F317867

General Info

Members Datasets Scaffolds Average Seq Length
208 148 416 169

Family's Representative Sequence

Representative Sequence 3300025250|Ga0209026_1013188|Ga0209026_10131882
Length 199
Sequence MYKISHYVRNDNFFGFAFYICYVKTQTNKKSKAAPVVPKRPVEVYFDKYAESHQNPVNKTIHWICVPLIVFSLLGLVWAIPFPHIGFLGQYNQFINWASLLIAFSIYYYYRLSPVLSYLMLVIVFIFCYIITGLAGWQKAGGPPLWESCLAIFVVSWIGQFIGHKIEGKKPSFLDDLRFLLIGPIWLLHFVLNKLSLRY

Samples

Sample ID Description Type Environment
1 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
53 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
101 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
102 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
109 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
118 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
121 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
122 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
123 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
124 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
125 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
126 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
127 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
128 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
129 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
130 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
131 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
132 2738541283 Pedobacter sp. OK701 Isolate Unclassified
133 2738541302 Pedobacter sp. CF074 Isolate Unclassified
134 2738543023 Pedobacter sp. OK628 Isolate Unclassified
135 2739367651 Pedobacter sp. OK291 Isolate Unclassified
136 2739367656 Pedobacter sp. CF523 Isolate Unclassified
137 2739367663 Pedobacter sp. YR510 Isolate Unclassified
138 2818991437 Pedobacter terrae 518 Isolate Unclassified
139 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
140 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
141 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
142 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
143 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
144 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
145 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
146 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
147 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
148 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.35
Metatranscriptomes 0
Isolates 8.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.73
Nodule 0
Rhizoplane 0.96
Rhizosphere 82.21
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209026_1013188 3300025250 Bacteria 1415
2 JGI25157J39369_1008666 3300002741 Bacteria 1404
3 JGI25152J39213_1000022 3300002773 Bacteria 105664
4 JGI25150J39212_1000001 3300002774 Bacteria 1318726
5 JGI25151J46595_10000001 3300003187 Bacteria 887211
6 JGI25153J46596_10000001 3300003215 Bacteria 748985
7 rootH1_10205381 3300003323 Bacteria 3216
8 rootH1_10334313 3300003323 Bacteria 1329
9 Ga0065714_10002437 3300005288 Bacteria 17662
10 Ga0065714_10067532 3300005288 Bacteria 5405
11 Ga0065704_10156608 3300005289 Bacteria 1386
12 Ga0065704_10225707 3300005289 Bacteria 1059
13 Ga0070658_10212085 3300005327 Bacteria 1636
14 Ga0070676_10000916 3300005328 Bacteria 14618
15 Ga0070680_100037528 3300005336 Bacteria 3915
16 Ga0068868_100164720 3300005338 Bacteria 1833
17 Ga0070675_100388473 3300005354 Bacteria 1243
18 Ga0070673_100010122 3300005364 Bacteria 6367
19 Ga0070659_100735234 3300005366 Bacteria 855
20 Ga0070678_100071417 3300005456 Bacteria 2599
21 Ga0068867_100005376 3300005459 Bacteria 9056
22 Ga0070679_100014443 3300005530 Bacteria 7584
23 Ga0070679_100138945 3300005530 Bacteria 2410
24 Ga0068853_100034785 3300005539 Bacteria 4278
25 Ga0068855_100000033 3300005563 Bacteria 167299
26 Ga0068855_100000248 3300005563 Bacteria 67971
27 Ga0068855_100098056 3300005563 Bacteria 3376
28 Ga0068855_101467003 3300005563 Bacteria 701
29 Ga0068856_100000014 3300005614 Bacteria 163480
30 Ga0068856_100030601 3300005614 Bacteria 5262
31 Ga0068856_100066455 3300005614 Bacteria 3563
32 Ga0068852_100001225 3300005616 Bacteria 17079
33 Ga0068866_10010465 3300005718 Bacteria 3978
34 Ga0068863_100256662 3300005841 Bacteria 1689
35 Ga0075366_10238270 3300006195 Bacteria 1109
36 Ga0097621_100000519 3300006237 Bacteria 27021
37 Ga0068871_100002312 3300006358 Bacteria 12970
38 Ga0068865_100001253 3300006881 Bacteria 14760
39 Ga0105240_10025069 3300009093 Bacteria 7850
40 Ga0105240_10044401 3300009093 Bacteria 5647
41 Ga0105240_10091218 3300009093 Bacteria 3723
42 Ga0105240_10561803 3300009093 Bacteria 1261
43 Ga0105241_10026602 3300009174 Bacteria 4305
44 Ga0105241_10338012 3300009174 Bacteria 1304
45 Ga0105242_10018007 3300009176 Bacteria 5517
46 Ga0105237_10001078 3300009545 Bacteria 36653
47 Ga0105237_10007732 3300009545 Bacteria 11737
48 Ga0105237_10010888 3300009545 Bacteria 9650
49 Ga0105237_10056039 3300009545 Bacteria 3947
50 Ga0105237_10503452 3300009545 Bacteria 1218
51 Ga0105238_10020187 3300009551 Bacteria 6781
52 Ga0105239_10029028 3300010375 Bacteria 6081
53 Ga0105239_10031643 3300010375 Bacteria 5816
54 Ga0105239_10060932 3300010375 Bacteria 4142
55 Ga0157373_10382140 3300013100 Bacteria 1007
56 Ga0157371_10011265 3300013102 Bacteria 6905
57 Ga0157370_10000304 3300013104 Bacteria 61764
58 Ga0157370_10001500 3300013104 Bacteria 28871
59 Ga0157370_10012933 3300013104 Bacteria 8628
60 Ga0157370_10666988 3300013104 Bacteria 950
61 Ga0157369_10097173 3300013105 Unclassified 3142
62 Ga0157374_10003557 3300013296 Bacteria 13117
63 Ga0157374_10488448 3300013296 Unclassified 1235
64 Ga0157374_10697034 3300013296 Bacteria 1028
65 Ga0157378_10014946 3300013297 Bacteria 6795
66 Ga0157378_10050982 3300013297 Bacteria 3683
67 Ga0163162_10000052 3300013306 Bacteria 112651
68 Ga0163162_10000163 3300013306 Bacteria 61153
69 Ga0163162_10356445 3300013306 Bacteria 1596
70 Ga0157372_10388342 3300013307 Bacteria 1626
71 Ga0157372_10586947 3300013307 Unclassified 1299
72 Ga0157372_11407894 3300013307 Bacteria 804
73 Ga0157375_10007463 3300013308 Bacteria 9567
74 Ga0157375_10107231 3300013308 Bacteria 2886
75 Ga0182008_10000363 3300014497 Bacteria 35337
76 Ga0182008_10041491 3300014497 Bacteria 2295
77 Ga0182008_10042744 3300014497 Bacteria 2257
78 Ga0157376_10328939 3300014969 Bacteria 1455
79 Ga0182006_1002113 3300015261 Bacteria 11083
80 Ga0182007_10021732 3300015262 Bacteria 2274
81 Ga0183373_1001 3300015682 Bacteria 1410374
82 Ga0163161_10000735 3300017792 Bacteria 25793
83 Ga0163161_10002109 3300017792 Bacteria 14388
84 Ga0163161_10073626 3300017792 Bacteria 2503
85 Ga0163161_10466814 3300017792 Bacteria 1023
86 Ga0213872_10005560 3300021361 Bacteria 6453
87 Ga0207425_1000002 3300025245 Bacteria 1362590
88 Ga0209026_1000857 3300025250 Bacteria 15877
89 Ga0209129_1000002 3300025258 Bacteria 1359086
90 Ga0209025_1000004 3300025294 Bacteria 1361782
91 Ga0209758_1000006 3300025297 Bacteria 1359562
92 Ga0207642_10101096 3300025899 Bacteria 1447
93 Ga0207645_10001637 3300025907 Bacteria 18270
94 Ga0207705_10179118 3300025909 Bacteria 1599
95 Ga0207654_10012299 3300025911 Bacteria 4384
96 Ga0207707_10062914 3300025912 Bacteria 3230
97 Ga0207695_10019506 3300025913 Bacteria 7807
98 Ga0207695_10047680 3300025913 Bacteria 4531
99 Ga0207695_10125123 3300025913 Bacteria 2534
100 Ga0207671_10005567 3300025914 Bacteria 11561
101 Ga0207671_10030226 3300025914 Bacteria 4041
102 Ga0207671_10144491 3300025914 Bacteria 1834
103 Ga0207671_10328767 3300025914 Bacteria 1210
104 Ga0207652_10014098 3300025921 Bacteria 6471
105 Ga0207652_10046942 3300025921 Bacteria 3688
106 Ga0207694_10014463 3300025924 Bacteria 5949
107 Ga0207644_10008904 3300025931 Bacteria 6575
108 Ga0207690_10555936 3300025932 Bacteria 933
109 Ga0207686_10004954 3300025934 Bacteria 7166
110 Ga0207704_10000042 3300025938 Bacteria 89683
111 Ga0207667_10000046 3300025949 Bacteria 245420
112 Ga0207667_10001325 3300025949 Bacteria 31070
113 Ga0207667_11430001 3300025949 Bacteria 664
114 Ga0207651_10733604 3300025960 Bacteria 872
115 Ga0207677_10129865 3300026023 Bacteria 1911
116 Ga0207639_10002748 3300026041 Bacteria 11811
117 Ga0207641_10333879 3300026088 Bacteria 1441
118 Ga0207648_10024175 3300026089 Bacteria 5428
119 Ga0207683_10011379 3300026121 Bacteria 7592
120 Ga0207698_10001535 3300026142 Bacteria 13460
121 Ga0207698_10101621 3300026142 Bacteria 2385
122 Ga0307517_10001783 3300028786 Bacteria 35450
123 Ga0307515_10097064 3300028794 Bacteria 3606
124 Ga0265338_10019761 3300028800 Bacteria 7123
125 Ga0265338_10345022 3300028800 Bacteria 1072
126 Ga0265327_10124056 3300031251 Bacteria 1221
127 Ga0307405_10000003 3300031731 Bacteria 569064
128 Ga0307413_10457127 3300031824 Bacteria 1015
129 Ga0307412_10794146 3300031911 Bacteria 821
130 Ga0307414_10006008 3300032004 Bacteria 6731
131 Ga0307414_10039589 3300032004 Bacteria 3177
132 Ga0307414_10201798 3300032004 Bacteria 1618
133 Ga0307414_10293618 3300032004 Bacteria 1371
134 Ga0307414_10310316 3300032004 Bacteria 1338
135 Ga0307411_10241151 3300032005 Bacteria 1415
136 Ga0307510_10000147 3300033180 Bacteria 58704
137 Ga0395899_0000286 3300037312 Bacteria 65138
138 Ga0395900_0000285 3300037418 Bacteria 75772
139 Ga0395900_0002189 3300037418 Bacteria 21852
140 Ga0395900_0006063 3300037418 Bacteria 12605
141 Ga0395898_0005006 3300037466 Bacteria 14379
142 Ga0395898_0040039 3300037466 Bacteria 4637
143 Ga0395905_0000045 3300037471 Bacteria 241370
144 Ga0395905_0000765 3300037471 Bacteria 42351
145 Ga0395901_0001032 3300038443 Bacteria 30164
146 Ga0395901_0010816 3300038443 Bacteria 9249
147 Ga0436361_0674393 3300039447 Bacteria 7132
148 Ga0439455_0072349 3300042012 Bacteria 928
149 Ga0466959_0084125 3300045049 Bacteria 2290
150 Ga0495603_0202526 3300046455 Bacteria 1147
151 Ga0495629_0007088 3300046459 Bacteria 8260
152 Ga0495594_0024060 3300046499 Bacteria 3268
153 Ga0495606_0151724 3300046507 Bacteria 1359
154 Ga0495610_0012766 3300046512 Bacteria 5028
155 Ga0495631_0016667 3300046518 Bacteria 3497
156 Ga0495663_0092239 3300046525 Bacteria 988
157 Ga0495666_0118360 3300046526 Bacteria 1241
158 Ga0495665_0057991 3300046531 Bacteria 2044
159 Ga0495586_0132199 3300046535 Bacteria 1397
160 Ga0495586_0358490 3300046535 Bacteria 838
161 Ga0495597_0005145 3300046542 Bacteria 6974
162 Ga0495622_0052162 3300046557 Bacteria 1897
163 Ga0495625_0304324 3300046660 Bacteria 1019
164 Ga0495661_0030903 3300046665 Bacteria 3406
165 Ga0495588_0005597 3300046674 Bacteria 5599
166 Ga0495588_0043841 3300046674 Bacteria 2289
167 Ga0495649_0185154 3300046694 Bacteria 1085
168 Ga0495581_0065853 3300047315 Bacteria 2095
169 Ga0495581_0109974 3300047315 Bacteria 1602
170 Ga0495674_0024854 3300047319 Bacteria 5499
171 Ga0495676_0057913 3300047321 Bacteria 3052
172 Ga0495676_0368269 3300047321 Bacteria 958
173 Ga0495683_0214791 3300047323 Bacteria 860
174 Ga0495687_006334 3300047443 Bacteria 7285
175 Ga0495675_0110252 3300047444 Bacteria 1718
176 Ga0495593_0033085 3300047673 Bacteria 2816
177 Ga0495626_0001993 3300048091 Bacteria 15071
178 Ga0496115_0055449 3300048918 Bacteria 3184
179 Ga0496115_0061914 3300048918 Bacteria 3018
180 Ga0496122_0003793 3300048925 Bacteria 19464
181 Ga0496123_0001711 3300048926 Bacteria 29305
182 Ga0496125_0015300 3300048928 Bacteria 7425
183 Ga0501217_240607 3300049661 Bacteria 579
184 Ga0501250_034138 3300049680 Unclassified 720
185 Ga0501241_003393 3300049758 Bacteria 3007
186 nmdc:mga0k408_241_c1 3300050493 Bacteria 22414
187 Ga0500635_0081970 3300053080 Bacteria 1161
188 Ga0500608_004787 3300053122 Bacteria 5286
189 Ga0500622_0001648 3300053156 Bacteria 17446
190 Ga0500634_0054182 3300053161 Bacteria 2150
191 2586209119 2585427687 Bacteria 5544917
192 2738755510 2738541283 Bacteria 7222293
193 2738851966 2738541302 Bacteria 5944758
194 2739303572 2738543023 Bacteria 6767879
195 2739590846 2739367651 Bacteria 6359826
196 2739616994 2739367656 Bacteria 5152243
197 2739647300 2739367663 Bacteria 5040914
198 2819546501 2818991437 Bacteria 5805520
199 2842725204 2842722452 Bacteria 6263924
200 2842912479 2842909656 Bacteria 6185908
201 2849286012 2849281842 Bacteria 6065644
202 2852629317 2852627209 Bacteria 5896285
203 2857629729 2857627736 Bacteria 5625397
204 2902052529 2902048731 Bacteria 4976191
205 2904446660 2904445276 Bacteria 5310396
206 2910245740 2910245624 Bacteria 6935613
207 2919190410 2919186247 Bacteria 6244071
208 2939668691 2939664404 Bacteria 6364494
209 Ga0209026_1013188
210 JGI25157J39369_1008666
211 JGI25152J39213_1000022
212 JGI25150J39212_1000001
213 JGI25151J46595_10000001
214 JGI25153J46596_10000001
215 rootH1_10205381
216 rootH1_10334313
217 Ga0065714_10002437
218 Ga0065714_10067532
219 Ga0065704_10156608
220 Ga0065704_10225707
221 Ga0070658_10212085
222 Ga0070676_10000916
223 Ga0070680_100037528
224 Ga0068868_100164720
225 Ga0070675_100388473
226 Ga0070673_100010122
227 Ga0070659_100735234
228 Ga0070678_100071417
229 Ga0068867_100005376
230 Ga0070679_100014443
231 Ga0070679_100138945
232 Ga0068853_100034785
233 Ga0068855_100000033
234 Ga0068855_100000248
235 Ga0068855_100098056
236 Ga0068855_101467003
237 Ga0068856_100000014
238 Ga0068856_100030601
239 Ga0068856_100066455
240 Ga0068852_100001225
241 Ga0068866_10010465
242 Ga0068863_100256662
243 Ga0075366_10238270
244 Ga0097621_100000519
245 Ga0068871_100002312
246 Ga0068865_100001253
247 Ga0105240_10025069
248 Ga0105240_10044401
249 Ga0105240_10091218
250 Ga0105240_10561803
251 Ga0105241_10026602
252 Ga0105241_10338012
253 Ga0105242_10018007
254 Ga0105237_10001078
255 Ga0105237_10007732
256 Ga0105237_10010888
257 Ga0105237_10056039
258 Ga0105237_10503452
259 Ga0105238_10020187
260 Ga0105239_10029028
261 Ga0105239_10031643
262 Ga0105239_10060932
263 Ga0157373_10382140
264 Ga0157371_10011265
265 Ga0157370_10000304
266 Ga0157370_10001500
267 Ga0157370_10012933
268 Ga0157370_10666988
269 Ga0157369_10097173
270 Ga0157374_10003557
271 Ga0157374_10488448
272 Ga0157374_10697034
273 Ga0157378_10014946
274 Ga0157378_10050982
275 Ga0163162_10000052
276 Ga0163162_10000163
277 Ga0163162_10356445
278 Ga0157372_10388342
279 Ga0157372_10586947
280 Ga0157372_11407894
281 Ga0157375_10007463
282 Ga0157375_10107231
283 Ga0182008_10000363
284 Ga0182008_10041491
285 Ga0182008_10042744
286 Ga0157376_10328939
287 Ga0182006_1002113
288 Ga0182007_10021732
289 Ga0183373_1001
290 Ga0163161_10000735
291 Ga0163161_10002109
292 Ga0163161_10073626
293 Ga0163161_10466814
294 Ga0213872_10005560
295 Ga0207425_1000002
296 Ga0209026_1000857
297 Ga0209129_1000002
298 Ga0209025_1000004
299 Ga0209758_1000006
300 Ga0207642_10101096
301 Ga0207645_10001637
302 Ga0207705_10179118
303 Ga0207654_10012299
304 Ga0207707_10062914
305 Ga0207695_10019506
306 Ga0207695_10047680
307 Ga0207695_10125123
308 Ga0207671_10005567
309 Ga0207671_10030226
310 Ga0207671_10144491
311 Ga0207671_10328767
312 Ga0207652_10014098
313 Ga0207652_10046942
314 Ga0207694_10014463
315 Ga0207644_10008904
316 Ga0207690_10555936
317 Ga0207686_10004954
318 Ga0207704_10000042
319 Ga0207667_10000046
320 Ga0207667_10001325
321 Ga0207667_11430001
322 Ga0207651_10733604
323 Ga0207677_10129865
324 Ga0207639_10002748
325 Ga0207641_10333879
326 Ga0207648_10024175
327 Ga0207683_10011379
328 Ga0207698_10001535
329 Ga0207698_10101621
330 Ga0307517_10001783
331 Ga0307515_10097064
332 Ga0265338_10019761
333 Ga0265338_10345022
334 Ga0265327_10124056
335 Ga0307405_10000003
336 Ga0307413_10457127
337 Ga0307412_10794146
338 Ga0307414_10006008
339 Ga0307414_10039589
340 Ga0307414_10201798
341 Ga0307414_10293618
342 Ga0307414_10310316
343 Ga0307411_10241151
344 Ga0307510_10000147
345 Ga0395899_0000286
346 Ga0395900_0000285
347 Ga0395900_0002189
348 Ga0395900_0006063
349 Ga0395898_0005006
350 Ga0395898_0040039
351 Ga0395905_0000045
352 Ga0395905_0000765
353 Ga0395901_0001032
354 Ga0395901_0010816
355 Ga0436361_0674393
356 Ga0439455_0072349
357 Ga0466959_0084125
358 Ga0495603_0202526
359 Ga0495629_0007088
360 Ga0495594_0024060
361 Ga0495606_0151724
362 Ga0495610_0012766
363 Ga0495631_0016667
364 Ga0495663_0092239
365 Ga0495666_0118360
366 Ga0495665_0057991
367 Ga0495586_0132199
368 Ga0495586_0358490
369 Ga0495597_0005145
370 Ga0495622_0052162
371 Ga0495625_0304324
372 Ga0495661_0030903
373 Ga0495588_0005597
374 Ga0495588_0043841
375 Ga0495649_0185154
376 Ga0495581_0065853
377 Ga0495581_0109974
378 Ga0495674_0024854
379 Ga0495676_0057913
380 Ga0495676_0368269
381 Ga0495683_0214791
382 Ga0495687_006334
383 Ga0495675_0110252
384 Ga0495593_0033085
385 Ga0495626_0001993
386 Ga0496115_0055449
387 Ga0496115_0061914
388 Ga0496122_0003793
389 Ga0496123_0001711
390 Ga0496125_0015300
391 Ga0501217_240607
392 Ga0501250_034138
393 Ga0501241_003393
394 nmdc:mga0k408_241_c1
395 Ga0500635_0081970
396 Ga0500608_004787
397 Ga0500622_0001648
398 Ga0500634_0054182
399 2586209119
400 2738755510
401 2738851966
402 2739303572
403 2739590846
404 2739616994
405 2739647300
406 2819546501
407 2842725204
408 2842912479
409 2849286012
410 2852629317
411 2857629729
412 2902052529
413 2904446660
414 2910245740
415 2919190410
416 2939668691

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06127

Mpo1-like

2-hydroxy-palmitic acid dioxygenase Mpo1-like

40

195

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dbt-assembly1.cif.gz_Q "e. coli atp synthase imaged in 10mm mgatp state2 ""down" 0.5181 23 130
8dbt-assembly1.cif.gz_Q "e. coli atp synthase imaged in 10mm mgatp state2 ""down" 0.4998 23 130
7t37-assembly1.cif.gz_D activated state of 2-apb and cbd-bound wildtype rat trpv2 in nanodiscs 0.2739 9 154
7p3n-assembly1.cif.gz_K f1fo-atp synthase from acinetobacter baumannii (state 2) 0.2686 23 140
7p3n-assembly1.cif.gz_K f1fo-atp synthase from acinetobacter baumannii (state 2) 0.2629 23 140
ID Description Score Start End Superfamily
af_A0A1D8PUA5_308_511_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3363 12 135 1.20.1250.20
af_A0A0G2L3Z8_323_518_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.32 10 147 1.20.1250.20
af_A4HUF5_30_619_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3135 22 146 1.20.1250.20
af_Q01082_1064_1163_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.2929 39 136 1.20.58.60
af_P0AAU5_1_108_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2835 31 137 1.20.1070.10
ID Description Score Start End GO Terms
AF-R9GMN1-F1-model_v4 DUF962 domain-containing protein 0.9635 1 167 GO:0016020
AF-R9GMN1-F1-model_v4 DUF962 domain-containing protein 0.9579 1 167 GO:0016020
AF-A0A5P9CPM5-F1-model_v4 PRS2 protein 0.9549 10 156 GO:0016020
GO:0046521
AF-H1Y0F9-F1-model_v4 DUF962 domain-containing protein 0.952 1 167 GO:0016020
GO:0046521
AF-A0A120MZ91-F1-model_v4 Putative membrane protein YGL010W 0.9489 3 167 GO:0016020
GO:0046521

Map