F318004

General Info

Members Datasets Scaffolds Average Seq Length
208 114 416 341

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100000017|Ga0307408_100000017130
Length 362
Sequence MVSSSGLSGRIAVDAMGGDLGPPEVVAAIDLALSEFTGLNPITLVGDEVVLKPLMKRHGLDGHPSLRLFHASEVITMEDKPLPSLKRKKDASMFRAIELVKSGEASAVVSCGNTGALMAGGTIKLRTLDGIDRPALAAIIPRKNGHFILIDAGANPEAEAEHLVHNALLGSHYARVVLGVANPRVGLLTIGTEEGKGNALISATNDHLKNLGSLINYVGPTEGFQVFTDHCDVAVCDGFVGNLLLKSWESLAHFFSDTLKSELKANPIRMGGAMLSRGAFKALKKRMNPEVYGGAPLLGLRGNVLKAHGSSSRHAIKNAILAASKIIKADMLHLIEADAARANALIAPPQDSAPTTLEAPAS

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
49 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
50 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
51 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
52 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
53 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
54 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
81 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
97 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
98 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
99 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
102 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
105 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
109 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
110 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
111 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
112 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
113 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
114 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 0
Rhizosphere 96.63
Stem 0
Stem Tuber 0
Unclassified 2.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100000017 3300031548 Bacteria 355890
2 rootH2_10172832 3300003320 Bacteria 3285
3 rootL2_10061709 3300003322 Bacteria 13737
4 rootL2_10135458 3300003322 Bacteria 4463
5 rootH1_10193262 3300003323 Bacteria 6256
6 Ga0070658_10034233 3300005327 Bacteria 4087
7 Ga0070683_100033214 3300005329 Bacteria 4704
8 Ga0070683_100052215 3300005329 Bacteria 3787
9 Ga0068869_100000396 3300005334 Bacteria 23752
10 Ga0070680_100002771 3300005336 Bacteria 13014
11 Ga0070680_100297683 3300005336 Bacteria 1368
12 Ga0068868_100108521 3300005338 Bacteria 2253
13 Ga0070660_100190454 3300005339 Unclassified 1661
14 Ga0070661_100008626 3300005344 Bacteria 7049
15 Ga0070714_100105014 3300005435 Bacteria 2493
16 Ga0070713_100005099 3300005436 Bacteria 8937
17 Ga0070678_100211260 3300005456 Bacteria 1608
18 Ga0070681_10010812 3300005458 Bacteria 9022
19 Ga0070681_10067738 3300005458 Bacteria 3538
20 Ga0070681_10107235 3300005458 Bacteria 2734
21 Ga0070681_10200144 3300005458 Bacteria 1916
22 Ga0070679_100024121 3300005530 Bacteria 5960
23 Ga0070679_100032731 3300005530 Bacteria 5145
24 Ga0070679_100113005 3300005530 Bacteria 2701
25 Ga0070679_100135260 3300005530 Bacteria 2446
26 Ga0068853_100016750 3300005539 Bacteria 6037
27 Ga0068855_100290881 3300005563 Bacteria 1811
28 Ga0068854_100033003 3300005578 Bacteria 3607
29 Ga0068856_100000166 3300005614 Bacteria 68390
30 Ga0068852_100097401 3300005616 Bacteria 2646
31 Ga0070717_10000243 3300006028 Bacteria 37415
32 Ga0097621_100002522 3300006237 Bacteria 12549
33 Ga0068871_100181690 3300006358 Bacteria 1808
34 Ga0068865_100004638 3300006881 Bacteria 8299
35 Ga0105238_10203055 3300009551 Bacteria 1958
36 Ga0105249_10000078 3300009553 Bacteria 140030
37 Ga0157373_10092579 3300013100 Bacteria 2129
38 Ga0157373_10171100 3300013100 Bacteria 1528
39 Ga0157370_10010634 3300013104 Bacteria 9685
40 Ga0157369_10009006 3300013105 Bacteria 11431
41 Ga0157369_10277206 3300013105 Bacteria 1746
42 Ga0157369_10405807 3300013105 Unclassified 1413
43 Ga0157372_10374356 3300013307 Bacteria 1660
44 Ga0157376_10056342 3300014969 Bacteria 3283
45 Ga0207705_10006994 3300025909 Bacteria 8328
46 Ga0207707_10001930 3300025912 Bacteria 18855
47 Ga0207707_10268866 3300025912 Bacteria 1478
48 Ga0207660_10023341 3300025917 Bacteria 4176
49 Ga0207652_10007085 3300025921 Bacteria 9034
50 Ga0207652_10019468 3300025921 Bacteria 5583
51 Ga0207652_10227819 3300025921 Bacteria 1680
52 Ga0207694_10101657 3300025924 Bacteria 2278
53 Ga0207700_10005493 3300025928 Bacteria 7601
54 Ga0207664_10015852 3300025929 Bacteria 5486
55 Ga0207704_10012735 3300025938 Bacteria 4181
56 Ga0207689_10000928 3300025942 Bacteria 28114
57 Ga0207661_10024050 3300025944 Bacteria 4610
58 Ga0207661_10036806 3300025944 Bacteria 3823
59 Ga0207661_10070837 3300025944 Bacteria 2847
60 Ga0207667_10321031 3300025949 Bacteria 1582
61 Ga0207712_10000079 3300025961 Bacteria 115164
62 Ga0207639_10164471 3300026041 Bacteria 1873
63 Ga0207702_10000367 3300026078 Bacteria 51620
64 Ga0207698_10006774 3300026142 Bacteria 7161
65 Ga0265337_1007224 3300028556 Bacteria 4179
66 Ga0265337_1013770 3300028556 Bacteria 2701
67 Ga0265337_1015197 3300028556 Bacteria 2528
68 Ga0265319_1000043 3300028563 Bacteria 109696
69 Ga0265319_1003077 3300028563 Bacteria 8834
70 Ga0265319_1005333 3300028563 Bacteria 6170
71 Ga0265319_1019923 3300028563 Bacteria 2495
72 Ga0265334_10003707 3300028573 Bacteria 6916
73 Ga0265334_10007624 3300028573 Bacteria 4637
74 Ga0265318_10000023 3300028577 Bacteria 160826
75 Ga0265318_10000690 3300028577 Bacteria 22719
76 Ga0265318_10001300 3300028577 Bacteria 15021
77 Ga0265318_10001908 3300028577 Bacteria 11684
78 Ga0265323_10000101 3300028653 Bacteria 48976
79 Ga0265323_10018619 3300028653 Bacteria 2685
80 Ga0265323_10037744 3300028653 Bacteria 1768
81 Ga0265322_10000739 3300028654 Bacteria 11944
82 Ga0265336_10004903 3300028666 Bacteria 5013
83 Ga0265336_10025805 3300028666 Bacteria 1850
84 Ga0265338_10000329 3300028800 Bacteria 86337
85 Ga0265330_10020011 3300031235 Bacteria 3060
86 Ga0265332_10021241 3300031238 Bacteria 2869
87 Ga0265332_10051235 3300031238 Bacteria 1773
88 Ga0265320_10000254 3300031240 Bacteria 43938
89 Ga0265320_10001238 3300031240 Bacteria 18757
90 Ga0265320_10003550 3300031240 Bacteria 10434
91 Ga0265320_10004290 3300031240 Bacteria 9371
92 Ga0265320_10005760 3300031240 Bacteria 7901
93 Ga0265320_10009274 3300031240 Bacteria 5947
94 Ga0265320_10014501 3300031240 Bacteria 4482
95 Ga0265320_10069233 3300031240 Bacteria 1666
96 Ga0265331_10006953 3300031250 Bacteria 6606
97 Ga0265327_10000057 3300031251 Bacteria 242754
98 Ga0265327_10004625 3300031251 Bacteria 12088
99 Ga0265327_10076578 3300031251 Bacteria 1662
100 Ga0265316_10000887 3300031344 Bacteria 32794
101 Ga0265316_10035833 3300031344 Bacteria 4016
102 Ga0265316_10036939 3300031344 Bacteria 3949
103 Ga0265316_10079009 3300031344 Bacteria 2524
104 Ga0265316_10089702 3300031344 Unclassified 2346
105 Ga0265316_10110056 3300031344 Bacteria 2087
106 Ga0265316_10114857 3300031344 Bacteria 2036
107 Ga0265316_10118329 3300031344 Bacteria 2002
108 Ga0265316_10209498 3300031344 Bacteria 1442
109 Ga0265313_10000228 3300031595 Bacteria 60668
110 Ga0265313_10003652 3300031595 Bacteria 12323
111 Ga0265313_10006116 3300031595 Bacteria 8655
112 Ga0265313_10006935 3300031595 Bacteria 7869
113 Ga0265313_10009967 3300031595 Bacteria 6096
114 Ga0265313_10017458 3300031595 Bacteria 4077
115 Ga0265313_10038365 3300031595 Bacteria 2386
116 Ga0307508_10000574 3300031616 Bacteria 43711
117 Ga0265314_10001071 3300031711 Bacteria 31765
118 Ga0265314_10014368 3300031711 Bacteria 6341
119 Ga0265314_10082806 3300031711 Bacteria 2110
120 Ga0265342_10004316 3300031712 Bacteria 11255
121 Ga0265342_10015444 3300031712 Bacteria 5021
122 Ga0265342_10040187 3300031712 Bacteria 2838
123 Ga0307410_10006577 3300031852 Bacteria 6283
124 Ga0307409_100000221 3300031995 Bacteria 22880
125 Ga0307416_100000034 3300032002 Bacteria 155632
126 Ga0373935_0163893 3300035692 Bacteria 1517
127 Ga0316582_0224540 3300036647 Bacteria 1285
128 Ga0395899_0296738 3300037312 Bacteria 1095
129 Ga0395900_0001406 3300037418 Bacteria 28805
130 Ga0395898_0017405 3300037466 Bacteria 7343
131 Ga0395905_0000015 3300037471 Bacteria 393880
132 Ga0451577_0002542 3300042876 Bacteria 21559
133 Ga0451577_0016735 3300042876 Bacteria 6782
134 Ga0451577_0247287 3300042876 Bacteria 1614
135 Ga0453683_0001939 3300044673 Bacteria 16831
136 Ga0453684_0000001 3300044712 Bacteria 2623166
137 Ga0453684_0028386 3300044712 Bacteria 7985
138 Ga0453684_0030880 3300044712 Bacteria 7553
139 Ga0453684_0037924 3300044712 Bacteria 6604
140 Ga0453684_0251471 3300044712 Bacteria 2029
141 Ga0453684_0412156 3300044712 Unclassified 1511
142 Ga0451576_0000856 3300045051 Bacteria 58909
143 Ga0451576_0000892 3300045051 Bacteria 56717
144 Ga0451576_0001925 3300045051 Bacteria 33256
145 Ga0451576_0004674 3300045051 Bacteria 17630
146 Ga0451576_0040490 3300045051 Bacteria 4931
147 Ga0451576_0119963 3300045051 Bacteria 2738
148 Ga0466967_0010210 3300045976 Bacteria 7027
149 Ga0495636_0022336 3300047318 Bacteria 2557
150 Ga0501031_0081717 3300049568 Bacteria 2106
151 Ga0501031_0289481 3300049568 Bacteria 1062
152 Ga0501032_0000841 3300049569 Bacteria 24925
153 Ga0501032_0001147 3300049569 Bacteria 21235
154 Ga0501032_0041232 3300049569 Bacteria 3136
155 Ga0501032_0056295 3300049569 Bacteria 2644
156 Ga0501033_0030096 3300049570 Bacteria 4079
157 Ga0501033_0138864 3300049570 Bacteria 1758
158 Ga0501034_0042245 3300049571 Bacteria 4615
159 Ga0501034_0080626 3300049571 Bacteria 3257
160 Ga0501036_0068529 3300049572 Bacteria 3002
161 Ga0501037_0012013 3300049573 Bacteria 6379
162 Ga0501037_0053956 3300049573 Bacteria 2940
163 Ga0501037_0271307 3300049573 Unclassified 1184
164 Ga0501038_0000450 3300049574 Bacteria 35843
165 Ga0501039_0011886 3300049575 Bacteria 6634
166 Ga0501042_0004431 3300049578 Bacteria 8956
167 Ga0501043_0100007 3300049579 Bacteria 2280
168 Ga0501046_0004515 3300049580 Bacteria 12612
169 Ga0501046_0015790 3300049580 Bacteria 6335
170 Ga0501046_0020993 3300049580 Bacteria 5393
171 Ga0501046_0024286 3300049580 Bacteria 4974
172 Ga0501047_0009287 3300049581 Bacteria 9291
173 Ga0501047_0009940 3300049581 Bacteria 8997
174 Ga0501047_0019493 3300049581 Bacteria 6506
175 Ga0501047_0039404 3300049581 Bacteria 4570
176 Ga0501048_0001262 3300049582 Bacteria 19135
177 Ga0501069_0127742 3300049585 Unclassified 1455
178 Ga0501070_0244258 3300049586 Bacteria 1469
179 Ga0501071_0049616 3300049587 Bacteria 3022
180 Ga0501072_0004459 3300049588 Bacteria 10638
181 Ga0501074_0300951 3300049590 Bacteria 1139
182 Ga0501075_0011911 3300049591 Bacteria 6169
183 Ga0501075_0146977 3300049591 Bacteria 1796
184 Ga0501076_0048633 3300049592 Bacteria 3352
185 Ga0501243_002266 3300049675 Bacteria 2804
186 Ga0501079_0085621 3300049741 Bacteria 2439
187 Ga0501080_0058926 3300049742 Bacteria 3574
188 Ga0501080_0149509 3300049742 Bacteria 2159
189 Ga0501081_0038541 3300049743 Bacteria 3266
190 Ga0501081_0101078 3300049743 Bacteria 2039
191 Ga0501083_0001223 3300049744 Bacteria 17388
192 Ga0501083_0009802 3300049744 Bacteria 6762
193 Ga0501083_0054934 3300049744 Bacteria 2671
194 Ga0501035_0001155 3300049822 Bacteria 27552
195 Ga0501035_0001280 3300049822 Bacteria 25975
196 Ga0501035_0005420 3300049822 Bacteria 12063
197 Ga0501044_0001175 3300049823 Bacteria 31002
198 Ga0501044_0003547 3300049823 Bacteria 17564
199 Ga0501044_0043355 3300049823 Bacteria 4673
200 Ga0501045_0021224 3300049824 Bacteria 4644
201 Ga0500568_0013648 3300053139 Bacteria 3696
202 Ga0501084_0064659 3300054114 Bacteria 3061
203 Ga0501082_0040496 3300060353 Bacteria 4019
204 Ga0501082_0116491 3300060353 Bacteria 2314
205 Ga0530510_0014833 3300061734 Bacteria 5503
206 Ga0530510_0039154 3300061734 Bacteria 3422
207 2524003501 2523533628 Bacteria 4098242
208 2788434403 2786546940 Bacteria 6396474
209 Ga0307408_100000017
210 rootH2_10172832
211 rootL2_10061709
212 rootL2_10135458
213 rootH1_10193262
214 Ga0070658_10034233
215 Ga0070683_100033214
216 Ga0070683_100052215
217 Ga0068869_100000396
218 Ga0070680_100002771
219 Ga0070680_100297683
220 Ga0068868_100108521
221 Ga0070660_100190454
222 Ga0070661_100008626
223 Ga0070714_100105014
224 Ga0070713_100005099
225 Ga0070678_100211260
226 Ga0070681_10010812
227 Ga0070681_10067738
228 Ga0070681_10107235
229 Ga0070681_10200144
230 Ga0070679_100024121
231 Ga0070679_100032731
232 Ga0070679_100113005
233 Ga0070679_100135260
234 Ga0068853_100016750
235 Ga0068855_100290881
236 Ga0068854_100033003
237 Ga0068856_100000166
238 Ga0068852_100097401
239 Ga0070717_10000243
240 Ga0097621_100002522
241 Ga0068871_100181690
242 Ga0068865_100004638
243 Ga0105238_10203055
244 Ga0105249_10000078
245 Ga0157373_10092579
246 Ga0157373_10171100
247 Ga0157370_10010634
248 Ga0157369_10009006
249 Ga0157369_10277206
250 Ga0157369_10405807
251 Ga0157372_10374356
252 Ga0157376_10056342
253 Ga0207705_10006994
254 Ga0207707_10001930
255 Ga0207707_10268866
256 Ga0207660_10023341
257 Ga0207652_10007085
258 Ga0207652_10019468
259 Ga0207652_10227819
260 Ga0207694_10101657
261 Ga0207700_10005493
262 Ga0207664_10015852
263 Ga0207704_10012735
264 Ga0207689_10000928
265 Ga0207661_10024050
266 Ga0207661_10036806
267 Ga0207661_10070837
268 Ga0207667_10321031
269 Ga0207712_10000079
270 Ga0207639_10164471
271 Ga0207702_10000367
272 Ga0207698_10006774
273 Ga0265337_1007224
274 Ga0265337_1013770
275 Ga0265337_1015197
276 Ga0265319_1000043
277 Ga0265319_1003077
278 Ga0265319_1005333
279 Ga0265319_1019923
280 Ga0265334_10003707
281 Ga0265334_10007624
282 Ga0265318_10000023
283 Ga0265318_10000690
284 Ga0265318_10001300
285 Ga0265318_10001908
286 Ga0265323_10000101
287 Ga0265323_10018619
288 Ga0265323_10037744
289 Ga0265322_10000739
290 Ga0265336_10004903
291 Ga0265336_10025805
292 Ga0265338_10000329
293 Ga0265330_10020011
294 Ga0265332_10021241
295 Ga0265332_10051235
296 Ga0265320_10000254
297 Ga0265320_10001238
298 Ga0265320_10003550
299 Ga0265320_10004290
300 Ga0265320_10005760
301 Ga0265320_10009274
302 Ga0265320_10014501
303 Ga0265320_10069233
304 Ga0265331_10006953
305 Ga0265327_10000057
306 Ga0265327_10004625
307 Ga0265327_10076578
308 Ga0265316_10000887
309 Ga0265316_10035833
310 Ga0265316_10036939
311 Ga0265316_10079009
312 Ga0265316_10089702
313 Ga0265316_10110056
314 Ga0265316_10114857
315 Ga0265316_10118329
316 Ga0265316_10209498
317 Ga0265313_10000228
318 Ga0265313_10003652
319 Ga0265313_10006116
320 Ga0265313_10006935
321 Ga0265313_10009967
322 Ga0265313_10017458
323 Ga0265313_10038365
324 Ga0307508_10000574
325 Ga0265314_10001071
326 Ga0265314_10014368
327 Ga0265314_10082806
328 Ga0265342_10004316
329 Ga0265342_10015444
330 Ga0265342_10040187
331 Ga0307410_10006577
332 Ga0307409_100000221
333 Ga0307416_100000034
334 Ga0373935_0163893
335 Ga0316582_0224540
336 Ga0395899_0296738
337 Ga0395900_0001406
338 Ga0395898_0017405
339 Ga0395905_0000015
340 Ga0451577_0002542
341 Ga0451577_0016735
342 Ga0451577_0247287
343 Ga0453683_0001939
344 Ga0453684_0000001
345 Ga0453684_0028386
346 Ga0453684_0030880
347 Ga0453684_0037924
348 Ga0453684_0251471
349 Ga0453684_0412156
350 Ga0451576_0000856
351 Ga0451576_0000892
352 Ga0451576_0001925
353 Ga0451576_0004674
354 Ga0451576_0040490
355 Ga0451576_0119963
356 Ga0466967_0010210
357 Ga0495636_0022336
358 Ga0501031_0081717
359 Ga0501031_0289481
360 Ga0501032_0000841
361 Ga0501032_0001147
362 Ga0501032_0041232
363 Ga0501032_0056295
364 Ga0501033_0030096
365 Ga0501033_0138864
366 Ga0501034_0042245
367 Ga0501034_0080626
368 Ga0501036_0068529
369 Ga0501037_0012013
370 Ga0501037_0053956
371 Ga0501037_0271307
372 Ga0501038_0000450
373 Ga0501039_0011886
374 Ga0501042_0004431
375 Ga0501043_0100007
376 Ga0501046_0004515
377 Ga0501046_0015790
378 Ga0501046_0020993
379 Ga0501046_0024286
380 Ga0501047_0009287
381 Ga0501047_0009940
382 Ga0501047_0019493
383 Ga0501047_0039404
384 Ga0501048_0001262
385 Ga0501069_0127742
386 Ga0501070_0244258
387 Ga0501071_0049616
388 Ga0501072_0004459
389 Ga0501074_0300951
390 Ga0501075_0011911
391 Ga0501075_0146977
392 Ga0501076_0048633
393 Ga0501243_002266
394 Ga0501079_0085621
395 Ga0501080_0058926
396 Ga0501080_0149509
397 Ga0501081_0038541
398 Ga0501081_0101078
399 Ga0501083_0001223
400 Ga0501083_0009802
401 Ga0501083_0054934
402 Ga0501035_0001155
403 Ga0501035_0001280
404 Ga0501035_0005420
405 Ga0501044_0001175
406 Ga0501044_0003547
407 Ga0501044_0043355
408 Ga0501045_0021224
409 Ga0500568_0013648
410 Ga0501084_0064659
411 Ga0501082_0040496
412 Ga0501082_0116491
413 Ga0530510_0014833
414 Ga0530510_0039154
415 2524003501
416 2788434403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02504

FA_synthesis

Fatty acid synthesis protein

9

334

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vi1-assembly2.cif.gz_B crystal structure of a fatty acid/phospholipid synthesis protein 0.9451 1 325
1vi1-assembly1.cif.gz_A crystal structure of a fatty acid/phospholipid synthesis protein 0.9447 1 324
6a1k-assembly1.cif.gz_B phosphate acyltransferase plsx from b.subtilis 0.944 1 322
1u7n-assembly1.cif.gz_B crystal structure of the fatty acid/phospholipid synthesis protein plsx from enterococcus faecalis v583 0.9292 1 322
1u7n-assembly1.cif.gz_A crystal structure of the fatty acid/phospholipid synthesis protein plsx from enterococcus faecalis v583 0.9276 1 322
ID Description Score Start End Superfamily
1u7nB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9214 2 322 3.40.718.10
af_P27247_3_343_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9147 1 330 3.40.718.10
af_P27247_3_343_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8967 1 330 3.40.718.10
1u7nB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8956 2 322 3.40.718.10
2af3D02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isocitrate/Isopropylmalate dehydrogenase-like 0.7808 112 238 3.40.50.10750
ID Description Score Start End GO Terms
AF-A0A1V6EHN6-F1-model_v4 Phosphate acyltransferase (EC 2.3.1.274) (Acyl-ACP phosphotransacylase) (Acyl-[acyl-carrier-protein]--phosphate acyltransferase) (Phosphate-acyl-ACP acyltransferase) 0.9788 1 324 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A350AUV3-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9784 104 335 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A520X5L9-F1-model_v4 Phosphate acyltransferase (EC 2.3.1.274) (Acyl-ACP phosphotransacylase) (Acyl-[acyl-carrier-protein]--phosphate acyltransferase) (Phosphate-acyl-ACP acyltransferase) 0.978 1 328 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A257QAE4-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9767 1 211 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A7X8VV14-F1-model_v4 Phosphate acyltransferase (EC 2.3.1.274) (Acyl-ACP phosphotransacylase) (Acyl-[acyl-carrier-protein]--phosphate acyltransferase) (Phosphate-acyl-ACP acyltransferase) 0.9762 1 329 GO:0005737
GO:0006633
GO:0008654
GO:0043811

Map