F317523

General Info

Members Datasets Scaffolds Average Seq Length
208 144 209 218

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100052564|Ga0070684_1000525647
Length 246
Sequence MRLYRYESVPQLIPLSINVEHFCVSAKIEYMEVDKNAKIIWDFLQMNMPLQKADAIFVLCSHDTRVAERALELYDEGYAPWIIVSGGAGKLTENLLNKPEAEIFKDILVKGGVPEAKIIVEPDSTNTGENVRFTFDLLNSSGIIFNSFILVQKPYMERRTYATFKKQWPRPETKILVTSPRLSYEEYINNAVLDKDLIINVMVGDLQRIREYPKKGFQIEQDIPDDVWHAYETLIAAGYTKHLLQS

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
127 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
128 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
140 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
141 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
142 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
143 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
144 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.02
Nodule 0
Rhizoplane 2.88
Rhizosphere 82.69
Stem 0
Stem Tuber 0
Unclassified 2.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_7309267 2162886011 Bacteria 1393
2 rootH1_10010855 3300003316 Bacteria 76739
3 rootH1_10010855 3300003323 Bacteria 16450
4 rootH1_10280559 3300003323 Bacteria 5301
5 Ga0065704_10077373 3300005289 Unclassified 4750
6 Ga0065712_10011940 3300005290 Bacteria 2360
7 Ga0065712_10074866 3300005290 Bacteria 3991
8 Ga0065715_10006846 3300005293 Bacteria 4540
9 Ga0065715_10394524 3300005293 Bacteria 890
10 Ga0065707_10128228 3300005295 Unclassified 1969
11 Ga0070683_100002122 3300005329 Bacteria 15653
12 Ga0070683_100060101 3300005329 Bacteria 3531
13 Ga0070683_100120214 3300005329 Bacteria 2481
14 Ga0070670_100009157 3300005331 Bacteria 8463
15 Ga0070670_100134383 3300005331 Bacteria 2137
16 Ga0070682_100033972 3300005337 Bacteria 3102
17 Ga0070689_100183409 3300005340 Unclassified 1701
18 Ga0070689_100256455 3300005340 Bacteria 1444
19 Ga0070689_100616184 3300005340 Bacteria 941
20 Ga0070691_10269415 3300005341 Bacteria 920
21 Ga0070661_100011813 3300005344 Bacteria 6093
22 Ga0070692_10202272 3300005345 Bacteria 1164
23 Ga0070669_100001950 3300005353 Bacteria 14896
24 Ga0070669_100247404 3300005353 Bacteria 1419
25 Ga0070675_100003146 3300005354 Bacteria 12490
26 Ga0070675_100032892 3300005354 Bacteria 4200
27 Ga0070674_100022950 3300005356 Bacteria 4028
28 Ga0070673_100100937 3300005364 Bacteria 2376
29 Ga0070688_100100712 3300005365 Bacteria 1904
30 Ga0070667_100055416 3300005367 Bacteria 3348
31 Ga0070667_100922371 3300005367 Bacteria 813
32 Ga0070701_10262758 3300005438 Bacteria 1047
33 Ga0070700_100132415 3300005441 Bacteria 1684
34 Ga0070700_100162316 3300005441 Bacteria 1539
35 Ga0070694_100100199 3300005444 Bacteria 2048
36 Ga0070663_100022773 3300005455 Bacteria 4192
37 Ga0070678_100858907 3300005456 Bacteria 827
38 Ga0070678_100990379 3300005456 Unclassified 772
39 Ga0068867_100200992 3300005459 Bacteria 1595
40 Ga0070706_100703603 3300005467 Bacteria 937
41 Ga0070698_100025554 3300005471 Bacteria 6156
42 Ga0070699_100001248 3300005518 Bacteria 23443
43 Ga0070699_100339410 3300005518 Bacteria 1352
44 Ga0070679_100041675 3300005530 Bacteria 4570
45 Ga0070684_100000667 3300005535 Bacteria 23730
46 Ga0070684_100052564 3300005535 Bacteria 3544
47 Ga0070684_100102152 3300005535 Bacteria 2563
48 Ga0070672_100246729 3300005543 Bacteria 1503
49 Ga0070696_100030075 3300005546 Unclassified 3716
50 Ga0070693_100294689 3300005547 Bacteria 1091
51 Ga0070665_100614837 3300005548 Bacteria 1100
52 Ga0070704_100151176 3300005549 Unclassified 1825
53 Ga0070704_100810114 3300005549 Bacteria 837
54 Ga0070664_100003674 3300005564 Bacteria 12364
55 Ga0070664_100165772 3300005564 Bacteria 1958
56 Ga0068857_100009278 3300005577 Bacteria 8537
57 Ga0068854_100093659 3300005578 Bacteria 2239
58 Ga0070702_100001417 3300005615 Bacteria 9798
59 Ga0068852_101022847 3300005616 Bacteria 845
60 Ga0068852_101060497 3300005616 Bacteria 830
61 Ga0068859_100001069 3300005617 Bacteria 28045
62 Ga0068864_100190825 3300005618 Bacteria 1878
63 Ga0068861_100677690 3300005719 Bacteria 955
64 Ga0081540_1156232 3300005983 Unclassified 892
65 Ga0075365_10000008 3300006038 Bacteria 114620
66 Ga0075365_10030612 3300006038 Bacteria 3449
67 Ga0075365_10107554 3300006038 Bacteria 1915
68 Ga0075364_10005119 3300006051 Bacteria 7599
69 Ga0075364_10010227 3300006051 Bacteria 5660
70 Ga0075364_10018918 3300006051 Bacteria 4319
71 Ga0075432_10019389 3300006058 Bacteria 2324
72 Ga0075362_10004077 3300006177 Bacteria 5206
73 Ga0075362_10005639 3300006177 Unclassified 4598
74 Ga0075367_10006988 3300006178 Bacteria 5748
75 Ga0097621_100323868 3300006237 Bacteria 1366
76 Ga0075370_10183500 3300006353 Unclassified 1232
77 Ga0068871_100159207 3300006358 Bacteria 1930
78 Ga0075428_100457977 3300006844 Bacteria 1366
79 Ga0075433_10005921 3300006852 Bacteria 9625
80 Ga0075433_10379067 3300006852 Bacteria 1249
81 Ga0075433_10467855 3300006852 Unclassified 1111
82 Ga0075433_10639828 3300006852 Bacteria 933
83 Ga0075434_100473802 3300006871 Bacteria 1273
84 Ga0075429_100083635 3300006880 Bacteria 2782
85 Ga0068865_100672703 3300006881 Bacteria 882
86 Ga0097620_100001069 3300006931 Bacteria 28045
87 Ga0075435_100168640 3300007076 Bacteria 1847
88 Ga0111539_10000245 3300009094 Bacteria 65047
89 Ga0111539_10006651 3300009094 Bacteria 14891
90 Ga0111539_10314032 3300009094 Bacteria 1824
91 Ga0105245_10619383 3300009098 Bacteria 1110
92 Ga0114129_10036984 3300009147 Bacteria 6892
93 Ga0114129_10221741 3300009147 Bacteria 2550
94 Ga0114129_10266098 3300009147 Bacteria 2295
95 Ga0105243_10485961 3300009148 Unclassified 1166
96 Ga0105241_10995875 3300009174 Bacteria 784
97 Ga0105242_10426543 3300009176 Bacteria 1244
98 Ga0105248_10275834 3300009177 Bacteria 1893
99 Ga0105248_10334303 3300009177 Bacteria 1706
100 Ga0105248_10739165 3300009177 Bacteria 1110
101 Ga0105249_10000683 3300009553 Bacteria 30864
102 Ga0105032_100001 3300009979 Bacteria 472394
103 Ga0105246_10421907 3300011119 Bacteria 1114
104 Ga0157371_10005464 3300013102 Bacteria 10712
105 Ga0157371_10031365 3300013102 Bacteria 3829
106 Ga0157371_10044792 3300013102 Bacteria 3150
107 Ga0157374_10370530 3300013296 Bacteria 1425
108 Ga0157374_10796163 3300013296 Bacteria 961
109 Ga0157372_10032485 3300013307 Bacteria 5724
110 Ga0157372_10184118 3300013307 Bacteria 2418
111 Ga0157372_10363084 3300013307 Bacteria 1687
112 Ga0157372_10519050 3300013307 Bacteria 1389
113 Ga0163163_10011651 3300014325 Bacteria 7988
114 Ga0163163_10666046 3300014325 Bacteria 1104
115 Ga0163163_11086807 3300014325 Bacteria 863
116 Ga0157380_10016859 3300014326 Bacteria 5394
117 Ga0157377_10009134 3300014745 Bacteria 4853
118 Ga0163161_10293847 3300017792 Bacteria 1278
119 Ga0213876_10000192 3300021384 Bacteria 63924
120 Ga0207697_10001138 3300025315 Bacteria 14645
121 Ga0207688_10034060 3300025901 Bacteria 2819
122 Ga0207645_10013952 3300025907 Bacteria 5388
123 Ga0207649_10071349 3300025920 Bacteria 2218
124 Ga0207649_10206324 3300025920 Bacteria 1391
125 Ga0207681_10007330 3300025923 Bacteria 6757
126 Ga0207650_10037226 3300025925 Bacteria 3544
127 Ga0207650_10277236 3300025925 Bacteria 1364
128 Ga0207659_10000339 3300025926 Bacteria 28024
129 Ga0207659_10023741 3300025926 Bacteria 4097
130 Ga0207659_10154249 3300025926 Bacteria 1796
131 Ga0207644_10356998 3300025931 Bacteria 1188
132 Ga0207711_10191593 3300025941 Bacteria 1863
133 Ga0207711_10223451 3300025941 Bacteria 1723
134 Ga0207661_10003548 3300025944 Bacteria 10840
135 Ga0207661_10031254 3300025944 Bacteria 4110
136 Ga0207679_10014696 3300025945 Bacteria 5153
137 Ga0207679_10490022 3300025945 Bacteria 1095
138 Ga0207712_10037300 3300025961 Bacteria 3315
139 Ga0207640_10283181 3300025981 Bacteria 1303
140 Ga0207658_10816184 3300025986 Bacteria 847
141 Ga0207678_10028030 3300026067 Bacteria 4918
142 Ga0207708_10074904 3300026075 Bacteria 2595
143 Ga0207641_10371405 3300026088 Unclassified 1368
144 Ga0207648_10031897 3300026089 Bacteria 4655
145 Ga0207676_10452762 3300026095 Bacteria 1210
146 Ga0207674_10069158 3300026116 Bacteria 3552
147 Ga0207675_100001562 3300026118 Bacteria 22957
148 Ga0207683_10867782 3300026121 Bacteria 838
149 Ga0207698_10321516 3300026142 Unclassified 1449
150 Ga0209971_1052230 3300027682 Bacteria 988
151 Ga0207428_10009712 3300027907 Bacteria 8622
152 Ga0207428_10016899 3300027907 Bacteria 6271
153 Ga0207428_10263683 3300027907 Bacteria 1282
154 Ga0268266_10803957 3300028379 Bacteria 908
155 Ga0268265_10047359 3300028380 Bacteria 3221
156 Ga0265338_10013264 3300028800 Bacteria 9321
157 Ga0265324_10003562 3300029957 Bacteria 7340
158 Ga0265332_10003076 3300031238 Bacteria 8143
159 Ga0307409_100071889 3300031995 Unclassified 2753
160 Ga0436365_1612133 3300039437 Bacteria 63983
161 Ga0451843_1632146 3300041509 Bacteria 650
162 Ga0453683_0208823 3300044673 Unclassified 1240
163 Ga0453684_0000946 3300044712 Bacteria 95779
164 Ga0453684_0783879 3300044712 Bacteria 1029
165 Ga0451576_0030139 3300045051 Bacteria 5802
166 Ga0451576_1210478 3300045051 Unclassified 789
167 Ga0495603_0168394 3300046455 Unclassified 1269
168 Ga0495638_0000203 3300046460 Bacteria 84250
169 Ga0495671_0058443 3300046692 Bacteria 1908
170 Ga0496104_0003484 3300048907 Bacteria 13574
171 Ga0496108_0021088 3300048911 Bacteria 5353
172 Ga0496109_0045532 3300048912 Bacteria 3982
173 Ga0496110_0046983 3300048913 Bacteria 3778
174 Ga0496112_0040579 3300048915 Bacteria 4551
175 Ga0496113_0240710 3300048916 Bacteria 1444
176 Ga0501039_1036767 3300049575 Bacteria 637
177 Ga0501040_0647795 3300049576 Unclassified 763
178 Ga0501251_030772 3300049681 Bacteria 764
179 Ga0501257_081473 3300049686 Bacteria 835
180 nmdc:mga03683_27778_c1 3300050489 Bacteria 2245
181 nmdc:mga03683_581_c2 3300050489 Bacteria 4603
182 nmdc:mga00v17_101817_c1 3300050491 Bacteria 1814
183 nmdc:mga00v17_5157_c1 3300050491 Bacteria 6870
184 nmdc:mga00v17_5387_c1 3300050491 Bacteria 6739
185 nmdc:mga0yw44_196286_c1 3300050492 Bacteria 1332
186 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
187 nmdc:mga06z11_2120_c1 3300050494 Bacteria 7520
188 nmdc:mga07m45_42464_c1 3300050496 Bacteria 2549
189 nmdc:mga05p37_52860_c2 3300050507 Bacteria 1532
190 nmdc:mga05p37_541500_c1 3300050507 Bacteria 1327
191 nmdc:mga09592_453504_c1 3300050508 Bacteria 1106
192 nmdc:mga09592_95204_c1 3300050508 Bacteria 2547
193 nmdc:mga08y16_13979_c1 3300050511 Bacteria 8449
194 nmdc:mga08y16_142782_c1 3300050511 Bacteria 2489
195 nmdc:mga08y16_26453_c1 3300050511 Bacteria 6118
196 nmdc:mga0n895_321946_c1 3300050512 Bacteria 1567
197 nmdc:mga0n895_764722_c1 3300050512 Bacteria 958
198 nmdc:mga0rr50_802573_c1 3300050513 Bacteria 803
199 nmdc:mga0rr50_944787_c1 3300050513 Bacteria 735
200 nmdc:mga0a205_202542_c1 3300050515 Unclassified 1875
201 nmdc:mga0a205_358481_c1 3300050515 Bacteria 1325
202 nmdc:mga0a205_492379_c1 3300050515 Unclassified 1083
203 nmdc:mga0a205_55591_c1 3300050515 Bacteria 3822
204 Ga0500635_0041831 3300053080 Bacteria 1534
205 Ga0500644_0001798 3300053088 Bacteria 5542
206 Ga0500651_0081479 3300053093 Bacteria 2004
207 Ga0500577_0000519 3300053142 Bacteria 9980
208 Ga0500604_0019482 3300053151 Bacteria 1901
209 Ga0500656_002712 3300053732 Bacteria 1616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025931 Ga0207644_10356998 Ga0207644_103569982 180
2 3300041509 Ga0451843_1632146 Ga0451843_1632146_91_639 182
3 3300049575 Ga0501039_1036767 Ga0501039_1036767_27_599 190
4 3300050508 nmdc:mga09592_453504_c1 nmdc:mga09592_453504_c1_500_1081 193
5 3300013102 Ga0157371_10005464 Ga0157371_1000546411 197
6 3300050515 nmdc:mga0a205_55591_c1 nmdc:mga0a205_55591_c1_2279_2872 197
7 3300005329 Ga0070683_100060101 Ga0070683_1000601013 198
8 3300049576 Ga0501040_0647795 Ga0501040_0647795_31_627 198
9 3300050512 nmdc:mga0n895_321946_c1 nmdc:mga0n895_321946_c1_628_1233 201
10 3300050515 nmdc:mga0a205_358481_c1 nmdc:mga0a205_358481_c1_521_1126 201
11 3300009147 Ga0114129_10221741 Ga0114129_102217412 202
12 3300026121 Ga0207683_10867782 Ga0207683_108677822 202
13 3300050507 nmdc:mga05p37_541500_c1 nmdc:mga05p37_541500_c1_544_1152 202
14 3300050508 nmdc:mga09592_95204_c1 nmdc:mga09592_95204_c1_857_1465 202
15 3300050511 nmdc:mga08y16_142782_c1 nmdc:mga08y16_142782_c1_904_1512 202
16 3300049681 Ga0501251_030772 Ga0501251_030772_13_657 203
17 3300005456 Ga0070678_100858907 Ga0070678_1008589071 206
18 3300044673 Ga0453683_0208823 Ga0453683_0208823_363_1007 206
19 3300045051 Ga0451576_0030139 Ga0451576_0030139_206_850 206
20 3300046460 Ga0495638_0000203 Ga0495638_0000203_25665_26321 212
21 3300003316 rootH1_10010855 rootH1_1001085563 213
22 3300005616 Ga0068852_101060497 Ga0068852_1010604971 213
23 3300013307 Ga0157372_10519050 Ga0157372_105190501 213
24 3300053080 Ga0500635_0041831 Ga0500635_0041831_290_943 213
25 3300053093 Ga0500651_0081479 Ga0500651_0081479_577_1230 213
26 3300006353 Ga0075370_10183500 Ga0075370_101835002 214
27 3300013307 Ga0157372_10184118 Ga0157372_101841182 214
28 3300044712 Ga0453684_0000946 Ga0453684_0000946_68714_69382 214
29 3300053151 Ga0500604_0019482 Ga0500604_0019482_778_1431 214
30 3300053732 Ga0500656_002712 Ga0500656_002712_690_1349 214
31 3300003323 rootH1_10280559 rootH1_102805593 215
32 3300005535 Ga0070684_100102152 Ga0070684_1001021523 215
33 3300005617 Ga0068859_100001069 Ga0068859_10000106914 215
34 3300006051 Ga0075364_10010227 Ga0075364_100102275 215
35 3300006177 Ga0075362_10005639 Ga0075362_100056396 215
36 3300006931 Ga0097620_100001069 Ga0097620_10000106916 215
37 3300013102 Ga0157371_10031365 Ga0157371_100313654 215
38 3300013102 Ga0157371_10044792 Ga0157371_100447922 215
39 3300013307 Ga0157372_10032485 Ga0157372_100324854 215
40 3300026142 Ga0207698_10321516 Ga0207698_103215161 215
41 3300050489 nmdc:mga03683_581_c2 nmdc:mga03683_581_c2_1878_2534 215
42 3300050491 nmdc:mga00v17_5157_c1 nmdc:mga00v17_5157_c1_379_1035 215
43 3300005535 Ga0070684_100052564 Ga0070684_1000525647 216
44 3300009979 Ga0105032_100001 Ga0105032_100001479 216
45 3300013307 Ga0157372_10363084 Ga0157372_103630842 216
46 3300028800 Ga0265338_10013264 Ga0265338_100132644 216
47 3300029957 Ga0265324_10003562 Ga0265324_100035627 216
48 3300031238 Ga0265332_10003076 Ga0265332_1000307613 216
49 3300046692 Ga0495671_0058443 Ga0495671_0058443_1123_1821 216
50 3300053088 Ga0500644_0001798 Ga0500644_0001798_4674_5372 216
51 3300053142 Ga0500577_0000519 Ga0500577_0000519_830_1528 216
52 3300021384 Ga0213876_10000192 Ga0213876_1000019213 217
53 3300039437 Ga0436365_1612133 Ga0436365_1612133_13193_13846 217
54 3300049686 Ga0501257_081473 Ga0501257_081473_38_751 217
55 3300005289 Ga0065704_10077373 Ga0065704_100773737 218
56 3300005518 Ga0070699_100001248 Ga0070699_1000012487 218
57 3300005530 Ga0070679_100041675 Ga0070679_1000416756 218
58 3300005983 Ga0081540_1156232 Ga0081540_11562321 218
59 3300006038 Ga0075365_10000008 Ga0075365_10000008111 218
60 3300007076 Ga0075435_100168640 Ga0075435_1001686402 218
61 3300050492 nmdc:mga0yw44_1_c1 nmdc:mga0yw44_1_c1_20031_20696 218
62 3300050513 nmdc:mga0rr50_802573_c1 nmdc:mga0rr50_802573_c1_132_791 218
63 3300005290 Ga0065712_10011940 Ga0065712_100119402 219
64 3300005293 Ga0065715_10006846 Ga0065715_100068465 219
65 3300005295 Ga0065707_10128228 Ga0065707_101282281 219
66 3300005331 Ga0070670_100009157 Ga0070670_1000091572 219
67 3300005331 Ga0070670_100134383 Ga0070670_1001343832 219
68 3300005340 Ga0070689_100256455 Ga0070689_1002564551 219
69 3300005340 Ga0070689_100616184 Ga0070689_1006161842 219
70 3300005345 Ga0070692_10202272 Ga0070692_102022722 219
71 3300005353 Ga0070669_100001950 Ga0070669_10000195012 219
72 3300005353 Ga0070669_100247404 Ga0070669_1002474041 219
73 3300005354 Ga0070675_100003146 Ga0070675_10000314612 219
74 3300005354 Ga0070675_100032892 Ga0070675_1000328926 219
75 3300005356 Ga0070674_100022950 Ga0070674_1000229504 219
76 3300005364 Ga0070673_100100937 Ga0070673_1001009373 219
77 3300005365 Ga0070688_100100712 Ga0070688_1001007122 219
78 3300005367 Ga0070667_100922371 Ga0070667_1009223711 219
79 3300005438 Ga0070701_10262758 Ga0070701_102627581 219
80 3300005441 Ga0070700_100132415 Ga0070700_1001324152 219
81 3300005441 Ga0070700_100162316 Ga0070700_1001623161 219
82 3300005444 Ga0070694_100100199 Ga0070694_1001001992 219
83 3300005456 Ga0070678_100990379 Ga0070678_1009903791 219
84 3300005459 Ga0068867_100200992 Ga0068867_1002009921 219
85 3300005471 Ga0070698_100025554 Ga0070698_1000255545 219
86 3300005546 Ga0070696_100030075 Ga0070696_1000300753 219
87 3300005548 Ga0070665_100614837 Ga0070665_1006148372 219
88 3300005549 Ga0070704_100151176 Ga0070704_1001511763 219
89 3300005549 Ga0070704_100810114 Ga0070704_1008101141 219
90 3300005564 Ga0070664_100165772 Ga0070664_1001657722 219
91 3300005577 Ga0068857_100009278 Ga0068857_10000927811 219
92 3300005578 Ga0068854_100093659 Ga0068854_1000936592 219
93 3300005615 Ga0070702_100001417 Ga0070702_1000014178 219
94 3300005616 Ga0068852_101022847 Ga0068852_1010228472 219
95 3300005719 Ga0068861_100677690 Ga0068861_1006776902 219
96 3300006038 Ga0075365_10030612 Ga0075365_100306124 219
97 3300006051 Ga0075364_10005119 Ga0075364_100051193 219
98 3300006058 Ga0075432_10019389 Ga0075432_100193893 219
99 3300006178 Ga0075367_10006988 Ga0075367_100069886 219
100 3300006237 Ga0097621_100323868 Ga0097621_1003238681 219
101 3300006358 Ga0068871_100159207 Ga0068871_1001592074 219
102 3300006844 Ga0075428_100457977 Ga0075428_1004579772 219
103 3300006852 Ga0075433_10005921 Ga0075433_1000592110 219
104 3300006852 Ga0075433_10379067 Ga0075433_103790672 219
105 3300006852 Ga0075433_10467855 Ga0075433_104678552 219
106 3300006852 Ga0075433_10639828 Ga0075433_106398282 219
107 3300006871 Ga0075434_100473802 Ga0075434_1004738021 219
108 3300006880 Ga0075429_100083635 Ga0075429_1000836352 219
109 3300006881 Ga0068865_100672703 Ga0068865_1006727032 219
110 3300009094 Ga0111539_10000245 Ga0111539_1000024554 219
111 3300009094 Ga0111539_10006651 Ga0111539_100066512 219
112 3300009147 Ga0114129_10036984 Ga0114129_100369842 219
113 3300009148 Ga0105243_10485961 Ga0105243_104859612 219
114 3300009174 Ga0105241_10995875 Ga0105241_109958752 219
115 3300009176 Ga0105242_10426543 Ga0105242_104265431 219
116 3300009177 Ga0105248_10275834 Ga0105248_102758342 219
117 3300009553 Ga0105249_10000683 Ga0105249_1000068312 219
118 3300011119 Ga0105246_10421907 Ga0105246_104219072 219
119 3300013296 Ga0157374_10370530 Ga0157374_103705302 219
120 3300013296 Ga0157374_10796163 Ga0157374_107961631 219
121 3300014325 Ga0163163_10666046 Ga0163163_106660462 219
122 3300014325 Ga0163163_11086807 Ga0163163_110868072 219
123 3300014745 Ga0157377_10009134 Ga0157377_100091344 219
124 3300017792 Ga0163161_10293847 Ga0163161_102938472 219
125 3300025315 Ga0207697_10001138 Ga0207697_1000113816 219
126 3300025901 Ga0207688_10034060 Ga0207688_100340602 219
127 3300025907 Ga0207645_10013952 Ga0207645_100139522 219
128 3300025920 Ga0207649_10071349 Ga0207649_100713493 219
129 3300025923 Ga0207681_10007330 Ga0207681_100073306 219
130 3300025925 Ga0207650_10037226 Ga0207650_100372262 219
131 3300025925 Ga0207650_10277236 Ga0207650_102772362 219
132 3300025926 Ga0207659_10000339 Ga0207659_100003398 219
133 3300025926 Ga0207659_10023741 Ga0207659_100237415 219
134 3300025941 Ga0207711_10191593 Ga0207711_101915932 219
135 3300025945 Ga0207679_10490022 Ga0207679_104900222 219
136 3300025961 Ga0207712_10037300 Ga0207712_100373002 219
137 3300025981 Ga0207640_10283181 Ga0207640_102831812 219
138 3300025986 Ga0207658_10816184 Ga0207658_108161841 219
139 3300026075 Ga0207708_10074904 Ga0207708_100749042 219
140 3300026088 Ga0207641_10371405 Ga0207641_103714052 219
141 3300026089 Ga0207648_10031897 Ga0207648_100318975 219
142 3300026116 Ga0207674_10069158 Ga0207674_100691584 219
143 3300026118 Ga0207675_100001562 Ga0207675_10000156211 219
144 3300027682 Ga0209971_1052230 Ga0209971_10522301 219
145 3300027907 Ga0207428_10009712 Ga0207428_100097127 219
146 3300027907 Ga0207428_10016899 Ga0207428_100168996 219
147 3300027907 Ga0207428_10263683 Ga0207428_102636832 219
148 3300028379 Ga0268266_10803957 Ga0268266_108039572 219
149 3300028380 Ga0268265_10047359 Ga0268265_100473593 219
150 3300044712 Ga0453684_0783879 Ga0453684_0783879_94_753 219
151 3300046455 Ga0495603_0168394 Ga0495603_0168394_24_683 219
152 3300050491 nmdc:mga00v17_5387_c1 nmdc:mga00v17_5387_c1_4852_5511 219
153 3300050494 nmdc:mga06z11_2120_c1 nmdc:mga06z11_2120_c1_5894_6553 219
154 3300050496 nmdc:mga07m45_42464_c1 nmdc:mga07m45_42464_c1_994_1653 219
155 3300050507 nmdc:mga05p37_52860_c2 nmdc:mga05p37_52860_c2_388_1047 219
156 3300050511 nmdc:mga08y16_13979_c1 nmdc:mga08y16_13979_c1_5250_5909 219
157 3300050511 nmdc:mga08y16_26453_c1 nmdc:mga08y16_26453_c1_1250_1909 219
158 3300050512 nmdc:mga0n895_764722_c1 nmdc:mga0n895_764722_c1_229_888 219
159 3300050513 nmdc:mga0rr50_944787_c1 nmdc:mga0rr50_944787_c1_45_704 219
160 3300050515 nmdc:mga0a205_202542_c1 nmdc:mga0a205_202542_c1_1173_1832 219
161 3300050515 nmdc:mga0a205_492379_c1 nmdc:mga0a205_492379_c1_134_793 219
162 3300005293 Ga0065715_10394524 Ga0065715_103945241 220
163 3300005337 Ga0070682_100033972 Ga0070682_1000339723 220
164 3300005341 Ga0070691_10269415 Ga0070691_102694151 220
165 3300005547 Ga0070693_100294689 Ga0070693_1002946891 220
166 3300009147 Ga0114129_10266098 Ga0114129_102660983 220
167 3300009177 Ga0105248_10739165 Ga0105248_107391652 220
168 3300014326 Ga0157380_10016859 Ga0157380_100168592 220
169 3300005467 Ga0070706_100703603 Ga0070706_1007036031 221
170 3300006038 Ga0075365_10107554 Ga0075365_101075542 221
171 3300006051 Ga0075364_10018918 Ga0075364_100189183 221
172 3300006177 Ga0075362_10004077 Ga0075362_100040775 221
173 3300009094 Ga0111539_10314032 Ga0111539_103140322 221
174 3300050489 nmdc:mga03683_27778_c1 nmdc:mga03683_27778_c1_1123_1788 221
175 3300050491 nmdc:mga00v17_101817_c1 nmdc:mga00v17_101817_c1_801_1466 221
176 3300050492 nmdc:mga0yw44_196286_c1 nmdc:mga0yw44_196286_c1_467_1132 221
177 2162886011 MRS1b_contig_7309267 MRS1b_0903.00002680 222
178 3300005290 Ga0065712_10074866 Ga0065712_100748663 222
179 3300005329 Ga0070683_100002122 Ga0070683_10000212213 222
180 3300005329 Ga0070683_100120214 Ga0070683_1001202144 222
181 3300005340 Ga0070689_100183409 Ga0070689_1001834091 222
182 3300005344 Ga0070661_100011813 Ga0070661_1000118133 222
183 3300005367 Ga0070667_100055416 Ga0070667_1000554163 222
184 3300005455 Ga0070663_100022773 Ga0070663_1000227733 222
185 3300005518 Ga0070699_100339410 Ga0070699_1003394102 222
186 3300005535 Ga0070684_100000667 Ga0070684_10000066723 222
187 3300005543 Ga0070672_100246729 Ga0070672_1002467292 222
188 3300005564 Ga0070664_100003674 Ga0070664_1000036743 222
189 3300005618 Ga0068864_100190825 Ga0068864_1001908252 222
190 3300009098 Ga0105245_10619383 Ga0105245_106193831 222
191 3300009177 Ga0105248_10334303 Ga0105248_103343032 222
192 3300014325 Ga0163163_10011651 Ga0163163_100116513 222
193 3300025920 Ga0207649_10206324 Ga0207649_102063242 222
194 3300025926 Ga0207659_10154249 Ga0207659_101542491 222
195 3300025941 Ga0207711_10223451 Ga0207711_102234512 222
196 3300025944 Ga0207661_10003548 Ga0207661_1000354812 222
197 3300025944 Ga0207661_10031254 Ga0207661_100312544 222
198 3300025945 Ga0207679_10014696 Ga0207679_100146965 222
199 3300026067 Ga0207678_10028030 Ga0207678_100280303 222
200 3300026095 Ga0207676_10452762 Ga0207676_104527622 222
201 3300031995 Ga0307409_100071889 Ga0307409_1000718892 222
202 3300045051 Ga0451576_1210478 Ga0451576_1210478_10_678 222
203 3300048907 Ga0496104_0003484 Ga0496104_0003484_1139_1807 222
204 3300048911 Ga0496108_0021088 Ga0496108_0021088_1722_2390 222
205 3300048912 Ga0496109_0045532 Ga0496109_0045532_2636_3304 222
206 3300048913 Ga0496110_0046983 Ga0496110_0046983_1198_1866 222
207 3300048915 Ga0496112_0040579 Ga0496112_0040579_980_1648 222
208 3300048916 Ga0496113_0240710 Ga0496113_0240710_591_1259 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02698

DUF218

DUF218 domain

54

206

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ca8-assembly2.cif.gz_B crystal structure of escherichia coli ydcf, an s-adenosyl-l-methionine utilizing enzyme 0.8022 1 212
3ca8-assembly2.cif.gz_B crystal structure of escherichia coli ydcf, an s-adenosyl-l-methionine utilizing enzyme 0.7657 1 212
6r48-assembly1.cif.gz_A crystal structure of lpor (synechocystis) complexed with nadph at 1.87a resolution. 0.6779 26 121
6r48-assembly2.cif.gz_B crystal structure of lpor (synechocystis) complexed with nadph at 1.87a resolution. 0.6603 25 121
6l1g-assembly2.cif.gz_B crystal structure of light-dependent protochlorophyllide oxidoreductase from synechocystis sp. pcc 6803 0.6492 29 125
ID Description Score Start End Superfamily
af_Q2FVR4_139_271_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8343 17 132 3.40.50.620
af_P34209_28_181_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8044 19 152 3.40.50.620
af_Q54FL1_98_236_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7886 26 145 3.40.50.620
af_F4HXZ8_108_292_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.754 26 155 3.40.50.620
af_Q2FVR4_139_271_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7295 17 132 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7W1C0Y2-F1-model_v4 YdcF family protein 0.9922 1 158 GO:0005886
AF-A0A2V7VN22-F1-model_v4 DUF218 domain-containing protein 0.9879 5 217 GO:0005886
AF-H5X368-F1-model_v4 DUF218 domain-containing protein 0.987 1 217 GO:0005886
AF-A0A6P1TT74-F1-model_v4 YdcF family protein 0.9869 1 217 GO:0005886
AF-A0A1D8C3E0-F1-model_v4 deleted 0.985 1 217

Feature Viewer

pLDDT pTM Quality
93.53 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map