300005327 Ga0070658_10195163 Ga0070658_101951632 120
57 3300005337 Ga0070682_100183399 Ga0070682_1001833993 120
58 3300005338 Ga0068868_101253294 Ga0068868_1012532942 120
59 3300005434 Ga0070709_11092983 Ga0070709_110929831 120
60 3300005435 Ga0070714_100867358 Ga0070714_1008673581 120
61 3300005436 Ga0070713_100514565 Ga0070713_1005145652 120
62 3300005439 Ga0070711_100010040 Ga0070711_1000100404 120
63 3300005439 Ga0070711_100781654 Ga0070711_1007816541 120
64 3300005445 Ga0070708_100492428 Ga0070708_1004924282 120
65 3300005468 Ga0070707_101388552 Ga0070707_1013885521 120
66 3300005536 Ga0070697_100497977 Ga0070697_1004979771 120
67 3300005536 Ga0070697_100653434 Ga0070697_1006534342 120
68 3300005937 Ga0081455_10012790 Ga0081455_100127905 120
69 3300005981 Ga0081538_10123908 Ga0081538_101239082 120
70 3300005983 Ga0081540_1011203 Ga0081540_10112033 120
71 3300006028 Ga0070717_10016132 Ga0070717_100161322 120
72 3300006038 Ga0075365_10140730 Ga0075365_101407302 120
73 3300006051 Ga0075364_10116149 Ga0075364_101161492 120
74 3300006173 Ga0070716_100028486 Ga0070716_1000284863 120
75 3300006173 Ga0070716_100094246 Ga0070716_1000942462 120
76 3300006173 Ga0070716_101370072 Ga0070716_1013700722 120
77 3300006175 Ga0070712_100004346 Ga0070712_1000043466 120
78 3300006175 Ga0070712_100466402 Ga0070712_1004664022 120
79 3300006178 Ga0075367_10257377 Ga0075367_102573772 120
80 3300006186 Ga0075369_10023845 Ga0075369_100238453 120
81 3300006186 Ga0075369_10064817 Ga0075369_100648173 120
82 3300006194 Ga0075427_10014661 Ga0075427_100146612 120
83 3300006353 Ga0075370_10286742 Ga0075370_102867422 120
84 3300006844 Ga0075428_100338692 Ga0075428_1003386922 120
85 3300006852 Ga0075433_10189732 Ga0075433_101897322 120
86 3300006852 Ga0075433_10838539 Ga0075433_108385392 120
87 3300006871 Ga0075434_100071839 Ga0075434_1000718393 120
88 3300006914 Ga0075436_100073052 Ga0075436_1000730523 120
89 3300007076 Ga0075435_100346012 Ga0075435_1003460122 120
90 3300007076 Ga0075435_100360790 Ga0075435_1003607902 120
91 3300009093 Ga0105240_10203555 Ga0105240_102035552 120
92 3300009147 Ga0114129_10574486 Ga0114129_105744862 120
93 3300009147 Ga0114129_10663159 Ga0114129_106631592 120
94 3300009148 Ga0105243_11268456 Ga0105243_112684562 120
95 3300009545 Ga0105237_10058298 Ga0105237_100582984 120
96 3300010375 Ga0105239_10027199 Ga0105239_100271993 120
97 3300013306 Ga0163162_10597278 Ga0163162_105972783 120
98 3300021361 Ga0213872_10003285 Ga0213872_100032852 120
99 3300025273 Ga0209673_1008599 Ga0209673_10085993 120
100 3300025303 Ga0209051_1001267 Ga0209051_100126720 120
101 3300025303 Ga0209051_1005430 Ga0209051_10054306 120
102 3300025906 Ga0207699_10172317 Ga0207699_101723171 120
103 3300025906 Ga0207699_10746224 Ga0207699_107462241 120
104 3300025909 Ga0207705_10212107 Ga0207705_102121072 120
105 3300025915 Ga0207693_10052211 Ga0207693_100522113 120
106 3300025915 Ga0207693_10738264 Ga0207693_107382642 120
107 3300025916 Ga0207663_10007528 Ga0207663_100075284 120
108 3300025916 Ga0207663_10212447 Ga0207663_102124471 120
109 3300025929 Ga0207664_10750578 Ga0207664_107505781 120
110 3300025939 Ga0207665_10083300 Ga0207665_100833002 120
111 3300025939 Ga0207665_10239775 Ga0207665_102397752 120
112 3300027866 Ga0209813_10168282 Ga0209813_101682822 120
113 3300028794 Ga0307515_10187594 Ga0307515_101875942 120
114 3300037418 Ga0395900_1054782 Ga0395900_1054782_38_400 120
115 3300037853 Ga0436364_1058574 Ga0436364_1058574_341_703 120
116 3300039438 Ga0436360_0244377 Ga0436360_0244377_764_1126 120
117 3300039447 Ga0436361_0196861 Ga0436361_0196861_17031_17393 120
118 3300039450 Ga0436363_0086053 Ga0436363_0086053_143_505 120
119 3300039453 Ga0436362_0739189 Ga0436362_0739189_77_439 120
120 3300041441 Ga0451787_393750 Ga0451787_393750_486_848 120
121 3300041443 Ga0451789_0947245 Ga0451789_0947245_440_802 120
122 3300041451 Ga0451791_0967417 Ga0451791_0967417_208_570 120
123 3300041452 Ga0451793_0436903 Ga0451793_0436903_94_477 120
124 3300041452 Ga0451793_1316674 Ga0451793_1316674_212_580 120
125 3300041456 Ga0451795_1511579 Ga0451795_1511579_410_772 120
126 3300041459 Ga0451800_0814939 Ga0451800_0814939_164_526 120
127 3300041460 Ga0451802_1931279 Ga0451802_1931279_243_605 120
128 3300041507 Ga0451851_0872640 Ga0451851_0872640_516_878 120
129 3300046455 Ga0495603_0604425 Ga0495603_0604425_248_610 120
130 3300046459 Ga0495629_0244184 Ga0495629_0244184_754_1116 120
131 3300046460 Ga0495638_0567165 Ga0495638_0567165_53_415 120
132 3300046492 Ga0495585_0000770 Ga0495585_0000770_12381_12743 120
133 3300046511 Ga0495608_0654309 Ga0495608_0654309_126_488 120
134 3300046514 Ga0495618_0891273 Ga0495618_0891273_122_484 120
135 3300046516 Ga0495628_0311944 Ga0495628_0311944_758_1120 120
136 3300046525 Ga0495663_0183722 Ga0495663_0183722_190_552 120
137 3300046530 Ga0495654_0091206 Ga0495654_0091206_960_1322 120
138 3300046557 Ga0495622_0040823 Ga0495622_0040823_1347_1709 120
139 3300046558 Ga0495633_0000021 Ga0495633_0000021_195067_195429 120
140 3300046616 Ga0495668_0000075 Ga0495668_0000075_35751_36113 120
141 3300046660 Ga0495625_0000439 Ga0495625_0000439_49539_49901 120
142 3300046660 Ga0495625_0000905 Ga0495625_0000905_31555_31917 120
143 3300046683 Ga0495658_0010176 Ga0495658_0010176_1380_1742 120
144 3300046809 Ga0495600_0300585 Ga0495600_0300585_16_378 120
145 3300047445 Ga0495677_0158790 Ga0495677_0158790_291_653 120
146 3300048089 Ga0495614_0082784 Ga0495614_0082784_343_705 120
147 3300048090 Ga0495615_0171298 Ga0495615_0171298_48_410 120
148 3300048927 Ga0496124_0233887 Ga0496124_0233887_563_925 120
149 3300050489 nmdc:mga03683_295281_c1 nmdc:mga03683_295281_c1_360_722 120
150 3300050491 nmdc:mga00v17_311685_c1 nmdc:mga00v17_311685_c1_280_642 120
151 3300050491 nmdc:mga00v17_381579_c1 nmdc:mga00v17_381579_c1_131_493 120
152 3300050491 nmdc:mga00v17_67785_c1 nmdc:mga00v17_67785_c1_838_1200 120
153 3300050492 nmdc:mga0yw44_205927_c1 nmdc:mga0yw44_205927_c1_772_1134 120
154 3300050492 nmdc:mga0yw44_67521_c1 nmdc:mga0yw44_67521_c1_897_1259 120
155 3300050493 nmdc:mga0k408_635_c1 nmdc:mga0k408_635_c1_9044_9406 120
156 3300050494 nmdc:mga06z11_234456_c1 nmdc:mga06z11_234456_c1_696_1058 120
157 3300050496 nmdc:mga07m45_251411_c1 nmdc:mga07m45_251411_c1_493_855 120
158 3300050508 nmdc:mga09592_36526_c1 nmdc:mga09592_36526_c1_583_945 120
159 3300050512 nmdc:mga0n895_388883_c1 nmdc:mga0n895_388883_c1_670_1032 120
160 3300050513 nmdc:mga0rr50_297391_c1 nmdc:mga0rr50_297391_c1_643_1005 120
161 3300050514 nmdc:mga08x19_55515_c1 nmdc:mga08x19_55515_c1_477_839 120
162 3300050515 nmdc:mga0a205_775527_c1 nmdc:mga0a205_775527_c1_60_422 120
163 3300053122 Ga0500608_129498 Ga0500608_129498_721_1083 120
164 3300053123 Ga0500614_015923 Ga0500614_015923_940_1302 120
165 3300053137 Ga0500561_0032305 Ga0500561_0032305_926_1288 120
166 3300053154 Ga0500619_252153 Ga0500619_252153_46_408 120
167 3300002737 JGI25162J39368_1000005 JGI25162J39368_1000005355 121
168 3300003320 rootH2_10268797 rootH2_102687973 121
169 3300003322 rootL2_10177546 rootL2_101775462 121
170 3300003322 rootL2_10209493 rootL2_102094931 121
171 3300005518 Ga0070699_101052980 Ga0070699_1010529802 121
172 3300005563 Ga0068855_100130153 Ga0068855_1001301534 121
173 3300005578 Ga0068854_100126323 Ga0068854_1001263234 121
174 3300006186 Ga0075369_10232698 Ga0075369_102326982 121
175 3300006358 Ga0068871_101038471 Ga0068871_1010384712 121
176 3300009545 Ga0105237_10062350 Ga0105237_100623504 121
177 3300009545 Ga0105237_10067223 Ga0105237_100672232 121
178 3300010375 Ga0105239_10005256 Ga0105239_1000525610 121
179 3300013104 Ga0157370_11075584 Ga0157370_110755841 121
180 3300013306 Ga0163162_10663836 Ga0163162_106638361 121
181 3300021361 Ga0213872_10010061 Ga0213872_100100613 121
182 3300025233 Ga0209437_100043 Ga0209437_10004351 121
183 3300025258 Ga0209129_1006197 Ga0209129_10061971 121
184 3300025914 Ga0207671_10014667 Ga0207671_100146674 121
185 3300025914 Ga0207671_10027061 Ga0207671_100270613 121
186 3300025949 Ga0207667_10040254 Ga0207667_100402544 121
187 3300025981 Ga0207640_10006215 Ga0207640_100062152 121
188 3300026116 Ga0207674_10803880 Ga0207674_108038801 121
189 3300030760 Ga0265762_1013860 Ga0265762_10138602 121
190 3300030836 Ga0265767_120063 Ga0265767_1200631 121
191 3300030878 Ga0265770_1038890 Ga0265770_10388902 121
192 3300031090 Ga0265760_10131360 Ga0265760_101313602 121
193 3300031911 Ga0307412_10001126 Ga0307412_100011269 121
194 3300039437 Ga0436365_0508751 Ga0436365_0508751_316_696 121
195 3300039447 Ga0436361_0049148 Ga0436361_0049148_3585_3956 121
196 3300039447 Ga0436361_1113856 Ga0436361_1113856_486_863 121
197 3300046507 Ga0495606_0031424 Ga0495606_0031424_1801_2190 121
198 3300046507 Ga0495606_0425481 Ga0495606_0425481_153_524 121
199 3300046660 Ga0495625_0009948 Ga0495625_0009948_3396_3767 121
200 3300046660 Ga0495625_0067135 Ga0495625_0067135_1385_1753 121
201 3300047443 Ga0495687_222186 Ga0495687_222186_13_384 121
202 3300047446 Ga0495679_010073 Ga0495679_010073_2315_2710 121
203 3300047472 Ga0495686_0000111 Ga0495686_0000111_34132_34503 121
204 3300050512 nmdc:mga0n895_450517_c1 nmdc:mga0n895_450517_c1_803_1168 121
205 3300053125 Ga0500618_000092 Ga0500618_000092_56052_56447 121
206 3300053143 Ga0500579_174493 Ga0500579_174493_67_438 121
207 3300053157 Ga0500624_000423 Ga0500624_000423_9936_10301 121
208 3300053161 Ga0500634_0098499 Ga0500634_0098499_717_1082 121

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o5u-assembly2.cif.gz_B crystal structure of a duf861 family protein (tm1112) from thermotoga maritima at 1.83 a resolution 0.8541 34 107
3lwc-assembly1.cif.gz_A-2 crystal structure of structural genomics, unknown function (yp_766765.1) from rhizobium leguminosarum bv. viciae 3841 at 1.40 a resolution 0.8471 33 109
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.8353 33 105
3gbg-assembly1.cif.gz_A crystal structure of toxt from vibrio cholerae o395 0.8224 32 107
5wse-assembly2.cif.gz_C crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.8166 33 105
ID Description Score Start End Superfamily
1o5uB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8541 34 107 2.60.120.10
af_Q6K9G4_18_110_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8506 32 104 2.60.120.10
af_C6SYR7_40_141_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8236 34 104 2.60.120.10
3gbgA01 Mainly Beta;Sandwich;Jelly Rolls; 0.814 32 107 2.60.120.810
3lwcA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8024 33 109 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A840B2F5-F1-model_v4 deleted 0.9936 1 120
AF-A0A494VUI8-F1-model_v4 Cupin domain-containing protein 0.9871 1 118
AF-A0A1I7EP26-F1-model_v4 Cupin domain protein 0.983 2 121
AF-A0A561H7S7-F1-model_v4 deleted 0.9828 2 120
AF-A0A858X6K5-F1-model_v4 Cupin domain-containing protein 0.9815 1 107

Feature Viewer

pLDDT pTM Quality
93.41 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map