F318033

General Info

Members Datasets Scaffolds Average Seq Length
208 128 416 120

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100106550|Ga0307409_1001065503
Length 129
Sequence VSSGEHETEEHPMTDVQNIDSPHERREFKAHGHMDVVTFGDFTMGRGIFEPGWRWSEDVKPIAGTDSCQVHHTGFCLSGQMTIRSDAGDEVTVRAGDVVDLDPGHDAWTVGDEPCVILDTGVAAYAKPQ

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
20 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
21 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
47 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
53 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
54 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
59 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
60 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
61 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
62 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
63 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
64 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
65 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
66 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
67 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
68 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
69 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
70 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
71 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
72 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
73 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
74 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
75 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
76 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
77 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
78 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
79 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
80 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
81 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
82 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
83 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
84 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
85 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
86 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
99 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
106 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
112 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
113 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
120 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
121 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
122 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
123 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
127 2643221561 Nocardioides sp. Root151 Isolate Unclassified
128 2643221696 Nocardioides sp. Root140 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.67
Metatranscriptomes 3.37
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.92
Nodule 0
Rhizoplane 14.9
Rhizosphere 81.73
Stem 0
Stem Tuber 0
Unclassified 16.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100106550 3300031995 Bacteria 2340
2 LJQas_1002708 3300000549 Bacteria 2439
3 Ga0070690_101683692 3300005330 Bacteria 515
4 Ga0070689_100638339 3300005340 Bacteria 925
5 Ga0070674_101152343 3300005356 Unclassified 686
6 Ga0070710_10000019 3300005437 Bacteria 88049
7 Ga0070708_101318597 3300005445 Unclassified 674
8 Ga0070698_100030697 3300005471 Bacteria 5571
9 Ga0070679_100180488 3300005530 Bacteria 2083
10 Ga0070704_100859406 3300005549 Unclassified 814
11 Ga0081539_10001681 3300005985 Bacteria 35743
12 Ga0081539_10004201 3300005985 Bacteria 16259
13 Ga0081539_10019258 3300005985 Bacteria 4682
14 Ga0081539_10097539 3300005985 Bacteria 1505
15 Ga0075365_10047669 3300006038 Bacteria 2817
16 Ga0070716_101215036 3300006173 Bacteria 606
17 Ga0070712_100000172 3300006175 Bacteria 35623
18 Ga0070712_100613629 3300006175 Bacteria 922
19 Ga0075367_10355561 3300006178 Unclassified 925
20 Ga0075431_100104111 3300006847 Bacteria 2929
21 Ga0075433_10811193 3300006852 Bacteria 817
22 Ga0075434_100119322 3300006871 Bacteria 2651
23 Ga0068865_101359844 3300006881 Unclassified 633
24 Ga0075435_100072629 3300007076 Bacteria 2811
25 Ga0075435_100820900 3300007076 Unclassified 810
26 Ga0105250_10571773 3300009092 Unclassified 521
27 Ga0105240_11198482 3300009093 Bacteria 804
28 Ga0111539_10433223 3300009094 Bacteria 1531
29 Ga0111539_13545174 3300009094 Bacteria 500
30 Ga0105245_10145469 3300009098 Unclassified 2236
31 Ga0105245_10784748 3300009098 Bacteria 990
32 Ga0105247_10588758 3300009101 Unclassified 823
33 Ga0114129_10273911 3300009147 Bacteria 2257
34 Ga0105242_10209947 3300009176 Bacteria 1735
35 Ga0105248_12410600 3300009177 Unclassified 599
36 Ga0105249_11486181 3300009553 Bacteria 750
37 Ga0154012_120457 3300013059 Bacteria 598
38 Ga0163162_11603726 3300013306 Unclassified 742
39 Ga0157376_10017946 3300014969 Bacteria 5412
40 Ga0206356_10573306 3300020070 Bacteria 840
41 Ga0206356_11272343 3300020070 Bacteria 612
42 Ga0206350_11488778 3300020080 Bacteria 978
43 Ga0206353_10521528 3300020082 Bacteria 1089
44 Ga0154015_1355769 3300020610 Bacteria 1026
45 Ga0224712_10680165 3300022467 Unclassified 505
46 Ga0207653_10395276 3300025885 Unclassified 542
47 Ga0207692_10000004 3300025898 Bacteria 413600
48 Ga0207693_10000185 3300025915 Bacteria 56784
49 Ga0207693_10578221 3300025915 Unclassified 875
50 Ga0207687_10365104 3300025927 Bacteria 1179
51 Ga0207687_10625117 3300025927 Bacteria 909
52 Ga0207669_10990188 3300025937 Unclassified 706
53 Ga0207665_10237802 3300025939 Bacteria 1341
54 Ga0207661_10000348 3300025944 Bacteria 29705
55 Ga0207661_10001988 3300025944 Bacteria 14066
56 Ga0207683_10212738 3300026121 Bacteria 1760
57 Ga0207683_10456225 3300026121 Bacteria 1179
58 Ga0265326_10029551 3300028558 Bacteria 1561
59 Ga0265319_1000563 3300028563 Bacteria 25147
60 Ga0265338_10168271 3300028800 Bacteria 1684
61 Ga0265327_10095867 3300031251 Bacteria 1439
62 Ga0307410_10157339 3300031852 Bacteria 1699
63 Ga0307409_101427584 3300031995 Bacteria 719
64 Ga0307416_103681367 3300032002 Bacteria 513
65 Ga0307414_11269909 3300032004 Bacteria 683
66 Ga0307411_10782601 3300032005 Bacteria 839
67 Ga0307411_11263235 3300032005 Bacteria 671
68 Ga0373935_0282389 3300035692 Bacteria 1169
69 Ga0395900_0122457 3300037418 Bacteria 2668
70 Ga0395905_0034937 3300037471 Bacteria 4719
71 Ga0395901_0100209 3300038443 Bacteria 3038
72 Ga0451795_0864526 3300041456 Bacteria 578
73 Ga0451839_0963164 3300041496 Bacteria 526
74 Ga0439435_0218287 3300042436 Bacteria 634
75 Ga0439440_0278683 3300042993 Bacteria 516
76 Ga0495653_0032900 3300046463 Bacteria 4113
77 Ga0495594_0000045 3300046499 Bacteria 54326
78 Ga0495596_0147657 3300046500 Bacteria 913
79 Ga0495596_0202471 3300046500 Bacteria 771
80 Ga0495608_0000906 3300046511 Bacteria 20783
81 Ga0495645_0638952 3300046543 Bacteria 651
82 Ga0495622_0000164 3300046557 Bacteria 55253
83 Ga0495634_0005330 3300046642 Bacteria 9911
84 Ga0495589_0276807 3300046794 Bacteria 781
85 Ga0495684_0380785 3300047471 Bacteria 995
86 Ga0496100_0141683 3300048903 Bacteria 1705
87 Ga0496100_1232288 3300048903 Unclassified 590
88 Ga0496101_0158696 3300048904 Bacteria 1734
89 Ga0496102_0060282 3300048905 Plasmid 3471
90 Ga0496102_0603838 3300048905 Unclassified 1020
91 Ga0496102_0915692 3300048905 Bacteria 798
92 Ga0496103_0189788 3300048906 Bacteria 1321
93 Ga0496104_0297435 3300048907 Bacteria 1526
94 Ga0496105_0175759 3300048908 Bacteria 1754
95 Ga0496106_0311577 3300048909 Bacteria 1263
96 Ga0496107_0475879 3300048910 Bacteria 927
97 Ga0496107_0638789 3300048910 Unclassified 785
98 Ga0496108_0021504 3300048911 Bacteria 5302
99 Ga0496108_0179072 3300048911 Archaea 1835
100 Ga0496109_0000011 3300048912 Bacteria 234908
101 Ga0496109_0132825 3300048912 Unclassified 2324
102 Ga0496110_0109749 3300048913 Unclassified 2478
103 Ga0496110_0132345 3300048913 Bacteria 2253
104 Ga0496110_0241581 3300048913 Bacteria 1643
105 Ga0496111_0289929 3300048914 Bacteria 1214
106 Ga0496112_0001124 3300048915 Bacteria 19896
107 Ga0496112_0035076 3300048915 Bacteria 4883
108 Ga0496112_0069937 3300048915 Unclassified 3468
109 Ga0496112_0192741 3300048915 Archaea 1999
110 Ga0496112_0375463 3300048915 Bacteria 1363
111 Ga0496113_0000204 3300048916 Bacteria 27481
112 Ga0496113_0380470 3300048916 Bacteria 1133
113 Ga0496113_0405950 3300048916 Bacteria 1094
114 Ga0496114_0378901 3300048917 Bacteria 1252
115 Ga0496115_0257857 3300048918 Bacteria 1434
116 Ga0501031_0182240 3300049568 Bacteria 1372
117 Ga0501033_0398622 3300049570 Bacteria 960
118 Ga0501036_0137780 3300049572 Bacteria 2059
119 Ga0501036_0167780 3300049572 Bacteria 1850
120 Ga0501037_0513440 3300049573 Bacteria 812
121 Ga0501038_1010132 3300049574 Unclassified 610
122 Ga0501039_0113497 3300049575 Bacteria 2119
123 Ga0501039_0325776 3300049575 Bacteria 1207
124 Ga0501039_0355919 3300049575 Unclassified 1150
125 Ga0501039_0718765 3300049575 Bacteria 781
126 Ga0501040_0004630 3300049576 Bacteria 8924
127 Ga0501040_0272157 3300049576 Bacteria 1209
128 Ga0501040_0525595 3300049576 Bacteria 853
129 Ga0501041_0140607 3300049577 Bacteria 1505
130 Ga0501041_0597552 3300049577 Bacteria 704
131 Ga0501041_0649801 3300049577 Unclassified 674
132 Ga0501042_0060919 3300049578 Bacteria 2696
133 Ga0501042_0127599 3300049578 Bacteria 1832
134 Ga0501042_0419911 3300049578 Bacteria 969
135 Ga0501042_0586079 3300049578 Unclassified 811
136 Ga0501046_0023305 3300049580 Bacteria 5094
137 Ga0501048_0178795 3300049582 Bacteria 1504
138 Ga0501048_0282058 3300049582 Bacteria 1181
139 Ga0501048_0748480 3300049582 Bacteria 702
140 Ga0501048_1152712 3300049582 Unclassified 558
141 Ga0501068_0813060 3300049584 Unclassified 613
142 Ga0501069_0930700 3300049585 Unclassified 529
143 Ga0501071_0013714 3300049587 Bacteria 5528
144 Ga0501071_0096787 3300049587 Bacteria 2173
145 Ga0501071_0346673 3300049587 Bacteria 1130
146 Ga0501072_0014903 3300049588 Bacteria 5959
147 Ga0501072_0154873 3300049588 Bacteria 1827
148 Ga0501072_0184326 3300049588 Unclassified 1665
149 Ga0501072_0285857 3300049588 Bacteria 1311
150 Ga0501072_0929128 3300049588 Bacteria 679
151 Ga0501074_0044027 3300049590 Bacteria 3232
152 Ga0501074_0096006 3300049590 Bacteria 2123
153 Ga0501075_0015116 3300049591 Bacteria 5537
154 Ga0501075_0127733 3300049591 Bacteria 1936
155 Ga0501075_1097141 3300049591 Bacteria 604
156 Ga0501076_0015263 3300049592 Bacteria 5803
157 Ga0501076_0424761 3300049592 Bacteria 1094
158 Ga0501077_0005255 3300049593 Bacteria 7867
159 Ga0501077_0309410 3300049593 Bacteria 1007
160 Ga0501077_1083876 3300049593 Bacteria 515
161 Ga0501079_0021783 3300049741 Bacteria 4906
162 Ga0501079_0349852 3300049741 Bacteria 1158
163 Ga0501080_0588051 3300049742 Bacteria 989
164 Ga0501080_0642688 3300049742 Bacteria 939
165 Ga0501080_0664759 3300049742 Bacteria 921
166 Ga0501081_0103492 3300049743 Bacteria 2015
167 Ga0501081_0366432 3300049743 Bacteria 1063
168 Ga0501081_0422902 3300049743 Bacteria 988
169 Ga0501081_0653677 3300049743 Bacteria 788
170 Ga0501081_1475407 3300049743 Unclassified 516
171 Ga0501083_0596124 3300049744 Bacteria 719
172 Ga0501035_0152853 3300049822 Bacteria 2002
173 Ga0501045_0010771 3300049824 Bacteria 6408
174 Ga0501045_0055334 3300049824 Bacteria 2901
175 Ga0501045_0151219 3300049824 Bacteria 1727
176 Ga0501045_0712663 3300049824 Bacteria 740
177 Ga0501045_0802408 3300049824 Unclassified 693
178 nmdc:mga0yw44_394541_c1 3300050492 Bacteria 935
179 nmdc:mga06z11_943573_c1 3300050494 Unclassified 526
180 nmdc:mga05p37_196552_c2 3300050507 Bacteria 1640
181 nmdc:mga06r32_69855_c1 3300050510 Bacteria 3395
182 nmdc:mga08y16_2182537_c1 3300050511 Bacteria 500
183 nmdc:mga0n895_141768_c1 3300050512 Bacteria 2432
184 nmdc:mga0rr50_357348_c1 3300050513 Bacteria 1229
185 nmdc:mga0rr50_646949_c1 3300050513 Bacteria 902
186 nmdc:mga08x19_246832_c1 3300050514 Bacteria 1232
187 nmdc:mga0a205_436800_c1 3300050515 Bacteria 1170
188 Ga0495655_0000171 3300053083 Bacteria 12258
189 Ga0495655_0010950 3300053083 Bacteria 1807
190 Ga0495595_0000213 3300053084 Bacteria 23371
191 Ga0495619_0341291 3300053085 Bacteria 1036
192 Ga0501084_0027811 3300054114 Bacteria 4726
193 Ga0501084_0150322 3300054114 Bacteria 1963
194 Ga0501084_0697154 3300054114 Unclassified 856
195 Ga0501084_0746935 3300054114 Bacteria 824
196 Ga0501082_0028676 3300060353 Bacteria 4795
197 Ga0501082_0547784 3300060353 Bacteria 1012
198 Ga0501082_0854281 3300060353 Unclassified 796
199 Ga0501082_1151661 3300060353 Unclassified 678
200 Ga0530510_0018530 3300061734 Bacteria 4935
201 Ga0530510_0027091 3300061734 Bacteria 4105
202 Ga0530510_0059732 3300061734 Bacteria 2758
203 Ga0530510_0257585 3300061734 Bacteria 1301
204 Ga0530510_0338235 3300061734 Bacteria 1130
205 Ga0530510_0745426 3300061734 Bacteria 747
206 Ga0530510_1171837 3300061734 Bacteria 589
207 2643826393 2643221561 Bacteria 4984412
208 2644532722 2643221696 Bacteria 5431823
209 Ga0307409_100106550
210 LJQas_1002708
211 Ga0070690_101683692
212 Ga0070689_100638339
213 Ga0070674_101152343
214 Ga0070710_10000019
215 Ga0070708_101318597
216 Ga0070698_100030697
217 Ga0070679_100180488
218 Ga0070704_100859406
219 Ga0081539_10001681
220 Ga0081539_10004201
221 Ga0081539_10019258
222 Ga0081539_10097539
223 Ga0075365_10047669
224 Ga0070716_101215036
225 Ga0070712_100000172
226 Ga0070712_100613629
227 Ga0075367_10355561
228 Ga0075431_100104111
229 Ga0075433_10811193
230 Ga0075434_100119322
231 Ga0068865_101359844
232 Ga0075435_100072629
233 Ga0075435_100820900
234 Ga0105250_10571773
235 Ga0105240_11198482
236 Ga0111539_10433223
237 Ga0111539_13545174
238 Ga0105245_10145469
239 Ga0105245_10784748
240 Ga0105247_10588758
241 Ga0114129_10273911
242 Ga0105242_10209947
243 Ga0105248_12410600
244 Ga0105249_11486181
245 Ga0154012_120457
246 Ga0163162_11603726
247 Ga0157376_10017946
248 Ga0206356_10573306
249 Ga0206356_11272343
250 Ga0206350_11488778
251 Ga0206353_10521528
252 Ga0154015_1355769
253 Ga0224712_10680165
254 Ga0207653_10395276
255 Ga0207692_10000004
256 Ga0207693_10000185
257 Ga0207693_10578221
258 Ga0207687_10365104
259 Ga0207687_10625117
260 Ga0207669_10990188
261 Ga0207665_10237802
262 Ga0207661_10000348
263 Ga0207661_10001988
264 Ga0207683_10212738
265 Ga0207683_10456225
266 Ga0265326_10029551
267 Ga0265319_1000563
268 Ga0265338_10168271
269 Ga0265327_10095867
270 Ga0307410_10157339
271 Ga0307409_101427584
272 Ga0307416_103681367
273 Ga0307414_11269909
274 Ga0307411_10782601
275 Ga0307411_11263235
276 Ga0373935_0282389
277 Ga0395900_0122457
278 Ga0395905_0034937
279 Ga0395901_0100209
280 Ga0451795_0864526
281 Ga0451839_0963164
282 Ga0439435_0218287
283 Ga0439440_0278683
284 Ga0495653_0032900
285 Ga0495594_0000045
286 Ga0495596_0147657
287 Ga0495596_0202471
288 Ga0495608_0000906
289 Ga0495645_0638952
290 Ga0495622_0000164
291 Ga0495634_0005330
292 Ga0495589_0276807
293 Ga0495684_0380785
294 Ga0496100_0141683
295 Ga0496100_1232288
296 Ga0496101_0158696
297 Ga0496102_0060282
298 Ga0496102_0603838
299 Ga0496102_0915692
300 Ga0496103_0189788
301 Ga0496104_0297435
302 Ga0496105_0175759
303 Ga0496106_0311577
304 Ga0496107_0475879
305 Ga0496107_0638789
306 Ga0496108_0021504
307 Ga0496108_0179072
308 Ga0496109_0000011
309 Ga0496109_0132825
310 Ga0496110_0109749
311 Ga0496110_0132345
312 Ga0496110_0241581
313 Ga0496111_0289929
314 Ga0496112_0001124
315 Ga0496112_0035076
316 Ga0496112_0069937
317 Ga0496112_0192741
318 Ga0496112_0375463
319 Ga0496113_0000204
320 Ga0496113_0380470
321 Ga0496113_0405950
322 Ga0496114_0378901
323 Ga0496115_0257857
324 Ga0501031_0182240
325 Ga0501033_0398622
326 Ga0501036_0137780
327 Ga0501036_0167780
328 Ga0501037_0513440
329 Ga0501038_1010132
330 Ga0501039_0113497
331 Ga0501039_0325776
332 Ga0501039_0355919
333 Ga0501039_0718765
334 Ga0501040_0004630
335 Ga0501040_0272157
336 Ga0501040_0525595
337 Ga0501041_0140607
338 Ga0501041_0597552
339 Ga0501041_0649801
340 Ga0501042_0060919
341 Ga0501042_0127599
342 Ga0501042_0419911
343 Ga0501042_0586079
344 Ga0501046_0023305
345 Ga0501048_0178795
346 Ga0501048_0282058
347 Ga0501048_0748480
348 Ga0501048_1152712
349 Ga0501068_0813060
350 Ga0501069_0930700
351 Ga0501071_0013714
352 Ga0501071_0096787
353 Ga0501071_0346673
354 Ga0501072_0014903
355 Ga0501072_0154873
356 Ga0501072_0184326
357 Ga0501072_0285857
358 Ga0501072_0929128
359 Ga0501074_0044027
360 Ga0501074_0096006
361 Ga0501075_0015116
362 Ga0501075_0127733
363 Ga0501075_1097141
364 Ga0501076_0015263
365 Ga0501076_0424761
366 Ga0501077_0005255
367 Ga0501077_0309410
368 Ga0501077_1083876
369 Ga0501079_0021783
370 Ga0501079_0349852
371 Ga0501080_0588051
372 Ga0501080_0642688
373 Ga0501080_0664759
374 Ga0501081_0103492
375 Ga0501081_0366432
376 Ga0501081_0422902
377 Ga0501081_0653677
378 Ga0501081_1475407
379 Ga0501083_0596124
380 Ga0501035_0152853
381 Ga0501045_0010771
382 Ga0501045_0055334
383 Ga0501045_0151219
384 Ga0501045_0712663
385 Ga0501045_0802408
386 nmdc:mga0yw44_394541_c1
387 nmdc:mga06z11_943573_c1
388 nmdc:mga05p37_196552_c2
389 nmdc:mga06r32_69855_c1
390 nmdc:mga08y16_2182537_c1
391 nmdc:mga0n895_141768_c1
392 nmdc:mga0rr50_357348_c1
393 nmdc:mga0rr50_646949_c1
394 nmdc:mga08x19_246832_c1
395 nmdc:mga0a205_436800_c1
396 Ga0495655_0000171
397 Ga0495655_0010950
398 Ga0495595_0000213
399 Ga0495619_0341291
400 Ga0501084_0027811
401 Ga0501084_0150322
402 Ga0501084_0697154
403 Ga0501084_0746935
404 Ga0501082_0028676
405 Ga0501082_0547784
406 Ga0501082_0854281
407 Ga0501082_1151661
408 Ga0530510_0018530
409 Ga0530510_0027091
410 Ga0530510_0059732
411 Ga0530510_0257585
412 Ga0530510_0338235
413 Ga0530510_0745426
414 Ga0530510_1171837
415 2643826393
416 2644532722

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zua-assembly2.cif.gz_B-2 crystal structure of the exsa regulatory domain 0.7857 34 111
5zbe-assembly1.cif.gz_A crystal structure of aere from microcystis aeruginosa 0.7854 14 109
1o5u-assembly2.cif.gz_B crystal structure of a duf861 family protein (tm1112) from thermotoga maritima at 1.83 a resolution 0.7602 36 109
3lwc-assembly1.cif.gz_A-2 crystal structure of structural genomics, unknown function (yp_766765.1) from rhizobium leguminosarum bv. viciae 3841 at 1.40 a resolution 0.7579 20 111
6xcv-assembly1.cif.gz_B crystal structure of apo sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.7532 34 111
ID Description Score Start End Superfamily
af_F1QLW3_37_119_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8331 60 109 2.60.120.10
5zbfA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7868 14 109 2.60.120.10
af_P0C037_1_93_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7718 14 110 2.60.120.10
2i45I00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7655 24 108 2.60.120.10
4e2gD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7652 3 109 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A6V8KDT5-F1-model_v4 Cupin 0.9967 1 120
AF-A0A535M4F5-F1-model_v4 Cupin 0.9959 43 110
AF-A0A538KR37-F1-model_v4 Cupin domain-containing protein 0.9916 1 120
AF-A0A4S4ATR5-F1-model_v4 Cupin 0.9915 3 120
AF-A0A538JSV8-F1-model_v4 Cupin domain-containing protein 0.9914 1 120

Map