F317536

General Info

Members Datasets Scaffolds Average Seq Length
208 128 208 213

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100033379|Ga0070665_1000333797
Length 232
Sequence MKRLITILSRHGRFYIALACGLATVLAARLMGFDAPVLAGGVMFYLVFLLLCLVMIGGQKTADLKKRAKNQDEGITIVLLITLATMAFFCDAVFTALHDKHGIEVAPLALAGIGAVSGWLVLHTVMAFHYANVHYFDDPDCATDDKDLDFPGRGDPGPWDFLYYSFVVGMTAQVSDVQVRTTVMRRLTLLHGVVSFFFNTVFIAMAVNAADFGVLTYLLAGGQGTKALTRRL

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
121 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
122 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
123 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
124 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
125 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
126 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
127 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.21
Nodule 0
Rhizoplane 0
Rhizosphere 91.35
Stem 0
Stem Tuber 0
Unclassified 1.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000003 3300003214 Bacteria 694080
2 JGI25153J46596_10002828 3300003215 Bacteria 9864
3 Ga0070658_10150475 3300005327 Bacteria 1948
4 Ga0070658_10442778 3300005327 Bacteria 1119
5 Ga0070683_100136313 3300005329 Bacteria 2325
6 Ga0068869_100205747 3300005334 Bacteria 1554
7 Ga0070680_100073739 3300005336 Bacteria 2808
8 Ga0070680_100664426 3300005336 Bacteria 896
9 Ga0068868_100017139 3300005338 Bacteria 5391
10 Ga0068868_100340822 3300005338 Bacteria 1282
11 Ga0070660_100149341 3300005339 Bacteria 1878
12 Ga0070661_100139093 3300005344 Bacteria 1829
13 Ga0070661_100524327 3300005344 Bacteria 951
14 Ga0070675_100029664 3300005354 Bacteria 4413
15 Ga0070675_100034096 3300005354 Bacteria 4130
16 Ga0070674_100470900 3300005356 Bacteria 1041
17 Ga0070673_100034845 3300005364 Bacteria 3814
18 Ga0070659_100479535 3300005366 Bacteria 1058
19 Ga0070659_100912109 3300005366 Unclassified 768
20 Ga0070667_100073281 3300005367 Bacteria 2919
21 Ga0070711_100318355 3300005439 Bacteria 1242
22 Ga0070678_100233282 3300005456 Bacteria 1535
23 Ga0070678_100558568 3300005456 Bacteria 1017
24 Ga0070678_100833564 3300005456 Unclassified 839
25 Ga0068867_100007198 3300005459 Bacteria 7864
26 Ga0070679_100016459 3300005530 Bacteria 7133
27 Ga0070679_100072040 3300005530 Bacteria 3447
28 Ga0070684_100360614 3300005535 Bacteria 1338
29 Ga0068853_100227846 3300005539 Bacteria 1704
30 Ga0068853_100316653 3300005539 Bacteria 1445
31 Ga0070672_100854846 3300005543 Unclassified 802
32 Ga0070693_100505277 3300005547 Bacteria 858
33 Ga0070665_100001163 3300005548 Bacteria 32337
34 Ga0070665_100033379 3300005548 Bacteria 5178
35 Ga0068855_100218359 3300005563 Bacteria 2139
36 Ga0068855_100588144 3300005563 Unclassified 1201
37 Ga0068855_100880209 3300005563 Bacteria 947
38 Ga0068855_101371513 3300005563 Bacteria 729
39 Ga0068857_100040495 3300005577 Bacteria 4131
40 Ga0068857_100145587 3300005577 Bacteria 2144
41 Ga0068857_100398221 3300005577 Bacteria 1281
42 Ga0068852_100721488 3300005616 Bacteria 1008
43 Ga0068852_100951474 3300005616 Bacteria 877
44 Ga0068859_100814717 3300005617 Bacteria 1021
45 Ga0068864_100568643 3300005618 Bacteria 1097
46 Ga0068870_10025015 3300005840 Bacteria 2961
47 Ga0068870_10132909 3300005840 Bacteria 1448
48 Ga0068863_100672258 3300005841 Bacteria 1028
49 Ga0068860_100226950 3300005843 Bacteria 1814
50 Ga0070717_10582925 3300006028 Unclassified 1014
51 Ga0097621_100000295 3300006237 Bacteria 33699
52 Ga0097621_100011768 3300006237 Bacteria 6461
53 Ga0097621_100437142 3300006237 Bacteria 1177
54 Ga0097621_100441630 3300006237 Bacteria 1171
55 Ga0097621_100560821 3300006237 Unclassified 1040
56 Ga0068871_100000019 3300006358 Bacteria 86487
57 Ga0068871_100011954 3300006358 Bacteria 6390
58 Ga0068871_100057582 3300006358 Bacteria 3162
59 Ga0068871_100067691 3300006358 Bacteria 2931
60 Ga0068871_100103301 3300006358 Bacteria 2389
61 Ga0068871_100905949 3300006358 Bacteria 817
62 Ga0097620_100814688 3300006931 Bacteria 1021
63 Ga0105240_10079098 3300009093 Bacteria 4047
64 Ga0105240_10128041 3300009093 Bacteria 3048
65 Ga0105240_10215617 3300009093 Bacteria 2240
66 Ga0105240_10550006 3300009093 Bacteria 1277
67 Ga0105245_10101327 3300009098 Bacteria 2665
68 Ga0105245_10141526 3300009098 Bacteria 2266
69 Ga0105243_10003401 3300009148 Bacteria 12905
70 Ga0105243_10688072 3300009148 Unclassified 995
71 Ga0105241_10020640 3300009174 Bacteria 4867
72 Ga0105241_10110371 3300009174 Bacteria 2200
73 Ga0105242_10065737 3300009176 Bacteria 2992
74 Ga0105242_10367082 3300009176 Bacteria 1334
75 Ga0105248_10633361 3300009177 Bacteria 1206
76 Ga0105237_10084403 3300009545 Bacteria 3166
77 Ga0105237_10410778 3300009545 Bacteria 1359
78 Ga0105238_10033816 3300009551 Bacteria 5202
79 Ga0105238_10073323 3300009551 Bacteria 3418
80 Ga0105238_10198039 3300009551 Bacteria 1984
81 Ga0105239_10137783 3300010375 Bacteria 2717
82 Ga0105239_10292578 3300010375 Bacteria 1834
83 Ga0105246_10265280 3300011119 Bacteria 1370
84 Ga0157373_10405277 3300013100 Unclassified 978
85 Ga0157371_10789768 3300013102 Bacteria 715
86 Ga0157370_10246801 3300013104 Bacteria 1651
87 Ga0157370_10407266 3300013104 Bacteria 1251
88 Ga0157369_10158359 3300013105 Bacteria 2391
89 Ga0157369_10552109 3300013105 Bacteria 1191
90 Ga0157374_10609982 3300013296 Unclassified 1102
91 Ga0157378_10066632 3300013297 Bacteria 3225
92 Ga0163162_10926414 3300013306 Unclassified 983
93 Ga0157375_10557608 3300013308 Bacteria 1307
94 Ga0157375_10750636 3300013308 Bacteria 1127
95 Ga0163163_10000002 3300014325 Bacteria 609846
96 Ga0163163_10042824 3300014325 Bacteria 4436
97 Ga0157377_10181422 3300014745 Unclassified 1324
98 Ga0157379_10103447 3300014968 Bacteria 2556
99 Ga0157376_10517239 3300014969 Unclassified 1176
100 Ga0209233_1000015 3300025261 Bacteria 980563
101 Ga0209233_1019711 3300025261 Bacteria 1786
102 Ga0209233_1033754 3300025261 Bacteria 1172
103 Ga0209455_1010399 3300025272 Bacteria 2367
104 Ga0209758_1000013 3300025297 Bacteria 873003
105 Ga0207642_10471346 3300025899 Unclassified 764
106 Ga0207705_10012253 3300025909 Bacteria 6196
107 Ga0207654_10098858 3300025911 Bacteria 1794
108 Ga0207695_10148331 3300025913 Bacteria 2287
109 Ga0207695_10369727 3300025913 Bacteria 1320
110 Ga0207695_10685544 3300025913 Unclassified 905
111 Ga0207660_10044018 3300025917 Bacteria 3139
112 Ga0207657_10006998 3300025919 Bacteria 11612
113 Ga0207657_10026171 3300025919 Bacteria 5366
114 Ga0207649_10440628 3300025920 Bacteria 981
115 Ga0207652_10010820 3300025921 Bacteria 7350
116 Ga0207652_10223388 3300025921 Bacteria 1697
117 Ga0207694_10084950 3300025924 Bacteria 2490
118 Ga0207694_10127434 3300025924 Bacteria 2038
119 Ga0207694_10239989 3300025924 Bacteria 1481
120 Ga0207659_10117885 3300025926 Bacteria 2030
121 Ga0207659_10522474 3300025926 Bacteria 1007
122 Ga0207687_10040843 3300025927 Bacteria 3182
123 Ga0207687_10375194 3300025927 Bacteria 1164
124 Ga0207687_10545236 3300025927 Bacteria 972
125 Ga0207686_10094913 3300025934 Bacteria 1978
126 Ga0207686_10379521 3300025934 Bacteria 1071
127 Ga0207686_10465304 3300025934 Bacteria 975
128 Ga0207709_10410404 3300025935 Bacteria 1038
129 Ga0207669_10355009 3300025937 Bacteria 1134
130 Ga0207704_10092807 3300025938 Bacteria 1988
131 Ga0207691_11040384 3300025940 Unclassified 682
132 Ga0207689_10015230 3300025942 Bacteria 6510
133 Ga0207689_10646001 3300025942 Bacteria 891
134 Ga0207667_10248074 3300025949 Bacteria 1821
135 Ga0207651_10310139 3300025960 Bacteria 1315
136 Ga0207712_10278089 3300025961 Bacteria 1365
137 Ga0207658_10473911 3300025986 Bacteria 1111
138 Ga0207677_10016350 3300026023 Bacteria 4391
139 Ga0207677_10563391 3300026023 Unclassified 995
140 Ga0207702_10559821 3300026078 Unclassified 1119
141 Ga0207641_10901056 3300026088 Bacteria 878
142 Ga0207648_10005978 3300026089 Bacteria 12168
143 Ga0207676_10208724 3300026095 Bacteria 1731
144 Ga0207674_10061324 3300026116 Bacteria 3800
145 Ga0207683_10238969 3300026121 Bacteria 1657
146 Ga0268266_10009463 3300028379 Bacteria 8577
147 Ga0265318_10009540 3300028577 Bacteria 4261
148 Ga0265338_10042184 3300028800 Bacteria 4254
149 Ga0265330_10219374 3300031235 Unclassified 803
150 Ga0265325_10036781 3300031241 Bacteria 2592
151 Ga0265329_10052578 3300031242 Bacteria 1296
152 Ga0265331_10076204 3300031250 Unclassified 1563
153 Ga0307513_10126427 3300031456 Bacteria 2511
154 Ga0265313_10008669 3300031595 Bacteria 6724
155 Ga0265313_10013367 3300031595 Bacteria 4931
156 Ga0265314_10078560 3300031711 Bacteria 2185
157 Ga0265314_10142056 3300031711 Bacteria 1483
158 Ga0265314_10203741 3300031711 Bacteria 1167
159 Ga0373953_0148741 3300035117 Bacteria 1003
160 Ga0373933_0121044 3300035724 Bacteria 1639
161 Ga0373937_0090749 3300036401 Bacteria 2830
162 Ga0373937_0164194 3300036401 Bacteria 2082
163 Ga0395900_0066882 3300037418 Bacteria 3693
164 Ga0395901_0137258 3300038443 Bacteria 2570
165 Ga0436365_0862915 3300039437 Bacteria 5399
166 Ga0466963_0199964 3300044694 Bacteria 1398
167 Ga0495622_0006576 3300046557 Bacteria 5389
168 Ga0495657_0268937 3300046675 Bacteria 1022
169 Ga0496121_0002872 3300048924 Bacteria 25387
170 Ga0501033_0061149 3300049570 Bacteria 2776
171 Ga0501033_0066319 3300049570 Bacteria 2654
172 Ga0501033_0069193 3300049570 Bacteria 2595
173 Ga0501033_0150640 3300049570 Bacteria 1678
174 Ga0501033_0258342 3300049570 Bacteria 1233
175 Ga0501034_0850719 3300049571 Bacteria 802
176 Ga0501038_0076462 3300049574 Bacteria 2828
177 Ga0501038_0263874 3300049574 Bacteria 1360
178 Ga0501043_0072655 3300049579 Bacteria 2702
179 Ga0501043_0442735 3300049579 Bacteria 977
180 Ga0501046_0010212 3300049580 Bacteria 8079
181 Ga0501046_0207816 3300049580 Bacteria 1454
182 Ga0501047_0009386 3300049581 Bacteria 9240
183 Ga0501047_0106747 3300049581 Bacteria 2681
184 Ga0501047_0226812 3300049581 Bacteria 1723
185 Ga0501047_0473560 3300049581 Bacteria 1080
186 Ga0501073_0051163 3300049589 Bacteria 2894
187 Ga0501080_0172272 3300049742 Bacteria 1996
188 Ga0501080_0517113 3300049742 Bacteria 1065
189 Ga0501080_0871574 3300049742 Unclassified 786
190 Ga0501083_0028256 3300049744 Bacteria 3867
191 Ga0501035_0014499 3300049822 Bacteria 7275
192 Ga0501035_0068322 3300049822 Bacteria 3151
193 Ga0501035_0100897 3300049822 Bacteria 2533
194 Ga0501044_0003917 3300049823 Bacteria 16687
195 Ga0501044_0096071 3300049823 Bacteria 2986
196 Ga0501044_0147439 3300049823 Bacteria 2337
197 Ga0501044_0382970 3300049823 Bacteria 1321
198 Ga0501044_0704639 3300049823 Bacteria 895
199 Ga0495595_0097532 3300053084 Bacteria 1416
200 Ga0500643_000003 3300053087 Bacteria 876659
201 Ga0500646_0027021 3300053090 Bacteria 1559
202 Ga0500595_000259 3300053119 Bacteria 35037
203 Ga0500595_012451 3300053119 Bacteria 3291
204 Ga0500573_0000002 3300053140 Bacteria 407088
205 Ga0500639_122424 3300053163 Bacteria 1247
206 Ga0500611_043450 3300053727 Bacteria 998
207 Ga0500645_019741 3300053730 Bacteria 2094
208 Ga0501082_0375615 3300060353 Bacteria 1240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005439 Ga0070711_100318355 Ga0070711_1003183552 189
2 3300036401 Ga0373937_0090749 Ga0373937_0090749_988_1656 190
3 3300049579 Ga0501043_0442735 Ga0501043_0442735_252_878 195
4 3300049822 Ga0501035_0100897 Ga0501035_0100897_1626_2252 195
5 3300005617 Ga0068859_100814717 Ga0068859_1008147172 196
6 3300006931 Ga0097620_100814688 Ga0097620_1008146882 196
7 3300014325 Ga0163163_10000002 Ga0163163_10000002378 196
8 3300028800 Ga0265338_10042184 Ga0265338_100421843 198
9 3300031250 Ga0265331_10076204 Ga0265331_100762042 198
10 3300031711 Ga0265314_10078560 Ga0265314_100785602 198
11 3300049742 Ga0501080_0871574 Ga0501080_0871574_102_743 201
12 3300005456 Ga0070678_100233282 Ga0070678_1002332822 202
13 3300031235 Ga0265330_10219374 Ga0265330_102193741 205
14 3300031241 Ga0265325_10036781 Ga0265325_100367813 205
15 3300031595 Ga0265313_10013367 Ga0265313_100133676 205
16 3300031711 Ga0265314_10142056 Ga0265314_101420562 205
17 3300005366 Ga0070659_100479535 Ga0070659_1004795351 206
18 3300013102 Ga0157371_10789768 Ga0157371_107897681 206
19 3300039437 Ga0436365_0862915 Ga0436365_0862915_1821_2450 206
20 3300005327 Ga0070658_10150475 Ga0070658_101504752 207
21 3300005336 Ga0070680_100073739 Ga0070680_1000737392 207
22 3300005339 Ga0070660_100149341 Ga0070660_1001493412 207
23 3300005344 Ga0070661_100139093 Ga0070661_1001390931 207
24 3300005530 Ga0070679_100072040 Ga0070679_1000720403 207
25 3300005548 Ga0070665_100001163 Ga0070665_1000011637 207
26 3300009093 Ga0105240_10215617 Ga0105240_102156173 207
27 3300025909 Ga0207705_10012253 Ga0207705_100122537 207
28 3300025913 Ga0207695_10148331 Ga0207695_101483313 207
29 3300025917 Ga0207660_10044018 Ga0207660_100440182 207
30 3300025919 Ga0207657_10026171 Ga0207657_100261714 207
31 3300025920 Ga0207649_10440628 Ga0207649_104406282 207
32 3300025921 Ga0207652_10010820 Ga0207652_1001082010 207
33 3300028379 Ga0268266_10009463 Ga0268266_100094637 207
34 3300049570 Ga0501033_0061149 Ga0501033_0061149_1395_2018 207
35 3300049742 Ga0501080_0172272 Ga0501080_0172272_1065_1688 207
36 3300049822 Ga0501035_0068322 Ga0501035_0068322_414_1037 207
37 3300049823 Ga0501044_0382970 Ga0501044_0382970_162_785 207
38 3300049570 Ga0501033_0150640 Ga0501033_0150640_139_765 208
39 3300049570 Ga0501033_0258342 Ga0501033_0258342_151_777 208
40 3300049574 Ga0501038_0076462 Ga0501038_0076462_174_800 208
41 3300049574 Ga0501038_0263874 Ga0501038_0263874_246_872 208
42 3300049581 Ga0501047_0473560 Ga0501047_0473560_388_1014 208
43 3300049822 Ga0501035_0014499 Ga0501035_0014499_1043_1669 208
44 3300049823 Ga0501044_0096071 Ga0501044_0096071_930_1556 208
45 3300025899 Ga0207642_10471346 Ga0207642_104713461 209
46 3300048924 Ga0496121_0002872 Ga0496121_0002872_3604_4233 209
47 3300009148 Ga0105243_10688072 Ga0105243_106880722 210
48 3300009174 Ga0105241_10110371 Ga0105241_101103714 210
49 3300013306 Ga0163162_10926414 Ga0163162_109264142 210
50 3300049744 Ga0501083_0028256 Ga0501083_0028256_453_1085 210
51 3300060353 Ga0501082_0375615 Ga0501082_0375615_523_1155 210
52 3300009098 Ga0105245_10101327 Ga0105245_101013272 211
53 3300025261 Ga0209233_1033754 Ga0209233_10337542 211
54 3300025927 Ga0207687_10040843 Ga0207687_100408433 211
55 3300028577 Ga0265318_10009540 Ga0265318_100095404 211
56 3300031242 Ga0265329_10052578 Ga0265329_100525782 211
57 3300031595 Ga0265313_10008669 Ga0265313_100086696 211
58 3300031711 Ga0265314_10203741 Ga0265314_102037412 211
59 3300049571 Ga0501034_0850719 Ga0501034_0850719_32_667 211
60 3300049580 Ga0501046_0010212 Ga0501046_0010212_2167_2802 211
61 3300049581 Ga0501047_0009386 Ga0501047_0009386_4438_5073 211
62 3300049742 Ga0501080_0517113 Ga0501080_0517113_208_843 211
63 3300049823 Ga0501044_0147439 Ga0501044_0147439_364_999 211
64 3300003215 JGI25153J46596_10002828 JGI25153J46596_100028288 212
65 3300005563 Ga0068855_100880209 Ga0068855_1008802092 212
66 3300005577 Ga0068857_100398221 Ga0068857_1003982212 212
67 3300025272 Ga0209455_1010399 Ga0209455_10103992 212
68 3300025297 Ga0209758_1000013 Ga0209758_1000013729 212
69 3300053087 Ga0500643_000003 Ga0500643_000003_385365_386003 212
70 3300053090 Ga0500646_0027021 Ga0500646_0027021_842_1480 212
71 3300053119 Ga0500595_000259 Ga0500595_000259_2609_3250 212
72 3300053727 Ga0500611_043450 Ga0500611_043450_315_953 212
73 3300035117 Ga0373953_0148741 Ga0373953_0148741_139_807 213
74 3300035724 Ga0373933_0121044 Ga0373933_0121044_95_763 213
75 3300036401 Ga0373937_0164194 Ga0373937_0164194_670_1338 213
76 3300046675 Ga0495657_0268937 Ga0495657_0268937_72_740 213
77 3300049580 Ga0501046_0207816 Ga0501046_0207816_478_1119 213
78 3300049823 Ga0501044_0704639 Ga0501044_0704639_204_845 213
79 3300053084 Ga0495595_0097532 Ga0495595_0097532_725_1393 213
80 3300049570 Ga0501033_0069193 Ga0501033_0069193_140_784 214
81 3300003214 JGI25165J46597_1000003 JGI25165J46597_1000003530 215
82 3300005327 Ga0070658_10442778 Ga0070658_104427781 215
83 3300005329 Ga0070683_100136313 Ga0070683_1001363133 215
84 3300005334 Ga0068869_100205747 Ga0068869_1002057471 215
85 3300005336 Ga0070680_100664426 Ga0070680_1006644261 215
86 3300005338 Ga0068868_100017139 Ga0068868_1000171396 215
87 3300005338 Ga0068868_100340822 Ga0068868_1003408221 215
88 3300005344 Ga0070661_100524327 Ga0070661_1005243271 215
89 3300005354 Ga0070675_100029664 Ga0070675_1000296641 215
90 3300005354 Ga0070675_100034096 Ga0070675_1000340962 215
91 3300005356 Ga0070674_100470900 Ga0070674_1004709002 215
92 3300005364 Ga0070673_100034845 Ga0070673_1000348452 215
93 3300005366 Ga0070659_100912109 Ga0070659_1009121091 215
94 3300005367 Ga0070667_100073281 Ga0070667_1000732813 215
95 3300005456 Ga0070678_100558568 Ga0070678_1005585681 215
96 3300005456 Ga0070678_100833564 Ga0070678_1008335641 215
97 3300005459 Ga0068867_100007198 Ga0068867_1000071989 215
98 3300005530 Ga0070679_100016459 Ga0070679_1000164597 215
99 3300005535 Ga0070684_100360614 Ga0070684_1003606142 215
100 3300005539 Ga0068853_100227846 Ga0068853_1002278462 215
101 3300005539 Ga0068853_100316653 Ga0068853_1003166532 215
102 3300005543 Ga0070672_100854846 Ga0070672_1008548462 215
103 3300005547 Ga0070693_100505277 Ga0070693_1005052772 215
104 3300005548 Ga0070665_100033379 Ga0070665_1000333797 215
105 3300005563 Ga0068855_100218359 Ga0068855_1002183592 215
106 3300005563 Ga0068855_100588144 Ga0068855_1005881442 215
107 3300005563 Ga0068855_101371513 Ga0068855_1013715131 215
108 3300005577 Ga0068857_100040495 Ga0068857_1000404954 215
109 3300005577 Ga0068857_100145587 Ga0068857_1001455873 215
110 3300005616 Ga0068852_100721488 Ga0068852_1007214882 215
111 3300005616 Ga0068852_100951474 Ga0068852_1009514741 215
112 3300005618 Ga0068864_100568643 Ga0068864_1005686432 215
113 3300005840 Ga0068870_10025015 Ga0068870_100250154 215
114 3300005840 Ga0068870_10132909 Ga0068870_101329092 215
115 3300005841 Ga0068863_100672258 Ga0068863_1006722582 215
116 3300005843 Ga0068860_100226950 Ga0068860_1002269503 215
117 3300006028 Ga0070717_10582925 Ga0070717_105829251 215
118 3300006237 Ga0097621_100000295 Ga0097621_1000002952 215
119 3300006237 Ga0097621_100011768 Ga0097621_1000117685 215
120 3300006237 Ga0097621_100437142 Ga0097621_1004371422 215
121 3300006237 Ga0097621_100441630 Ga0097621_1004416302 215
122 3300006237 Ga0097621_100560821 Ga0097621_1005608212 215
123 3300006358 Ga0068871_100000019 Ga0068871_10000001939 215
124 3300006358 Ga0068871_100011954 Ga0068871_1000119547 215
125 3300006358 Ga0068871_100057582 Ga0068871_1000575822 215
126 3300006358 Ga0068871_100067691 Ga0068871_1000676912 215
127 3300006358 Ga0068871_100103301 Ga0068871_1001033012 215
128 3300006358 Ga0068871_100905949 Ga0068871_1009059492 215
129 3300009093 Ga0105240_10079098 Ga0105240_100790985 215
130 3300009093 Ga0105240_10128041 Ga0105240_101280411 215
131 3300009093 Ga0105240_10550006 Ga0105240_105500062 215
132 3300009098 Ga0105245_10141526 Ga0105245_101415263 215
133 3300009148 Ga0105243_10003401 Ga0105243_100034019 215
134 3300009174 Ga0105241_10020640 Ga0105241_100206404 215
135 3300009176 Ga0105242_10065737 Ga0105242_100657373 215
136 3300009176 Ga0105242_10367082 Ga0105242_103670822 215
137 3300009177 Ga0105248_10633361 Ga0105248_106333611 215
138 3300009545 Ga0105237_10084403 Ga0105237_100844033 215
139 3300009545 Ga0105237_10410778 Ga0105237_104107782 215
140 3300009551 Ga0105238_10033816 Ga0105238_100338163 215
141 3300009551 Ga0105238_10073323 Ga0105238_100733234 215
142 3300009551 Ga0105238_10198039 Ga0105238_101980392 215
143 3300010375 Ga0105239_10137783 Ga0105239_101377833 215
144 3300010375 Ga0105239_10292578 Ga0105239_102925782 215
145 3300011119 Ga0105246_10265280 Ga0105246_102652802 215
146 3300013100 Ga0157373_10405277 Ga0157373_104052771 215
147 3300013104 Ga0157370_10246801 Ga0157370_102468012 215
148 3300013104 Ga0157370_10407266 Ga0157370_104072662 215
149 3300013105 Ga0157369_10158359 Ga0157369_101583593 215
150 3300013105 Ga0157369_10552109 Ga0157369_105521092 215
151 3300013296 Ga0157374_10609982 Ga0157374_106099823 215
152 3300013297 Ga0157378_10066632 Ga0157378_100666325 215
153 3300013308 Ga0157375_10557608 Ga0157375_105576081 215
154 3300013308 Ga0157375_10750636 Ga0157375_107506362 215
155 3300014325 Ga0163163_10042824 Ga0163163_100428245 215
156 3300014745 Ga0157377_10181422 Ga0157377_101814222 215
157 3300014968 Ga0157379_10103447 Ga0157379_101034472 215
158 3300014969 Ga0157376_10517239 Ga0157376_105172391 215
159 3300025261 Ga0209233_1000015 Ga0209233_1000015254 215
160 3300025261 Ga0209233_1019711 Ga0209233_10197112 215
161 3300025911 Ga0207654_10098858 Ga0207654_100988582 215
162 3300025913 Ga0207695_10369727 Ga0207695_103697271 215
163 3300025913 Ga0207695_10685544 Ga0207695_106855442 215
164 3300025919 Ga0207657_10006998 Ga0207657_1000699811 215
165 3300025921 Ga0207652_10223388 Ga0207652_102233882 215
166 3300025924 Ga0207694_10084950 Ga0207694_100849503 215
167 3300025924 Ga0207694_10127434 Ga0207694_101274342 215
168 3300025924 Ga0207694_10239989 Ga0207694_102399892 215
169 3300025926 Ga0207659_10117885 Ga0207659_101178852 215
170 3300025926 Ga0207659_10522474 Ga0207659_105224742 215
171 3300025927 Ga0207687_10375194 Ga0207687_103751942 215
172 3300025927 Ga0207687_10545236 Ga0207687_105452361 215
173 3300025934 Ga0207686_10094913 Ga0207686_100949131 215
174 3300025934 Ga0207686_10379521 Ga0207686_103795212 215
175 3300025934 Ga0207686_10465304 Ga0207686_104653042 215
176 3300025935 Ga0207709_10410404 Ga0207709_104104042 215
177 3300025937 Ga0207669_10355009 Ga0207669_103550092 215
178 3300025938 Ga0207704_10092807 Ga0207704_100928073 215
179 3300025940 Ga0207691_11040384 Ga0207691_110403841 215
180 3300025942 Ga0207689_10015230 Ga0207689_100152304 215
181 3300025942 Ga0207689_10646001 Ga0207689_106460012 215
182 3300025949 Ga0207667_10248074 Ga0207667_102480742 215
183 3300025960 Ga0207651_10310139 Ga0207651_103101392 215
184 3300025961 Ga0207712_10278089 Ga0207712_102780891 215
185 3300025986 Ga0207658_10473911 Ga0207658_104739112 215
186 3300026023 Ga0207677_10016350 Ga0207677_100163505 215
187 3300026023 Ga0207677_10563391 Ga0207677_105633912 215
188 3300026078 Ga0207702_10559821 Ga0207702_105598212 215
189 3300026088 Ga0207641_10901056 Ga0207641_109010561 215
190 3300026089 Ga0207648_10005978 Ga0207648_100059786 215
191 3300026095 Ga0207676_10208724 Ga0207676_102087243 215
192 3300026116 Ga0207674_10061324 Ga0207674_100613243 215
193 3300026121 Ga0207683_10238969 Ga0207683_102389691 215
194 3300031456 Ga0307513_10126427 Ga0307513_101264272 215
195 3300037418 Ga0395900_0066882 Ga0395900_0066882_1350_2000 215
196 3300038443 Ga0395901_0137258 Ga0395901_0137258_1264_1914 215
197 3300044694 Ga0466963_0199964 Ga0466963_0199964_34_684 215
198 3300046557 Ga0495622_0006576 Ga0495622_0006576_3229_3876 215
199 3300049570 Ga0501033_0066319 Ga0501033_0066319_451_1098 215
200 3300049579 Ga0501043_0072655 Ga0501043_0072655_1934_2581 215
201 3300049581 Ga0501047_0106747 Ga0501047_0106747_1382_2029 215
202 3300049581 Ga0501047_0226812 Ga0501047_0226812_848_1501 215
203 3300049589 Ga0501073_0051163 Ga0501073_0051163_224_874 215
204 3300049823 Ga0501044_0003917 Ga0501044_0003917_7817_8464 215
205 3300053119 Ga0500595_012451 Ga0500595_012451_1136_1783 215
206 3300053140 Ga0500573_0000002 Ga0500573_0000002_334824_335474 215
207 3300053163 Ga0500639_122424 Ga0500639_122424_584_1237 215
208 3300053730 Ga0500645_019741 Ga0500645_019741_79_726 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07077

DUF1345

Protein of unknown function (DUF1345)

34

205

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vou-assembly1.cif.gz_A-2 the crystal structure of nak-navsulp chimera channel 0.8142 155 207
7n9k-assembly1.cif.gz_A kirbac3.1 l124m mutant 0.7374 89 209
6o9t-assembly1.cif.gz_A kirbac3.1 mutant at a resolution of 4.1 angstroms 0.7305 89 209
6o9u-assembly1.cif.gz_A kirbac3.1 at a resolution of 2 angstroms 0.7208 89 209
7n9l-assembly1.cif.gz_A kirbac3.1 c71s c262s 0.7182 89 206
ID Description Score Start End Superfamily
3vouA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8142 155 207 1.10.287.70
2wlkA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7706 108 205 1.10.287.70
af_I1JJJ2_64_158_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7534 106 211 1.10.287.70
af_Q8LIN5_63_157_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7533 116 211 1.10.287.70
af_C4J1B8_73_187_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7405 111 211 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A7V9S8D8-F1-model_v4 DUF1345 domain-containing protein 0.9224 1 215 GO:0016020
AF-A0A554UAZ8-F1-model_v4 deleted 0.9211 3 215
AF-A0A258VIM1-F1-model_v4 deleted 0.9108 8 215
AF-A0A554UAZ8-F1-model_v4 deleted 0.9089 3 215
AF-A0A5C5T9T6-F1-model_v4 DUF1345 domain-containing protein 0.9013 10 215 GO:0016020

Feature Viewer

pLDDT pTM Quality
87.7 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map