F318212

General Info

Members Datasets Scaffolds Average Seq Length
208 173 174 322

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0000790|Ga0495638_0000790_27569_28540
Length 323
Sequence MESKVIAILAVPGVQLLDVSGPLDVFAEANVQAGREIYRPLVVAVTHGHIRSSSGARLVADYVVGEEMNRLTIDTLLVAGCPNAADIEPDRNAVEWLQQATPGMRRYGSVCSGAFLLAAAGLLDGRRVTTHWAVADKLAEAYPLATVEADAIHVRDGRLRTAAGVTAGLDLALALVEEDLGHDIAMKVAGQLVMFFKRPGGQMQFSRKGEAAAAGRSALQEVQRWVAANPSADHSVASLAKRMELSPRHFARLFREEVGITPAAWVEAARIAAARQLLEEGHAPKHVAAECGFADDDTLRRAFARHIGITPAEYRKRNARAPA

Samples

Sample ID Description Type Environment
1 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
2 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
3 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
4 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
5 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
6 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
7 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
8 2738541277 Variovorax sp. GV051 Isolate Unclassified
9 2738541307 Variovorax sp. GV008 Isolate Unclassified
10 2738543019 Variovorax sp. GV040 Isolate Unclassified
11 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
12 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
13 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
14 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
15 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
16 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
17 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
18 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
19 2855730933 Achromobacter sp. HZ28 Isolate Nodule
20 2855767633 Achromobacter sp. HZ34 Isolate Nodule
21 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
22 2858950400 Achromobacter sp. K91 Isolate Unclassified
23 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
24 2884411467 Dyella sp. AD56 Isolate Rhizosphere
25 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
26 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
27 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
28 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
29 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
30 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
31 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
32 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
33 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
34 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
35 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
36 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
39 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
40 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
41 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
42 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
43 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
44 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
45 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
75 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
103 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
104 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
105 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
106 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
107 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
115 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
125 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
140 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
144 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
160 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
161 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
162 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
163 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
164 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
165 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
168 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
169 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
170 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
171 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
172 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
173 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.65
Metatranscriptomes 0
Isolates 16.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.48
Nodule 2.88
Rhizoplane 0.96
Rhizosphere 48.08
Stem 0
Stem Tuber 0
Unclassified 22.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000028 3300002737 Bacteria 221876
2 JGI25157J39369_1000126 3300002741 Bacteria 65430
3 JGI25163J39215_1000096 3300002771 Bacteria 36239
4 JGI25164J39214_1000012 3300002772 Bacteria 255140
5 JGI25151J46595_10000584 3300003187 Bacteria 32416
6 JGI25165J46597_1000048 3300003214 Bacteria 254392
7 Ga0055538_1000568 3300003751 Bacteria 12728
8 Ga0055535_1000027 3300003761 Bacteria 202056
9 Ga0055535_1000151 3300003761 Bacteria 74028
10 Ga0055542_1000034 3300003762 Bacteria 231972
11 Ga0055529_1000056 3300003763 Bacteria 196316
12 Ga0055524_1026448 3300003775 Bacteria 1793
13 Ga0055540_1010710 3300003792 Bacteria 3028
14 Ga0058692_1030563 3300003856 Bacteria 1022
15 Ga0055543_1000060 3300004625 Bacteria 98330
16 Ga0065165_1000343 3300005262 Bacteria 76286
17 Ga0065714_10094935 3300005288 Bacteria 1793
18 Ga0070666_10000034 3300005335 Bacteria 121537
19 Ga0070661_100053704 3300005344 Bacteria 2950
20 Ga0070668_100169040 3300005347 Bacteria 1779
21 Ga0070665_100007188 3300005548 Bacteria 11317
22 Ga0068854_100044292 3300005578 Bacteria 3157
23 Ga0075369_10015261 3300006186 Bacteria 3081
24 Ga0099794_10060857 3300007265 Bacteria 1834
25 Ga0105251_10000003 3300009011 Bacteria 311814
26 Ga0105250_10000758 3300009092 Bacteria 19643
27 Ga0105240_10043045 3300009093 Bacteria 5749
28 Ga0105237_10000389 3300009545 Bacteria 62514
29 Ga0105238_10107015 3300009551 Bacteria 2778
30 Ga0157373_10184560 3300013100 Bacteria 1469
31 Ga0157370_10000070 3300013104 Bacteria 112014
32 Ga0157369_10073683 3300013105 Bacteria 3663
33 Ga0163162_10000106 3300013306 Bacteria 74934
34 Ga0182008_10000580 3300014497 Bacteria 26983
35 Ga0182006_1050741 3300015261 Bacteria 1598
36 Ga0213872_10005452 3300021361 Bacteria 6542
37 Ga0209760_100786 3300025207 Bacteria 4442
38 Ga0209436_100081 3300025208 Bacteria 48215
39 Ga0209784_100016 3300025224 Bacteria 481036
40 Ga0209672_104817 3300025228 Bacteria 2434
41 Ga0207427_100019 3300025231 Bacteria 513977
42 Ga0209437_100054 3300025233 Bacteria 366715
43 Ga0209258_100039 3300025242 Bacteria 386366
44 Ga0209646_1000269 3300025246 Bacteria 48883
45 Ga0209026_1000012 3300025250 Bacteria 480426
46 Ga0209148_1000001 3300025254 Bacteria 2545271
47 Ga0209233_1000002 3300025261 Bacteria 2501366
48 Ga0209455_1000039 3300025272 Bacteria 437734
49 Ga0209673_1003145 3300025273 Bacteria 10084
50 Ga0209130_1000023 3300025284 Bacteria 359355
51 Ga0209675_1009984 3300025291 Bacteria 3290
52 Ga0209676_1024782 3300025292 Bacteria 1935
53 Ga0209025_1000018 3300025294 Bacteria 686898
54 Ga0209025_1028437 3300025294 Bacteria 2739
55 Ga0209564_1001566 3300025295 Bacteria 22444
56 Ga0209758_1017166 3300025297 Bacteria 3622
57 Ga0209758_1023474 3300025297 Bacteria 2788
58 Ga0209050_1006345 3300025298 Bacteria 7031
59 Ga0209256_1005201 3300025299 Bacteria 7647
60 Ga0207426_1000008 3300025302 Bacteria 848730
61 Ga0209051_1016607 3300025303 Bacteria 3321
62 Ga0207696_1000155 3300025711 Bacteria 115807
63 Ga0207655_1000051 3300025728 Bacteria 294176
64 Ga0207713_1000009 3300025735 Bacteria 551314
65 Ga0207713_1002599 3300025735 Bacteria 13023
66 Ga0207680_10000005 3300025903 Bacteria 660983
67 Ga0207671_10000290 3300025914 Bacteria 73868
68 Ga0207640_10022338 3300025981 Bacteria 3784
69 Ga0209371_1004048 3300027312 Bacteria 6625
70 Ga0209588_1041493 3300027671 Bacteria 1485
71 Ga0268266_10000004 3300028379 Bacteria 1495817
72 Ga0268256_1003598 3300030500 Bacteria 6898
73 Ga0395901_0596736 3300038443 Bacteria 1114
74 Ga0436361_0420654 3300039447 Bacteria 5328
75 Ga0436361_0898454 3300039447 Bacteria 4187
76 Ga0439465_0003400 3300041413 Bacteria 5190
77 Ga0439465_0015023 3300041413 Bacteria 2416
78 Ga0451833_1327554 3300041491 Bacteria 1681
79 Ga0451835_0185345 3300041492 Bacteria 2220
80 Ga0451841_0423896 3300041498 Bacteria 2778
81 Ga0451855_1022649 3300041511 Bacteria 2439
82 Ga0466965_0004159 3300044683 Bacteria 6435
83 Ga0466961_0013360 3300044693 Bacteria 5256
84 Ga0466971_0018334 3300044719 Bacteria 3099
85 Ga0466968_0000940 3300044735 Bacteria 10254
86 Ga0466970_0061999 3300044765 Bacteria 2004
87 Ga0466957_0004540 3300044842 Bacteria 7749
88 Ga0466958_0180868 3300045836 Bacteria 1338
89 Ga0495627_015160 3300046453 Bacteria 2667
90 Ga0495627_024528 3300046453 Bacteria 1965
91 Ga0495591_022235 3300046458 Bacteria 2054
92 Ga0495638_0000790 3300046460 Bacteria 33426
93 Ga0495653_0000277 3300046463 Bacteria 41569
94 Ga0495585_0001577 3300046492 Bacteria 17719
95 Ga0495607_0001115 3300046501 Bacteria 24351
96 Ga0495606_0004255 3300046507 Bacteria 14452
97 Ga0495610_0019162 3300046512 Bacteria 3837
98 Ga0495610_0069487 3300046512 Bacteria 1648
99 Ga0495616_0042148 3300046513 Bacteria 2325
100 Ga0495632_0110637 3300046519 Bacteria 1290
101 Ga0495637_0001023 3300046520 Bacteria 17604
102 Ga0495637_0010268 3300046520 Bacteria 4535
103 Ga0495643_0020373 3300046522 Bacteria 3823
104 Ga0495643_0169160 3300046522 Bacteria 1070
105 Ga0495668_0002378 3300046616 Bacteria 15614
106 Ga0495625_0141135 3300046660 Bacteria 1625
107 Ga0495659_0037216 3300046664 Bacteria 1723
108 Ga0495661_0000055 3300046665 Bacteria 138787
109 Ga0495649_0000615 3300046694 Bacteria 29480
110 Ga0495649_0000892 3300046694 Bacteria 23716
111 Ga0495660_0054567 3300046810 Bacteria 2165
112 Ga0495636_0016926 3300047318 Bacteria 2915
113 Ga0495672_0034814 3300047320 Bacteria 3108
114 Ga0495683_0000014 3300047323 Bacteria 199398
115 Ga0495687_000005 3300047443 Bacteria 610401
116 Ga0495686_0000092 3300047472 Bacteria 189292
117 Ga0495686_0106542 3300047472 Bacteria 1685
118 Ga0496101_0044927 3300048904 Bacteria 3162
119 Ga0496106_0002317 3300048909 Bacteria 14193
120 Ga0496116_0068248 3300048919 Bacteria 2266
121 Ga0496117_0008152 3300048920 Bacteria 10008
122 Ga0496117_0008409 3300048920 Bacteria 9810
123 Ga0496117_0013720 3300048920 Bacteria 7040
124 Ga0496118_0000777 3300048921 Bacteria 51122
125 Ga0496118_0001031 3300048921 Bacteria 43374
126 Ga0496118_0002915 3300048921 Bacteria 22219
127 Ga0496121_0011893 3300048924 Bacteria 9582
128 Ga0496121_0018289 3300048924 Bacteria 7077
129 Ga0496121_0068963 3300048924 Bacteria 2857
130 Ga0496121_0171660 3300048924 Bacteria 1574
131 Ga0496122_0055392 3300048925 Bacteria 2967
132 Ga0496122_0076390 3300048925 Bacteria 2357
133 Ga0496123_0001551 3300048926 Bacteria 31655
134 Ga0496123_0052191 3300048926 Bacteria 2716
135 Ga0496123_0159764 3300048926 Bacteria 1203
136 Ga0496124_0004767 3300048927 Bacteria 15613
137 Ga0496124_0055667 3300048927 Bacteria 3341
138 Ga0496125_0005279 3300048928 Bacteria 14461
139 Ga0496125_0030810 3300048928 Bacteria 4791
140 Ga0496125_0066153 3300048928 Bacteria 2858
141 Ga0496125_0200662 3300048928 Bacteria 1306
142 Ga0496126_0018660 3300048929 Bacteria 6865
143 Ga0496126_0044885 3300048929 Bacteria 4067
144 Ga0501032_0078338 3300049569 Bacteria 2200
145 Ga0501033_0030338 3300049570 Bacteria 4064
146 Ga0501037_0119106 3300049573 Bacteria 1899
147 Ga0501038_0027024 3300049574 Bacteria 5108
148 Ga0501038_0151822 3300049574 Bacteria 1888
149 Ga0501043_0153511 3300049579 Bacteria 1801
150 Ga0501046_0099000 3300049580 Bacteria 2239
151 Ga0501047_0004578 3300049581 Bacteria 13007
152 Ga0501047_0061512 3300049581 Bacteria 3623
153 Ga0501047_0126224 3300049581 Bacteria 2439
154 Ga0501047_0397924 3300049581 Bacteria 1210
155 Ga0501068_0125020 3300049584 Bacteria 1606
156 Ga0501073_0090611 3300049589 Bacteria 2125
157 Ga0501035_0002736 3300049822 Bacteria 17098
158 Ga0501035_0157359 3300049822 Bacteria 1969
159 Ga0501044_0001803 3300049823 Bacteria 24994
160 nmdc:mga0sz30_70177_c1 3300050516 Bacteria 1507
161 Ga0500610_0003278 3300053079 Bacteria 6170
162 Ga0500610_0003281 3300053079 Bacteria 6169
163 Ga0500593_000205 3300053117 Bacteria 24092
164 Ga0500595_006479 3300053119 Bacteria 4961
165 Ga0500607_001138 3300053121 Bacteria 24753
166 Ga0500618_001802 3300053125 Bacteria 9032
167 Ga0500568_0001419 3300053139 Bacteria 15537
168 Ga0500568_0011328 3300053139 Bacteria 4144
169 Ga0500616_0060066 3300053153 Bacteria 1972
170 Ga0500622_0000597 3300053156 Bacteria 32786
171 Ga0500627_0011593 3300053158 Bacteria 3265
172 Ga0500627_0017141 3300053158 Bacteria 2840
173 Ga0500633_0007538 3300053160 Bacteria 2747
174 Ga0500634_0035803 3300053161 Bacteria 2703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0008152 Ga0496117_0008152_7613_8584 301
2 3300048921 Ga0496118_0000777 Ga0496118_0000777_31194_32165 301
3 3300046616 Ga0495668_0002378 Ga0495668_0002378_9600_10565 302
4 3300009551 Ga0105238_10107015 Ga0105238_101070153 305
5 3300044735 Ga0466968_0000940 Ga0466968_0000940_5333_6256 306
6 3300025297 Ga0209758_1017166 Ga0209758_10171661 307
7 3300046453 Ga0495627_024528 Ga0495627_024528_629_1603 307
8 3300047472 Ga0495686_0000092 Ga0495686_0000092_123378_124349 307
9 3300048920 Ga0496117_0008409 Ga0496117_0008409_8490_9461 307
10 3300048921 Ga0496118_0001031 Ga0496118_0001031_12463_13434 307
11 3300048929 Ga0496126_0044885 Ga0496126_0044885_238_1209 307
12 3300053153 Ga0500616_0060066 Ga0500616_0060066_589_1515 307
13 3300025291 Ga0209675_1009984 Ga0209675_10099842 308
14 3300025292 Ga0209676_1024782 Ga0209676_10247822 308
15 3300025294 Ga0209025_1028437 Ga0209025_10284373 308
16 3300025298 Ga0209050_1006345 Ga0209050_10063455 308
17 3300048904 Ga0496101_0044927 Ga0496101_0044927_918_1892 308
18 3300048919 Ga0496116_0068248 Ga0496116_0068248_643_1617 308
19 3300048924 Ga0496121_0068963 Ga0496121_0068963_1007_1981 308
20 3300048925 Ga0496122_0055392 Ga0496122_0055392_1347_2321 308
21 3300048926 Ga0496123_0159764 Ga0496123_0159764_69_1043 308
22 3300048928 Ga0496125_0200662 Ga0496125_0200662_58_1032 308
23 iso_pu_bacteria 2511231027 2511390710 312
24 iso_pu_bacteria 2842871566 2842873589 312
25 iso_pu_bacteria 3007315729 3007319861 313
26 3300009011 Ga0105251_10000003 Ga0105251_10000003107 315
27 3300009093 Ga0105240_10043045 Ga0105240_100430454 315
28 3300025735 Ga0207713_1000009 Ga0207713_1000009182 315
29 iso_pu_bacteria 2721755763 2723879253 316
30 iso_pu_bacteria 2855730933 2855731849 316
31 iso_pu_bacteria 2855767633 2855768555 316
32 iso_pu_bacteria 8056120720 8056122575 316
33 3300013104 Ga0157370_10000070 Ga0157370_1000007094 317
34 iso_pu_bacteria 2582581298 2585225363 317
35 iso_pu_bacteria 2585427529 2585547919 317
36 iso_pu_bacteria 2593339239 2595450952 317
37 iso_pu_bacteria 2744054900 2746090093 317
38 iso_pu_bacteria 2744054901 2746095533 317
39 iso_pu_bacteria 2808606390 2809009230 317
40 iso_pu_bacteria 2808606391 2809015053 317
41 iso_pu_bacteria 2842805378 2842805814 317
42 iso_pu_bacteria 2858950400 2858954212 317
43 iso_pu_bacteria 2881412998 2881413259 317
44 iso_pu_bacteria 2884411467 2884413905 317
45 iso_pu_bacteria 2904463128 2904465263 317
46 iso_pu_bacteria 2919100787 2919106182 317
47 iso_pu_bacteria 2953994433 2953996556 317
48 iso_pu_bacteria 3005445848 3005448723 317
49 iso_pu_bacteria 8055878733 8055880624 317
50 3300046519 Ga0495632_0110637 Ga0495632_0110637_23_979 318
51 3300046694 Ga0495649_0000892 Ga0495649_0000892_16542_17498 318
52 3300053119 Ga0500595_006479 Ga0500595_006479_2899_3900 318
53 iso_pu_bacteria 2513237103 2513707890 318
54 iso_pu_bacteria 2517093000 2517096108 318
55 iso_pu_bacteria 2765235942 2766066144 318
56 iso_pu_bacteria 2842217011 2842218216 318
57 iso_pu_bacteria 2857516855 2857517151 318
58 iso_pu_bacteria 3007803356 3007805683 318
59 iso_pu_bacteria 639633055 639649441 318
60 3300021361 Ga0213872_10005452 Ga0213872_100054527 319
61 3300039447 Ga0436361_0420654 Ga0436361_0420654_3373_4338 319
62 3300049580 Ga0501046_0099000 Ga0501046_0099000_707_1675 319
63 iso_pu_bacteria 2738541277 2738721926 319
64 iso_pu_bacteria 2738541307 2738882092 319
65 iso_pu_bacteria 2738543019 2739282290 319
66 iso_pu_bacteria 3005409236 3005414294 319
67 3300003187 JGI25151J46595_10000584 JGI25151J46595_100005846 320
68 3300003775 Ga0055524_1026448 Ga0055524_10264481 320
69 3300003792 Ga0055540_1010710 Ga0055540_10107102 320
70 3300003856 Ga0058692_1030563 Ga0058692_10305631 320
71 3300004625 Ga0055543_1000060 Ga0055543_100006030 320
72 3300005262 Ga0065165_1000343 Ga0065165_100034329 320
73 3300005288 Ga0065714_10094935 Ga0065714_100949353 320
74 3300005347 Ga0070668_100169040 Ga0070668_1001690402 320
75 3300006186 Ga0075369_10015261 Ga0075369_100152613 320
76 3300009545 Ga0105237_10000389 Ga0105237_1000038938 320
77 3300013100 Ga0157373_10184560 Ga0157373_101845602 320
78 3300015261 Ga0182006_1050741 Ga0182006_10507411 320
79 3300025208 Ga0209436_100081 Ga0209436_10008119 320
80 3300025273 Ga0209673_1003145 Ga0209673_10031456 320
81 3300025284 Ga0209130_1000023 Ga0209130_100002328 320
82 3300025294 Ga0209025_1000018 Ga0209025_1000018135 320
83 3300025295 Ga0209564_1001566 Ga0209564_100156625 320
84 3300025297 Ga0209758_1023474 Ga0209758_10234742 320
85 3300025299 Ga0209256_1005201 Ga0209256_10052013 320
86 3300025302 Ga0207426_1000008 Ga0207426_100000843 320
87 3300025303 Ga0209051_1016607 Ga0209051_10166072 320
88 3300025914 Ga0207671_10000290 Ga0207671_1000029027 320
89 3300027312 Ga0209371_1004048 Ga0209371_10040484 320
90 3300030500 Ga0268256_1003598 Ga0268256_10035984 320
91 3300038443 Ga0395901_0596736 Ga0395901_0596736_24_998 320
92 3300041413 Ga0439465_0003400 Ga0439465_0003400_3669_4643 320
93 3300041413 Ga0439465_0015023 Ga0439465_0015023_277_1248 320
94 3300041491 Ga0451833_1327554 Ga0451833_1327554_417_1403 320
95 3300041492 Ga0451835_0185345 Ga0451835_0185345_283_1269 320
96 3300041498 Ga0451841_0423896 Ga0451841_0423896_650_1636 320
97 3300041511 Ga0451855_1022649 Ga0451855_1022649_543_1529 320
98 3300046460 Ga0495638_0000790 Ga0495638_0000790_27569_28540 320
99 3300046463 Ga0495653_0000277 Ga0495653_0000277_9444_10409 320
100 3300046492 Ga0495585_0001577 Ga0495585_0001577_8699_9676 320
101 3300046507 Ga0495606_0004255 Ga0495606_0004255_9434_10399 320
102 3300046512 Ga0495610_0019162 Ga0495610_0019162_1677_2648 320
103 3300046522 Ga0495643_0020373 Ga0495643_0020373_1296_2267 320
104 3300046522 Ga0495643_0169160 Ga0495643_0169160_50_1021 320
105 3300046665 Ga0495661_0000055 Ga0495661_0000055_44630_45607 320
106 3300047318 Ga0495636_0016926 Ga0495636_0016926_167_1138 320
107 3300047320 Ga0495672_0034814 Ga0495672_0034814_2027_2998 320
108 3300047443 Ga0495687_000005 Ga0495687_000005_74150_75112 320
109 3300047472 Ga0495686_0106542 Ga0495686_0106542_330_1403 320
110 3300048909 Ga0496106_0002317 Ga0496106_0002317_2983_3954 320
111 3300048924 Ga0496121_0018289 Ga0496121_0018289_5069_6040 320
112 3300048924 Ga0496121_0171660 Ga0496121_0171660_392_1363 320
113 3300048925 Ga0496122_0076390 Ga0496122_0076390_1242_2213 320
114 3300048926 Ga0496123_0052191 Ga0496123_0052191_1125_2096 320
115 3300048928 Ga0496125_0030810 Ga0496125_0030810_386_1357 320
116 3300049569 Ga0501032_0078338 Ga0501032_0078338_279_1250 320
117 3300049573 Ga0501037_0119106 Ga0501037_0119106_189_1160 320
118 3300049574 Ga0501038_0027024 Ga0501038_0027024_2655_3626 320
119 3300049579 Ga0501043_0153511 Ga0501043_0153511_583_1554 320
120 3300049581 Ga0501047_0061512 Ga0501047_0061512_1227_2198 320
121 3300049581 Ga0501047_0126224 Ga0501047_0126224_1297_2268 320
122 3300049584 Ga0501068_0125020 Ga0501068_0125020_230_1201 320
123 3300049589 Ga0501073_0090611 Ga0501073_0090611_244_1215 320
124 3300049822 Ga0501035_0157359 Ga0501035_0157359_395_1366 320
125 3300050516 nmdc:mga0sz30_70177_c1 nmdc:mga0sz30_70177_c1_76_1047 320
126 3300053139 Ga0500568_0001419 Ga0500568_0001419_12313_13284 320
127 3300053139 Ga0500568_0011328 Ga0500568_0011328_1149_2120 320
128 3300053156 Ga0500622_0000597 Ga0500622_0000597_21797_22768 320
129 3300053158 Ga0500627_0011593 Ga0500627_0011593_2226_3197 320
130 3300053160 Ga0500633_0007538 Ga0500633_0007538_669_1640 320
131 3300002737 JGI25162J39368_1000028 JGI25162J39368_1000028186 321
132 3300002741 JGI25157J39369_1000126 JGI25157J39369_10001268 321
133 3300002771 JGI25163J39215_1000096 JGI25163J39215_100009622 321
134 3300002772 JGI25164J39214_1000012 JGI25164J39214_1000012202 321
135 3300003214 JGI25165J46597_1000048 JGI25165J46597_100004848 321
136 3300003751 Ga0055538_1000568 Ga0055538_10005684 321
137 3300003761 Ga0055535_1000027 Ga0055535_100002736 321
138 3300003761 Ga0055535_1000151 Ga0055535_100015148 321
139 3300003762 Ga0055542_1000034 Ga0055542_1000034185 321
140 3300003763 Ga0055529_1000056 Ga0055529_1000056150 321
141 3300005335 Ga0070666_10000034 Ga0070666_1000003436 321
142 3300005344 Ga0070661_100053704 Ga0070661_1000537043 321
143 3300005548 Ga0070665_100007188 Ga0070665_1000071886 321
144 3300005578 Ga0068854_100044292 Ga0068854_1000442922 321
145 3300007265 Ga0099794_10060857 Ga0099794_100608571 321
146 3300009092 Ga0105250_10000758 Ga0105250_100007588 321
147 3300013105 Ga0157369_10073683 Ga0157369_100736831 321
148 3300013306 Ga0163162_10000106 Ga0163162_1000010614 321
149 3300014497 Ga0182008_10000580 Ga0182008_100005805 321
150 3300025207 Ga0209760_100786 Ga0209760_1007863 321
151 3300025224 Ga0209784_100016 Ga0209784_10001649 321
152 3300025228 Ga0209672_104817 Ga0209672_1048172 321
153 3300025231 Ga0207427_100019 Ga0207427_100019364 321
154 3300025233 Ga0209437_100054 Ga0209437_100054147 321
155 3300025242 Ga0209258_100039 Ga0209258_10003949 321
156 3300025246 Ga0209646_1000269 Ga0209646_100026916 321
157 3300025250 Ga0209026_1000012 Ga0209026_1000012436 321
158 3300025254 Ga0209148_1000001 Ga0209148_10000011319 321
159 3300025261 Ga0209233_1000002 Ga0209233_1000002911 321
160 3300025272 Ga0209455_1000039 Ga0209455_100003949 321
161 3300025711 Ga0207696_1000155 Ga0207696_100015511 321
162 3300025728 Ga0207655_1000051 Ga0207655_1000051212 321
163 3300025735 Ga0207713_1002599 Ga0207713_10025997 321
164 3300025903 Ga0207680_10000005 Ga0207680_10000005322 321
165 3300025981 Ga0207640_10022338 Ga0207640_100223384 321
166 3300027671 Ga0209588_1041493 Ga0209588_10414931 321
167 3300028379 Ga0268266_10000004 Ga0268266_100000041204 321
168 3300039447 Ga0436361_0898454 Ga0436361_0898454_2164_3144 321
169 3300044683 Ga0466965_0004159 Ga0466965_0004159_3541_4506 321
170 3300044693 Ga0466961_0013360 Ga0466961_0013360_1409_2374 321
171 3300044719 Ga0466971_0018334 Ga0466971_0018334_1209_2174 321
172 3300044765 Ga0466970_0061999 Ga0466970_0061999_82_1101 321
173 3300044842 Ga0466957_0004540 Ga0466957_0004540_4849_5814 321
174 3300045836 Ga0466958_0180868 Ga0466958_0180868_283_1248 321
175 3300046453 Ga0495627_015160 Ga0495627_015160_955_1929 321
176 3300046458 Ga0495591_022235 Ga0495591_022235_570_1559 321
177 3300046501 Ga0495607_0001115 Ga0495607_0001115_17212_18201 321
178 3300046512 Ga0495610_0069487 Ga0495610_0069487_285_1259 321
179 3300046513 Ga0495616_0042148 Ga0495616_0042148_29_1018 321
180 3300046520 Ga0495637_0001023 Ga0495637_0001023_806_1780 321
181 3300046520 Ga0495637_0010268 Ga0495637_0010268_3062_4051 321
182 3300046660 Ga0495625_0141135 Ga0495625_0141135_324_1298 321
183 3300046664 Ga0495659_0037216 Ga0495659_0037216_590_1564 321
184 3300046694 Ga0495649_0000615 Ga0495649_0000615_9654_10643 321
185 3300046810 Ga0495660_0054567 Ga0495660_0054567_931_1905 321
186 3300047323 Ga0495683_0000014 Ga0495683_0000014_141477_142466 321
187 3300048920 Ga0496117_0013720 Ga0496117_0013720_1728_2708 321
188 3300048921 Ga0496118_0002915 Ga0496118_0002915_2806_3786 321
189 3300048924 Ga0496121_0011893 Ga0496121_0011893_6883_7851 321
190 3300048926 Ga0496123_0001551 Ga0496123_0001551_9414_10394 321
191 3300048927 Ga0496124_0004767 Ga0496124_0004767_5199_6179 321
192 3300048927 Ga0496124_0055667 Ga0496124_0055667_86_1051 321
193 3300048928 Ga0496125_0005279 Ga0496125_0005279_1145_2113 321
194 3300048928 Ga0496125_0066153 Ga0496125_0066153_1077_2057 321
195 3300048929 Ga0496126_0018660 Ga0496126_0018660_702_1670 321
196 3300049570 Ga0501033_0030338 Ga0501033_0030338_2956_3924 321
197 3300049574 Ga0501038_0151822 Ga0501038_0151822_516_1484 321
198 3300049581 Ga0501047_0004578 Ga0501047_0004578_7498_8466 321
199 3300049581 Ga0501047_0397924 Ga0501047_0397924_112_1086 321
200 3300049822 Ga0501035_0002736 Ga0501035_0002736_15372_16340 321
201 3300049823 Ga0501044_0001803 Ga0501044_0001803_15589_16557 321
202 3300053079 Ga0500610_0003278 Ga0500610_0003278_692_1666 321
203 3300053079 Ga0500610_0003281 Ga0500610_0003281_692_1666 321
204 3300053117 Ga0500593_000205 Ga0500593_000205_8609_9583 321
205 3300053121 Ga0500607_001138 Ga0500607_001138_20829_21803 321
206 3300053125 Ga0500618_001802 Ga0500618_001802_766_1755 321
207 3300053158 Ga0500627_0017141 Ga0500627_0017141_932_1906 321
208 3300053161 Ga0500634_0035803 Ga0500634_0035803_739_1713 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

239

317

0.98

PF01965

DJ-1_PfpI

DJ-1/PfpI family

3

178

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9282 215 315
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9204 216 313
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9182 216 320
3mgk-assembly1.cif.gz_A crystal structure of probable protease/amidase from clostridium acetobutylicum atcc 824 0.9072 2 189
3oou-assembly1.cif.gz_A the structure of a protein with unkown function from listeria innocua 0.9042 216 317
ID Description Score Start End Superfamily
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9616 264 317 1.10.10.60
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9614 216 318 1.10.10.60
af_P31449_179_288_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.947 213 316 1.10.10.60
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.935 216 318 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9271 265 319 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7V6PWS0-F1-model_v4 AraC family transcriptional regulator 0.9541 213 316 GO:0003700
GO:0043565
AF-A0A7X7QVZ1-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9411 227 311 GO:0003700
GO:0043565
AF-A0A4R5YYA1-F1-model_v4 deleted 0.941 220 315
AF-A0A644U0M6-F1-model_v4 DNA gyrase inhibitor 0.9397 215 314 GO:0003700
GO:0043565
AF-A0A5Q2TN56-F1-model_v4 Helix-turn-helix domain-containing protein 0.939 215 313 GO:0003700
GO:0043565

Feature Viewer

pLDDT pTM Quality
87.82 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map