F318028

General Info

Members Datasets Scaffolds Average Seq Length
208 157 208 149

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10813905|Ga0307413_108139052
Length 150
Sequence MSWREQLLDTPEQIDALLAATRRVAVLGIKTEAQADQPAFYVPRYLADAGLEVVPVPVYYPEVTQILGKPVYRALADVPAPPIDLVDVFRRPQDLPPHLDDILAAKPRAVWLQSGIRNDAFAERLVGAGIAVVQDRCLMVEHRRFARRNG

Samples

Sample ID Description Type Environment
1 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
105 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
112 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
119 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
120 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
153 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 0
Rhizosphere 92.79
Stem 0
Stem Tuber 0
Unclassified 5.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26143J51219_1005007 3300003502 Bacteria 649
2 Ga0070658_10255486 3300005327 Bacteria 1487
3 Ga0070683_100000057 3300005329 Bacteria 82440
4 Ga0070683_100123242 3300005329 Bacteria 2449
5 Ga0070690_100898040 3300005330 Bacteria 693
6 Ga0070690_100899302 3300005330 Bacteria 692
7 Ga0070670_100000150 3300005331 Bacteria 64102
8 Ga0070670_100131801 3300005331 Bacteria 2159
9 Ga0070677_10092816 3300005333 Unclassified 1316
10 Ga0068869_100002670 3300005334 Bacteria 10777
11 Ga0070680_100838940 3300005336 Unclassified 792
12 Ga0070682_100000006 3300005337 Bacteria 369078
13 Ga0068868_100000028 3300005338 Bacteria 78800
14 Ga0068868_100000562 3300005338 Bacteria 24927
15 Ga0070691_10021435 3300005341 Bacteria 2990
16 Ga0070691_10171414 3300005341 Bacteria 1125
17 Ga0070675_100000060 3300005354 Bacteria 66785
18 Ga0070674_100623038 3300005356 Bacteria 914
19 Ga0070673_100056075 3300005364 Bacteria 3107
20 Ga0070709_10483542 3300005434 Bacteria 938
21 Ga0070708_100140173 3300005445 Bacteria 2242
22 Ga0070681_10583414 3300005458 Bacteria 1032
23 Ga0070706_100337707 3300005467 Bacteria 1405
24 Ga0070707_100009076 3300005468 Bacteria 9219
25 Ga0070698_100794540 3300005471 Bacteria 890
26 Ga0070699_100917831 3300005518 Unclassified 802
27 Ga0070679_100511228 3300005530 Bacteria 1145
28 Ga0070684_100000552 3300005535 Bacteria 25687
29 Ga0070684_100113909 3300005535 Bacteria 2427
30 Ga0068853_100323853 3300005539 Bacteria 1429
31 Ga0068853_100686706 3300005539 Bacteria 976
32 Ga0070672_100000848 3300005543 Bacteria 18308
33 Ga0070672_100056475 3300005543 Bacteria 3079
34 Ga0070686_100190721 3300005544 Bacteria 1463
35 Ga0070686_101525409 3300005544 Bacteria 564
36 Ga0070695_100004878 3300005545 Bacteria 7900
37 Ga0070696_100706797 3300005546 Bacteria 822
38 Ga0070693_100188197 3300005547 Bacteria 1333
39 Ga0070693_100968286 3300005547 Bacteria 642
40 Ga0068854_100124195 3300005578 Bacteria 1964
41 Ga0070702_100009828 3300005615 Bacteria 4695
42 Ga0070702_100037119 3300005615 Bacteria 2705
43 Ga0070702_101091492 3300005615 Unclassified 637
44 Ga0068864_100000054 3300005618 Bacteria 129210
45 Ga0068851_10036694 3300005834 Bacteria 2455
46 Ga0068863_101877281 3300005841 Bacteria 609
47 Ga0068858_100000523 3300005842 Bacteria 40323
48 Ga0070717_11372135 3300006028 Bacteria 642
49 Ga0070712_100720269 3300006175 Bacteria 852
50 Ga0075433_10828114 3300006852 Bacteria 808
51 Ga0075429_100207915 3300006880 Bacteria 1715
52 Ga0068865_100085460 3300006881 Unclassified 2276
53 Ga0075436_100598574 3300006914 Archaea 812
54 Ga0105244_10170260 3300009036 Bacteria 1036
55 Ga0111539_10000030 3300009094 Bacteria 175454
56 Ga0105245_10000033 3300009098 Bacteria 148617
57 Ga0105245_10007841 3300009098 Bacteria 9351
58 Ga0105245_10265903 3300009098 Bacteria 1671
59 Ga0105245_10364399 3300009098 Bacteria 1435
60 Ga0114129_10207485 3300009147 Bacteria 2650
61 Ga0114129_11072753 3300009147 Bacteria 1010
62 Ga0105243_10973901 3300009148 Unclassified 849
63 Ga0105248_10784263 3300009177 Bacteria 1075
64 Ga0105238_10000005 3300009551 Bacteria 372840
65 Ga0099796_10341071 3300010159 Bacteria 644
66 Ga0105239_10073067 3300010375 Bacteria 3771
67 Ga0105246_10099472 3300011119 Bacteria 2114
68 Ga0157369_10000927 3300013105 Bacteria 37308
69 Ga0157374_10000006 3300013296 Bacteria 640284
70 Ga0157378_10000499 3300013297 Bacteria 37240
71 Ga0157378_10003879 3300013297 Bacteria 13239
72 Ga0157378_11252257 3300013297 Unclassified 782
73 Ga0163162_10288920 3300013306 Unclassified 1772
74 Ga0157372_10377049 3300013307 Bacteria 1653
75 Ga0157372_10633477 3300013307 Bacteria 1245
76 Ga0157375_10000018 3300013308 Bacteria 285123
77 Ga0157375_10000064 3300013308 Bacteria 112951
78 Ga0157375_10001254 3300013308 Bacteria 21963
79 Ga0157375_10607442 3300013308 Unclassified 1252
80 Ga0163163_10230775 3300014325 Bacteria 1900
81 Ga0157380_10035982 3300014326 Unclassified 3828
82 Ga0157377_10000003 3300014745 Bacteria 435133
83 Ga0157377_10000102 3300014745 Bacteria 60035
84 Ga0157377_10611451 3300014745 Bacteria 779
85 Ga0157376_10000003 3300014969 Bacteria 568634
86 Ga0213873_10000004 3300021358 Bacteria 774374
87 Ga0213873_10005030 3300021358 Unclassified 2508
88 Ga0213876_10000007 3300021384 Bacteria 670340
89 Ga0213876_10000028 3300021384 Bacteria 222108
90 Ga0213876_10000930 3300021384 Bacteria 19350
91 Ga0213876_10023624 3300021384 Bacteria 3247
92 Ga0207682_10122021 3300025893 Bacteria 1156
93 Ga0207699_10418196 3300025906 Bacteria 957
94 Ga0207705_10343573 3300025909 Bacteria 1149
95 Ga0207684_10223043 3300025910 Bacteria 1627
96 Ga0207646_10117840 3300025922 Bacteria 2385
97 Ga0207694_10000001 3300025924 Bacteria 4078485
98 Ga0207650_10000115 3300025925 Bacteria 105044
99 Ga0207650_10728679 3300025925 Bacteria 838
100 Ga0207650_10912421 3300025925 Bacteria 746
101 Ga0207659_10000011 3300025926 Bacteria 275661
102 Ga0207687_10000006 3300025927 Bacteria 641680
103 Ga0207687_10007001 3300025927 Bacteria 7431
104 Ga0207687_10647658 3300025927 Unclassified 894
105 Ga0207664_10852245 3300025929 Bacteria 819
106 Ga0207706_10802890 3300025933 Bacteria 799
107 Ga0207670_10000303 3300025936 Bacteria 29521
108 Ga0207704_10065222 3300025938 Unclassified 2279
109 Ga0207665_10063726 3300025939 Bacteria 2504
110 Ga0207691_10000605 3300025940 Bacteria 35769
111 Ga0207689_10008438 3300025942 Bacteria 8973
112 Ga0207689_10170518 3300025942 Unclassified 1794
113 Ga0207661_10000006 3300025944 Bacteria 537727
114 Ga0207661_10140046 3300025944 Bacteria 2081
115 Ga0207651_10007433 3300025960 Bacteria 5838
116 Ga0207640_10028592 3300025981 Bacteria 3411
117 Ga0207677_10000011 3300026023 Bacteria 199704
118 Ga0207677_10000153 3300026023 Bacteria 55121
119 Ga0207703_10000008 3300026035 Bacteria 373718
120 Ga0207639_10229844 3300026041 Bacteria 1607
121 Ga0207639_10384852 3300026041 Bacteria 1260
122 Ga0207708_10000033 3300026075 Bacteria 145920
123 Ga0207641_10631434 3300026088 Bacteria 1051
124 Ga0207676_10000028 3300026095 Bacteria 237195
125 Ga0209973_1018257 3300027252 Bacteria 908
126 Ga0209969_1010620 3300027360 Archaea 1319
127 Ga0209967_1015754 3300027364 Bacteria 1083
128 Ga0209981_1003767 3300027378 Archaea 1972
129 Ga0209984_1011361 3300027424 Bacteria 1153
130 Ga0209995_1016450 3300027471 Bacteria 1215
131 Ga0209968_1002865 3300027526 Archaea 2587
132 Ga0209982_1013649 3300027552 Bacteria 1225
133 Ga0210002_1010734 3300027617 Archaea 1410
134 Ga0209983_1000405 3300027665 Bacteria 9247
135 Ga0209971_1000222 3300027682 Bacteria 16775
136 Ga0209966_1000221 3300027695 Bacteria 22469
137 Ga0209998_10000028 3300027717 Bacteria 60458
138 Ga0209974_10020041 3300027876 Archaea 2216
139 Ga0207428_10000038 3300027907 Bacteria 216105
140 Ga0307511_10000606 3300030521 Bacteria 38444
141 Ga0314311_1056438 3300030733 Bacteria 1951
142 Ga0307408_100219150 3300031548 Unclassified 1552
143 Ga0307413_10813905 3300031824 Bacteria 786
144 Ga0307413_11950264 3300031824 Bacteria 528
145 Ga0307410_11456011 3300031852 Unclassified 602
146 Ga0307409_100071053 3300031995 Bacteria 2766
147 Ga0307409_101709535 3300031995 Bacteria 658
148 Ga0307416_100067680 3300032002 Bacteria 2947
149 Ga0373940_0166641 3300035088 Bacteria 710
150 Ga0373932_0000296 3300035112 Bacteria 15000
151 Ga0373943_0038779 3300035170 Bacteria 2292
152 Ga0373947_0108478 3300035725 Unclassified 1752
153 Ga0436365_0067311 3300039437 Bacteria 45592
154 Ga0436365_0073603 3300039437 Bacteria 250590
155 Ga0436365_1659689 3300039437 Bacteria 27329
156 Ga0436365_1704384 3300039437 Bacteria 3018
157 Ga0436363_0655856 3300039450 Unclassified 562
158 Ga0436362_0060085 3300039453 Bacteria 9177
159 Ga0436362_0290430 3300039453 Bacteria 772596
160 Ga0451839_1448181 3300041496 Bacteria 1470
161 Ga0451843_0533339 3300041509 Bacteria 754
162 Ga0450893_0105420 3300042532 Archaea 578
163 Ga0451577_0002708 3300042876 Bacteria 20620
164 Ga0451577_0005250 3300042876 Bacteria 13323
165 Ga0451577_0392414 3300042876 Bacteria 1260
166 Ga0451577_1270120 3300042876 Bacteria 655
167 Ga0453684_0000414 3300044712 Bacteria 174278
168 Ga0453684_0004769 3300044712 Bacteria 27970
169 Ga0453684_1712721 3300044712 Bacteria 642
170 Ga0466957_0599107 3300044842 Bacteria 771
171 Ga0451576_0192808 3300045051 Bacteria 2128
172 Ga0451576_1401095 3300045051 Bacteria 727
173 Ga0495645_0554468 3300046543 Bacteria 712
174 Ga0495679_140037 3300047446 Unclassified 653
175 Ga0501031_0078429 3300049568 Bacteria 2152
176 Ga0501036_0054648 3300049572 Archaea 3383
177 Ga0501037_0461795 3300049573 Bacteria 865
178 Ga0501038_0146043 3300049574 Bacteria 1931
179 Ga0501039_0029889 3300049575 Bacteria 4198
180 Ga0501041_0003240 3300049577 Bacteria 9358
181 Ga0501042_0001072 3300049578 Bacteria 15665
182 Ga0501043_0111373 3300049579 Bacteria 2149
183 Ga0501046_0000394 3300049580 Bacteria 43581
184 Ga0501047_0015536 3300049581 Bacteria 7253
185 Ga0501048_0005462 3300049582 Bacteria 9669
186 Ga0501071_0663851 3300049587 Bacteria 802
187 Ga0501072_0019459 3300049588 Bacteria 5249
188 Ga0501074_0002364 3300049590 Bacteria 13134
189 Ga0501074_0554204 3300049590 Bacteria 814
190 Ga0501075_0021361 3300049591 Bacteria 4717
191 Ga0501076_0001825 3300049592 Bacteria 14462
192 Ga0501077_0047450 3300049593 Archaea 2729
193 Ga0501079_0006572 3300049741 Bacteria 8743
194 Ga0501080_0047906 3300049742 Bacteria 3979
195 Ga0501080_0372464 3300049742 Bacteria 1287
196 Ga0501081_0005972 3300049743 Bacteria 7881
197 Ga0501083_0018525 3300049744 Bacteria 4852
198 Ga0501045_0004737 3300049824 Bacteria 9386
199 nmdc:mga05p37_1101812_c1 3300050507 Bacteria 831
200 nmdc:mga05p37_81927_c1 3300050507 Bacteria 3975
201 nmdc:mga09592_78197_c1 3300050508 Bacteria 2815
202 nmdc:mga08y16_27_c1 3300050511 Bacteria 214573
203 Ga0500643_018442 3300053087 Bacteria 2315
204 Ga0500593_098058 3300053117 Bacteria 1227
205 Ga0500568_0016627 3300053139 Bacteria 3265
206 Ga0501084_0000727 3300054114 Bacteria 25071
207 Ga0501082_0002409 3300060353 Bacteria 16410
208 Ga0530510_0017149 3300061734 Bacteria 5130

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100123242 Ga0070683_1001232422 136
2 3300005518 Ga0070699_100917831 Ga0070699_1009178311 136
3 3300005535 Ga0070684_100113909 Ga0070684_1001139091 136
4 3300006852 Ga0075433_10828114 Ga0075433_108281141 136
5 3300006880 Ga0075429_100207915 Ga0075429_1002079151 136
6 3300009147 Ga0114129_10207485 Ga0114129_102074852 136
7 3300025944 Ga0207661_10140046 Ga0207661_101400462 136
8 3300050507 nmdc:mga05p37_81927_c1 nmdc:mga05p37_81927_c1_2442_2891 136
9 3300050508 nmdc:mga09592_78197_c1 nmdc:mga09592_78197_c1_1605_2054 136
10 3300053117 Ga0500593_098058 Ga0500593_098058_212_649 136
11 3300053087 Ga0500643_018442 Ga0500643_018442_971_1411 137
12 3300053139 Ga0500568_0016627 Ga0500568_0016627_2050_2490 137
13 3300013308 Ga0157375_10000064 Ga0157375_1000006427 140
14 3300046543 Ga0495645_0554468 Ga0495645_0554468_57_488 142
15 3300031548 Ga0307408_100219150 Ga0307408_1002191502 144
16 3300031852 Ga0307410_11456011 Ga0307410_114560111 144
17 3300031995 Ga0307409_100071053 Ga0307409_1000710533 144
18 3300032002 Ga0307416_100067680 Ga0307416_1000676803 144
19 3300042876 Ga0451577_0005250 Ga0451577_0005250_6489_6926 144
20 3300042876 Ga0451577_0392414 Ga0451577_0392414_239_673 144
21 3300044712 Ga0453684_0000414 Ga0453684_0000414_164538_164975 144
22 3300044712 Ga0453684_1712721 Ga0453684_1712721_166_600 144
23 3300005539 Ga0068853_100686706 Ga0068853_1006867062 145
24 3300005615 Ga0070702_101091492 Ga0070702_1010914921 145
25 3300013307 Ga0157372_10633477 Ga0157372_106334772 145
26 3300021384 Ga0213876_10023624 Ga0213876_100236242 145
27 3300026041 Ga0207639_10384852 Ga0207639_103848521 145
28 3300030733 Ga0314311_1056438 Ga0314311_10564382 145
29 3300039437 Ga0436365_1704384 Ga0436365_1704384_2514_2951 145
30 3300042876 Ga0451577_0002708 Ga0451577_0002708_13885_14325 145
31 3300044712 Ga0453684_0004769 Ga0453684_0004769_11929_12369 145
32 3300045051 Ga0451576_1401095 Ga0451576_1401095_77_517 145
33 3300049590 Ga0501074_0554204 Ga0501074_0554204_332_769 145
34 3300049742 Ga0501080_0372464 Ga0501080_0372464_616_1053 145
35 3300005333 Ga0070677_10092816 Ga0070677_100928162 146
36 3300005337 Ga0070682_100000006 Ga0070682_10000000614 146
37 3300005338 Ga0068868_100000562 Ga0068868_1000005628 146
38 3300005341 Ga0070691_10171414 Ga0070691_101714142 146
39 3300005354 Ga0070675_100000060 Ga0070675_10000006053 146
40 3300005364 Ga0070673_100056075 Ga0070673_1000560753 146
41 3300005467 Ga0070706_100337707 Ga0070706_1003377071 146
42 3300005543 Ga0070672_100000848 Ga0070672_1000008483 146
43 3300005618 Ga0068864_100000054 Ga0068864_10000005435 146
44 3300005841 Ga0068863_101877281 Ga0068863_1018772811 146
45 3300005842 Ga0068858_100000523 Ga0068858_10000052313 146
46 3300006028 Ga0070717_11372135 Ga0070717_113721352 146
47 3300006881 Ga0068865_100085460 Ga0068865_1000854603 146
48 3300009036 Ga0105244_10170260 Ga0105244_101702601 146
49 3300009094 Ga0111539_10000030 Ga0111539_10000030116 146
50 3300009098 Ga0105245_10007841 Ga0105245_100078416 146
51 3300013297 Ga0157378_11252257 Ga0157378_112522572 146
52 3300013308 Ga0157375_10000018 Ga0157375_10000018174 146
53 3300014326 Ga0157380_10035982 Ga0157380_100359823 146
54 3300025893 Ga0207682_10122021 Ga0207682_101220212 146
55 3300025926 Ga0207659_10000011 Ga0207659_10000011192 146
56 3300025927 Ga0207687_10007001 Ga0207687_100070012 146
57 3300025936 Ga0207670_10000303 Ga0207670_1000030315 146
58 3300025938 Ga0207704_10065222 Ga0207704_100652222 146
59 3300025940 Ga0207691_10000605 Ga0207691_1000060528 146
60 3300025960 Ga0207651_10007433 Ga0207651_100074335 146
61 3300026023 Ga0207677_10000011 Ga0207677_100000118 146
62 3300026035 Ga0207703_10000008 Ga0207703_10000008249 146
63 3300026075 Ga0207708_10000033 Ga0207708_1000003397 146
64 3300026088 Ga0207641_10631434 Ga0207641_106314342 146
65 3300026095 Ga0207676_10000028 Ga0207676_10000028159 146
66 3300027907 Ga0207428_10000038 Ga0207428_10000038167 146
67 3300031824 Ga0307413_11950264 Ga0307413_119502641 146
68 3300031995 Ga0307409_101709535 Ga0307409_1017095351 146
69 3300039450 Ga0436363_0655856 Ga0436363_0655856_79_519 146
70 3300042532 Ga0450893_0105420 Ga0450893_0105420_92_532 146
71 3300049587 Ga0501071_0663851 Ga0501071_0663851_151_624 146
72 3300050511 nmdc:mga08y16_27_c1 nmdc:mga08y16_27_c1_165860_166300 146
73 3300005327 Ga0070658_10255486 Ga0070658_102554862 147
74 3300005329 Ga0070683_100000057 Ga0070683_1000000577 147
75 3300005330 Ga0070690_100898040 Ga0070690_1008980401 147
76 3300005330 Ga0070690_100899302 Ga0070690_1008993021 147
77 3300005331 Ga0070670_100000150 Ga0070670_10000015029 147
78 3300005331 Ga0070670_100131801 Ga0070670_1001318012 147
79 3300005334 Ga0068869_100002670 Ga0068869_1000026706 147
80 3300005336 Ga0070680_100838940 Ga0070680_1008389402 147
81 3300005338 Ga0068868_100000028 Ga0068868_10000002842 147
82 3300005356 Ga0070674_100623038 Ga0070674_1006230382 147
83 3300005434 Ga0070709_10483542 Ga0070709_104835421 147
84 3300005445 Ga0070708_100140173 Ga0070708_1001401732 147
85 3300005458 Ga0070681_10583414 Ga0070681_105834141 147
86 3300005468 Ga0070707_100009076 Ga0070707_1000090763 147
87 3300005471 Ga0070698_100794540 Ga0070698_1007945402 147
88 3300005530 Ga0070679_100511228 Ga0070679_1005112282 147
89 3300005535 Ga0070684_100000552 Ga0070684_10000055216 147
90 3300005539 Ga0068853_100323853 Ga0068853_1003238532 147
91 3300005543 Ga0070672_100056475 Ga0070672_1000564752 147
92 3300005544 Ga0070686_100190721 Ga0070686_1001907212 147
93 3300005544 Ga0070686_101525409 Ga0070686_1015254091 147
94 3300005546 Ga0070696_100706797 Ga0070696_1007067971 147
95 3300005547 Ga0070693_100188197 Ga0070693_1001881973 147
96 3300005547 Ga0070693_100968286 Ga0070693_1009682861 147
97 3300005578 Ga0068854_100124195 Ga0068854_1001241952 147
98 3300005615 Ga0070702_100009828 Ga0070702_1000098282 147
99 3300005615 Ga0070702_100037119 Ga0070702_1000371192 147
100 3300005834 Ga0068851_10036694 Ga0068851_100366941 147
101 3300006175 Ga0070712_100720269 Ga0070712_1007202692 147
102 3300006914 Ga0075436_100598574 Ga0075436_1005985741 147
103 3300009098 Ga0105245_10000033 Ga0105245_10000033105 147
104 3300009098 Ga0105245_10265903 Ga0105245_102659032 147
105 3300009098 Ga0105245_10364399 Ga0105245_103643992 147
106 3300009147 Ga0114129_11072753 Ga0114129_110727532 147
107 3300009148 Ga0105243_10973901 Ga0105243_109739011 147
108 3300009177 Ga0105248_10784263 Ga0105248_107842632 147
109 3300009551 Ga0105238_10000005 Ga0105238_1000000581 147
110 3300010159 Ga0099796_10341071 Ga0099796_103410711 147
111 3300010375 Ga0105239_10073067 Ga0105239_100730672 147
112 3300011119 Ga0105246_10099472 Ga0105246_100994722 147
113 3300013105 Ga0157369_10000927 Ga0157369_100009274 147
114 3300013296 Ga0157374_10000006 Ga0157374_10000006315 147
115 3300013297 Ga0157378_10000499 Ga0157378_1000049922 147
116 3300013297 Ga0157378_10003879 Ga0157378_100038795 147
117 3300013306 Ga0163162_10288920 Ga0163162_102889202 147
118 3300013308 Ga0157375_10001254 Ga0157375_100012544 147
119 3300013308 Ga0157375_10607442 Ga0157375_106074422 147
120 3300014325 Ga0163163_10230775 Ga0163163_102307752 147
121 3300014745 Ga0157377_10000003 Ga0157377_10000003262 147
122 3300014745 Ga0157377_10000102 Ga0157377_1000010251 147
123 3300014745 Ga0157377_10611451 Ga0157377_106114512 147
124 3300014969 Ga0157376_10000003 Ga0157376_10000003422 147
125 3300021358 Ga0213873_10000004 Ga0213873_10000004147 147
126 3300021358 Ga0213873_10005030 Ga0213873_100050302 147
127 3300021384 Ga0213876_10000007 Ga0213876_10000007147 147
128 3300021384 Ga0213876_10000028 Ga0213876_10000028115 147
129 3300021384 Ga0213876_10000930 Ga0213876_1000093017 147
130 3300025906 Ga0207699_10418196 Ga0207699_104181961 147
131 3300025909 Ga0207705_10343573 Ga0207705_103435732 147
132 3300025910 Ga0207684_10223043 Ga0207684_102230432 147
133 3300025922 Ga0207646_10117840 Ga0207646_101178402 147
134 3300025924 Ga0207694_10000001 Ga0207694_100000013074 147
135 3300025925 Ga0207650_10000115 Ga0207650_1000011525 147
136 3300025925 Ga0207650_10728679 Ga0207650_107286792 147
137 3300025925 Ga0207650_10912421 Ga0207650_109124211 147
138 3300025927 Ga0207687_10000006 Ga0207687_10000006106 147
139 3300025927 Ga0207687_10647658 Ga0207687_106476581 147
140 3300025929 Ga0207664_10852245 Ga0207664_108522452 147
141 3300025939 Ga0207665_10063726 Ga0207665_100637262 147
142 3300025942 Ga0207689_10008438 Ga0207689_100084384 147
143 3300025942 Ga0207689_10170518 Ga0207689_101705182 147
144 3300025944 Ga0207661_10000006 Ga0207661_10000006284 147
145 3300025981 Ga0207640_10028592 Ga0207640_100285922 147
146 3300026023 Ga0207677_10000153 Ga0207677_1000015330 147
147 3300026041 Ga0207639_10229844 Ga0207639_102298442 147
148 3300030521 Ga0307511_10000606 Ga0307511_1000060613 147
149 3300031824 Ga0307413_10813905 Ga0307413_108139052 147
150 3300035088 Ga0373940_0166641 Ga0373940_0166641_155_598 147
151 3300035112 Ga0373932_0000296 Ga0373932_0000296_1655_2098 147
152 3300035170 Ga0373943_0038779 Ga0373943_0038779_126_569 147
153 3300035725 Ga0373947_0108478 Ga0373947_0108478_1168_1611 147
154 3300039437 Ga0436365_0067311 Ga0436365_0067311_32140_32583 147
155 3300039437 Ga0436365_0073603 Ga0436365_0073603_88712_89155 147
156 3300039437 Ga0436365_1659689 Ga0436365_1659689_392_835 147
157 3300039453 Ga0436362_0060085 Ga0436362_0060085_8063_8506 147
158 3300039453 Ga0436362_0290430 Ga0436362_0290430_593545_593988 147
159 3300041496 Ga0451839_1448181 Ga0451839_1448181_188_631 147
160 3300041509 Ga0451843_0533339 Ga0451843_0533339_250_699 147
161 3300044842 Ga0466957_0599107 Ga0466957_0599107_266_709 147
162 3300047446 Ga0495679_140037 Ga0495679_140037_78_575 147
163 3300050507 nmdc:mga05p37_1101812_c1 nmdc:mga05p37_1101812_c1_87_530 147
164 3300003502 JGI26143J51219_1005007 JGI26143J51219_10050071 148
165 3300005341 Ga0070691_10021435 Ga0070691_100214352 148
166 3300005545 Ga0070695_100004878 Ga0070695_1000048785 148
167 3300013307 Ga0157372_10377049 Ga0157372_103770493 148
168 3300025933 Ga0207706_10802890 Ga0207706_108028902 148
169 3300027252 Ga0209973_1018257 Ga0209973_10182572 148
170 3300027360 Ga0209969_1010620 Ga0209969_10106202 148
171 3300027364 Ga0209967_1015754 Ga0209967_10157542 148
172 3300027378 Ga0209981_1003767 Ga0209981_10037672 148
173 3300027424 Ga0209984_1011361 Ga0209984_10113612 148
174 3300027471 Ga0209995_1016450 Ga0209995_10164503 148
175 3300027526 Ga0209968_1002865 Ga0209968_10028653 148
176 3300027552 Ga0209982_1013649 Ga0209982_10136493 148
177 3300027617 Ga0210002_1010734 Ga0210002_10107342 148
178 3300027665 Ga0209983_1000405 Ga0209983_10004057 148
179 3300027682 Ga0209971_1000222 Ga0209971_100022211 148
180 3300027695 Ga0209966_1000221 Ga0209966_100022127 148
181 3300027717 Ga0209998_10000028 Ga0209998_1000002814 148
182 3300027876 Ga0209974_10020041 Ga0209974_100200412 148
183 3300042876 Ga0451577_1270120 Ga0451577_1270120_34_480 148
184 3300045051 Ga0451576_0192808 Ga0451576_0192808_539_985 148
185 3300049568 Ga0501031_0078429 Ga0501031_0078429_1341_1787 148
186 3300049572 Ga0501036_0054648 Ga0501036_0054648_2439_2885 148
187 3300049573 Ga0501037_0461795 Ga0501037_0461795_353_799 148
188 3300049574 Ga0501038_0146043 Ga0501038_0146043_359_805 148
189 3300049575 Ga0501039_0029889 Ga0501039_0029889_2308_2754 148
190 3300049577 Ga0501041_0003240 Ga0501041_0003240_713_1159 148
191 3300049578 Ga0501042_0001072 Ga0501042_0001072_3299_3745 148
192 3300049579 Ga0501043_0111373 Ga0501043_0111373_1041_1487 148
193 3300049580 Ga0501046_0000394 Ga0501046_0000394_30552_30998 148
194 3300049581 Ga0501047_0015536 Ga0501047_0015536_1946_2392 148
195 3300049582 Ga0501048_0005462 Ga0501048_0005462_8373_8819 148
196 3300049588 Ga0501072_0019459 Ga0501072_0019459_3822_4268 148
197 3300049590 Ga0501074_0002364 Ga0501074_0002364_10871_11317 148
198 3300049591 Ga0501075_0021361 Ga0501075_0021361_1092_1538 148
199 3300049592 Ga0501076_0001825 Ga0501076_0001825_10171_10617 148
200 3300049593 Ga0501077_0047450 Ga0501077_0047450_2002_2448 148
201 3300049741 Ga0501079_0006572 Ga0501079_0006572_5070_5516 148
202 3300049742 Ga0501080_0047906 Ga0501080_0047906_2323_2769 148
203 3300049743 Ga0501081_0005972 Ga0501081_0005972_4307_4753 148
204 3300049744 Ga0501083_0018525 Ga0501083_0018525_283_729 148
205 3300049824 Ga0501045_0004737 Ga0501045_0004737_5944_6390 148
206 3300054114 Ga0501084_0000727 Ga0501084_0000727_15270_15716 148
207 3300060353 Ga0501082_0002409 Ga0501082_0002409_12271_12717 148
208 3300061734 Ga0530510_0017149 Ga0530510_0017149_2677_3123 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

22

143

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.9299 10 145
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.9197 10 145
3qa9-assembly1.cif.gz_A crystal structure of prb (ph1109 protein redesigned for binding) 0.9196 8 145
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.9166 10 145
3q9n-assembly2.cif.gz_B in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9082 10 145
ID Description Score Start End Superfamily
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9299 10 145 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9166 10 145 3.40.50.720
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9082 10 145 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8902 23 140 3.40.50.720
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8719 21 143 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W5TCV3-F1-model_v4 CoA-binding protein 0.9944 8 144
AF-A0A2V6T1N2-F1-model_v4 CoA-binding protein 0.9942 1 136
AF-A0A352FQP4-F1-model_v4 CoA-binding protein 0.9936 3 145
AF-A0A7W1W8Z4-F1-model_v4 CoA-binding protein 0.9932 3 146
AF-A0A2V8SKW0-F1-model_v4 CoA-binding domain-containing protein 0.9888 2 147

Feature Viewer

pLDDT pTM Quality
96.77 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map