F317509

General Info

Members Datasets Scaffolds Average Seq Length
208 157 416 235

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100169454|Ga0070698_1001694542
Length 238
Sequence MSAKAAESRVMLITGTRKGIGRHLAERYVARGWRVVGVSRSKPDWTLDGYEHHEADVADERAVKALFLALRKQHGRLDALINNAGIASMNHVLLTPLETMESIFRTNVFGTFLFCRESARLMSQDKRGGRIINFATVATPLKLEGEAAYAASKAAVVSLTEVLARELAPFAITVNAVGPTPIETDLIRSVPRQKMDALIARQAIPRMGTMEDVANVIDFFLREESDFITGQVVYLGGV

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
88 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
89 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
90 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
93 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
110 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
111 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
157 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 0
Rhizoplane 0.96
Rhizosphere 91.83
Stem 0
Stem Tuber 0
Unclassified 10.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100169454 3300005471 Bacteria 2125
2 rootL2_10302734 3300003322 Unclassified 3574
3 rootL2_10303194 3300003322 Bacteria 1267
4 rootH1_10049198 3300003323 Bacteria 5395
5 rootH1_10072756 3300003323 Bacteria 4612
6 Ga0065707_10083830 3300005295 Bacteria 8155
7 Ga0070676_10039634 3300005328 Unclassified 2725
8 Ga0070683_100009837 3300005329 Bacteria 8194
9 Ga0070683_100161621 3300005329 Bacteria 2125
10 Ga0070670_100014980 3300005331 Bacteria 6654
11 Ga0070680_100023278 3300005336 Bacteria 4940
12 Ga0070689_100219959 3300005340 Bacteria 1557
13 Ga0070687_100167435 3300005343 Bacteria 1305
14 Ga0070692_10227469 3300005345 Bacteria 1105
15 Ga0070673_100033130 3300005364 Bacteria 3897
16 Ga0070688_100019232 3300005365 Bacteria 3955
17 Ga0070659_100900112 3300005366 Bacteria 773
18 Ga0070667_100040625 3300005367 Bacteria 3901
19 Ga0070705_100224666 3300005440 Bacteria 1302
20 Ga0070700_100025530 3300005441 Plasmid 3479
21 Ga0070694_100009987 3300005444 Bacteria 5835
22 Ga0070662_100029390 3300005457 Bacteria 3835
23 Ga0070681_10193527 3300005458 Bacteria 1953
24 Ga0068867_100142518 3300005459 Bacteria 1875
25 Ga0070698_100841107 3300005471 Bacteria 862
26 Ga0070679_100012508 3300005530 Bacteria 8114
27 Ga0070679_100099137 3300005530 Bacteria 2901
28 Ga0070696_100111722 3300005546 Bacteria 1968
29 Ga0070696_100511620 3300005546 Bacteria 957
30 Ga0070704_100194222 3300005549 Unclassified 1634
31 Ga0070704_100560523 3300005549 Bacteria 999
32 Ga0068855_100001090 3300005563 Bacteria 33764
33 Ga0068854_100061708 3300005578 Bacteria 2716
34 Ga0068856_100034657 3300005614 Unclassified 4944
35 Ga0068852_100473555 3300005616 Bacteria 1243
36 Ga0068864_100842247 3300005618 Bacteria 903
37 Ga0068861_100134673 3300005719 Bacteria 2009
38 Ga0068863_100022884 3300005841 Bacteria 5972
39 Ga0068860_100017538 3300005843 Bacteria 6976
40 Ga0068862_100187741 3300005844 Unclassified 1858
41 Ga0081455_10016165 3300005937 Bacteria 7214
42 Ga0081539_10004858 3300005985 Bacteria 14371
43 Ga0075367_10171816 3300006178 Unclassified 1350
44 Ga0075427_10002012 3300006194 Bacteria 2680
45 Ga0097621_100075306 3300006237 Unclassified 2797
46 Ga0075428_100191066 3300006844 Unclassified 2214
47 Ga0075428_100268064 3300006844 Bacteria 1838
48 Ga0075428_100322013 3300006844 Bacteria 1661
49 Ga0075428_100692383 3300006844 Bacteria 1086
50 Ga0075428_100703851 3300006844 Bacteria 1076
51 Ga0075430_100031247 3300006846 Bacteria 4519
52 Ga0075430_100162737 3300006846 Bacteria 1857
53 Ga0075431_100128004 3300006847 Bacteria 2620
54 Ga0075431_100255986 3300006847 Bacteria 1778
55 Ga0075433_10014904 3300006852 Bacteria 6362
56 Ga0075433_10059548 3300006852 Bacteria 3341
57 Ga0075433_10175949 3300006852 Bacteria 1904
58 Ga0075434_100072002 3300006871 Bacteria 3449
59 Ga0075434_100497041 3300006871 Bacteria 1241
60 Ga0075429_100088576 3300006880 Bacteria 2698
61 Ga0075429_100211730 3300006880 Bacteria 1698
62 Ga0075429_100525304 3300006880 Bacteria 1037
63 Ga0075429_100533433 3300006880 Unclassified 1029
64 Ga0105250_10000032 3300009092 Bacteria 159642
65 Ga0111539_10012923 3300009094 Unclassified 10447
66 Ga0111539_10078691 3300009094 Plasmid 3878
67 Ga0111539_10811468 3300009094 Bacteria 1089
68 Ga0111539_10943889 3300009094 Bacteria 1003
69 Ga0105245_10000382 3300009098 Bacteria 41169
70 Ga0114129_10089025 3300009147 Bacteria 4279
71 Ga0114129_10448707 3300009147 Bacteria 1692
72 Ga0105241_10004658 3300009174 Bacteria 10134
73 Ga0105241_10442472 3300009174 Bacteria 1148
74 Ga0099796_10053819 3300010159 Bacteria 1405
75 Ga0105246_10737451 3300011119 Bacteria 867
76 Ga0157369_10459777 3300013105 Bacteria 1318
77 Ga0157378_10091814 3300013297 Bacteria 2761
78 Ga0163162_10467151 3300013306 Bacteria 1393
79 Ga0157372_10086696 3300013307 Bacteria 3552
80 Ga0157375_10521384 3300013308 Bacteria 1351
81 Ga0157375_11009832 3300013308 Bacteria 971
82 Ga0157380_10000221 3300014326 Bacteria 34047
83 Ga0157380_10479152 3300014326 Bacteria 1203
84 Ga0157379_10000004 3300014968 Bacteria 173351
85 Ga0157376_10188752 3300014969 Bacteria 1889
86 Ga0157376_10451823 3300014969 Bacteria 1254
87 Ga0157376_10951072 3300014969 Bacteria 880
88 Ga0213876_10012707 3300021384 Unclassified 4478
89 Ga0207696_1000263 3300025711 Bacteria 67526
90 Ga0207680_10205923 3300025903 Bacteria 1343
91 Ga0207660_10168835 3300025917 Bacteria 1692
92 Ga0207662_10137282 3300025918 Bacteria 1546
93 Ga0207652_10060068 3300025921 Bacteria 3279
94 Ga0207652_10723022 3300025921 Bacteria 887
95 Ga0207650_10009512 3300025925 Bacteria 6643
96 Ga0207687_10000250 3300025927 Bacteria 36357
97 Ga0207644_10358401 3300025931 Bacteria 1186
98 Ga0207690_10812933 3300025932 Bacteria 773
99 Ga0207706_10034844 3300025933 Bacteria 4478
100 Ga0207709_10202440 3300025935 Bacteria 1419
101 Ga0207691_10016467 3300025940 Bacteria 7018
102 Ga0207661_10114782 3300025944 Bacteria 2284
103 Ga0207661_10868746 3300025944 Bacteria 830
104 Ga0207667_10001155 3300025949 Bacteria 33146
105 Ga0207640_10252741 3300025981 Bacteria 1369
106 Ga0207658_10076812 3300025986 Bacteria 2546
107 Ga0207658_10263167 3300025986 Unclassified 1471
108 Ga0207677_10869369 3300026023 Bacteria 811
109 Ga0207708_10016425 3300026075 Bacteria 5567
110 Ga0207702_10034724 3300026078 Unclassified 4218
111 Ga0207641_10287673 3300026088 Bacteria 1548
112 Ga0207648_10032033 3300026089 Bacteria 4645
113 Ga0207676_10126070 3300026095 Unclassified 2169
114 Ga0207675_100056886 3300026118 Bacteria 3648
115 Ga0207675_100263888 3300026118 Bacteria 1670
116 Ga0207675_100521241 3300026118 Bacteria 1185
117 Ga0207683_10423425 3300026121 Bacteria 1226
118 Ga0207698_10447118 3300026142 Bacteria 1247
119 Ga0268265_10030829 3300028380 Bacteria 3867
120 Ga0268265_10050107 3300028380 Unclassified 3145
121 Ga0265334_10093048 3300028573 Bacteria 1098
122 Ga0265330_10019899 3300031235 Bacteria 3069
123 Ga0265330_10034301 3300031235 Bacteria 2267
124 Ga0265332_10000181 3300031238 Bacteria 52143
125 Ga0265328_10008750 3300031239 Bacteria 4156
126 Ga0265325_10031431 3300031241 Bacteria 2842
127 Ga0265329_10019133 3300031242 Unclassified 2329
128 Ga0265340_10000860 3300031247 Bacteria 17257
129 Ga0265339_10002563 3300031249 Bacteria 12963
130 Ga0265339_10168471 3300031249 Bacteria 1098
131 Ga0265331_10000278 3300031250 Bacteria 56825
132 Ga0265316_10000317 3300031344 Bacteria 53473
133 Ga0265316_10001420 3300031344 Bacteria 25771
134 Ga0307513_10023257 3300031456 Bacteria 7245
135 Ga0307508_10000396 3300031616 Bacteria 52502
136 Ga0307508_10060281 3300031616 Bacteria 3356
137 Ga0265314_10000003 3300031711 Bacteria 1653386
138 Ga0265314_10000842 3300031711 Bacteria 36310
139 Ga0265342_10002733 3300031712 Bacteria 15010
140 Ga0307516_10002770 3300031730 Bacteria 23127
141 Ga0307405_10609718 3300031731 Bacteria 892
142 Ga0307410_10596093 3300031852 Bacteria 921
143 Ga0307415_100169544 3300032126 Unclassified 1701
144 Ga0373955_0057270 3300035172 Bacteria 2141
145 Ga0373933_0109704 3300035724 Bacteria 1720
146 Ga0373933_0148818 3300035724 Bacteria 1482
147 Ga0373937_0008005 3300036401 Bacteria 9165
148 Ga0373937_0816007 3300036401 Bacteria 881
149 Ga0436365_0610073 3300039437 Bacteria 7329
150 Ga0451797_1335187 3300041453 Bacteria 1066
151 Ga0451807_1257073 3300041486 Bacteria 5460
152 Ga0451839_1045181 3300041496 Unclassified 1720
153 Ga0451853_2773787 3300041512 Bacteria 2295
154 Ga0466964_0129851 3300044706 Bacteria 1146
155 Ga0466960_0255232 3300044901 Bacteria 975
156 Ga0451576_0872267 3300045051 Bacteria 945
157 Ga0466967_0214963 3300045976 Bacteria 1825
158 Ga0495629_0276744 3300046459 Bacteria 1152
159 Ga0495638_0137500 3300046460 Bacteria 1429
160 Ga0495651_0012295 3300046462 Bacteria 6597
161 Ga0495648_0021177 3300046524 Bacteria 4511
162 Ga0495652_0298122 3300046529 Bacteria 1173
163 Ga0495587_0034949 3300046536 Bacteria 3029
164 Ga0495645_0009090 3300046543 Bacteria 6942
165 Ga0495667_0080399 3300046559 Bacteria 2119
166 Ga0495668_0015753 3300046616 Bacteria 4407
167 Ga0495634_0214292 3300046642 Bacteria 1191
168 Ga0495625_0020779 3300046660 Bacteria 5062
169 Ga0495635_0445756 3300046663 Bacteria 856
170 Ga0495623_0241552 3300046679 Bacteria 1020
171 Ga0495658_0201680 3300046683 Bacteria 1240
172 Ga0495649_0016300 3300046694 Bacteria 4211
173 Ga0495600_0228192 3300046809 Bacteria 1189
174 Ga0495604_0066318 3300047317 Bacteria 2746
175 Ga0495604_0401922 3300047317 Unclassified 902
176 Ga0495674_0100808 3300047319 Bacteria 2457
177 Ga0495680_0008200 3300047322 Bacteria 9521
178 Ga0495680_0269528 3300047322 Bacteria 1202
179 Ga0495602_0141972 3300048088 Bacteria 1900
180 Ga0501034_0383168 3300049571 Bacteria 1331
181 Ga0501038_0081672 3300049574 Bacteria 2723
182 Ga0501040_0003973 3300049576 Bacteria 9611
183 Ga0501071_0124654 3300049587 Bacteria 1911
184 Ga0501072_0007647 3300049588 Bacteria 8202
185 Ga0501074_0272443 3300049590 Bacteria 1203
186 Ga0501075_0003586 3300049591 Bacteria 10398
187 Ga0501076_0110559 3300049592 Bacteria 2221
188 Ga0501079_0002926 3300049741 Bacteria 12475
189 Ga0501080_0014504 3300049742 Bacteria 7259
190 Ga0501081_0001523 3300049743 Bacteria 14243
191 nmdc:mga05p37_113230_c1 3300050507 Bacteria 3336
192 nmdc:mga05p37_596762_c1 3300050507 Unclassified 1247
193 nmdc:mga09592_120889_c1 3300050508 Bacteria 2250
194 nmdc:mga09592_217276_c1 3300050508 Unclassified 1656
195 nmdc:mga06r32_217846_c1 3300050510 Bacteria 1897
196 nmdc:mga06r32_31192_c1 3300050510 Bacteria 5004
197 nmdc:mga06r32_587221_c1 3300050510 Unclassified 1086
198 nmdc:mga0n895_161860_c1 3300050512 Bacteria 2270
199 nmdc:mga0n895_20592_c1 3300050512 Bacteria 6154
200 nmdc:mga0a205_20177_c1 3300050515 Bacteria 6287
201 nmdc:mga0a205_74238_c1 3300050515 Bacteria 3286
202 nmdc:mga0a205_79214_c1 3300050515 Bacteria 2756
203 Ga0500604_0100490 3300053151 Bacteria 953
204 Ga0501084_0033333 3300054114 Bacteria 4309
205 Ga0501084_0112197 3300054114 Bacteria 2291
206 Ga0501082_0016363 3300060353 Bacteria 6384
207 Ga0530510_0025564 3300061734 Bacteria 4223
208 2854684883 2854681122 Bacteria 4548679
209 Ga0070698_100169454
210 rootL2_10302734
211 rootL2_10303194
212 rootH1_10049198
213 rootH1_10072756
214 Ga0065707_10083830
215 Ga0070676_10039634
216 Ga0070683_100009837
217 Ga0070683_100161621
218 Ga0070670_100014980
219 Ga0070680_100023278
220 Ga0070689_100219959
221 Ga0070687_100167435
222 Ga0070692_10227469
223 Ga0070673_100033130
224 Ga0070688_100019232
225 Ga0070659_100900112
226 Ga0070667_100040625
227 Ga0070705_100224666
228 Ga0070700_100025530
229 Ga0070694_100009987
230 Ga0070662_100029390
231 Ga0070681_10193527
232 Ga0068867_100142518
233 Ga0070698_100841107
234 Ga0070679_100012508
235 Ga0070679_100099137
236 Ga0070696_100111722
237 Ga0070696_100511620
238 Ga0070704_100194222
239 Ga0070704_100560523
240 Ga0068855_100001090
241 Ga0068854_100061708
242 Ga0068856_100034657
243 Ga0068852_100473555
244 Ga0068864_100842247
245 Ga0068861_100134673
246 Ga0068863_100022884
247 Ga0068860_100017538
248 Ga0068862_100187741
249 Ga0081455_10016165
250 Ga0081539_10004858
251 Ga0075367_10171816
252 Ga0075427_10002012
253 Ga0097621_100075306
254 Ga0075428_100191066
255 Ga0075428_100268064
256 Ga0075428_100322013
257 Ga0075428_100692383
258 Ga0075428_100703851
259 Ga0075430_100031247
260 Ga0075430_100162737
261 Ga0075431_100128004
262 Ga0075431_100255986
263 Ga0075433_10014904
264 Ga0075433_10059548
265 Ga0075433_10175949
266 Ga0075434_100072002
267 Ga0075434_100497041
268 Ga0075429_100088576
269 Ga0075429_100211730
270 Ga0075429_100525304
271 Ga0075429_100533433
272 Ga0105250_10000032
273 Ga0111539_10012923
274 Ga0111539_10078691
275 Ga0111539_10811468
276 Ga0111539_10943889
277 Ga0105245_10000382
278 Ga0114129_10089025
279 Ga0114129_10448707
280 Ga0105241_10004658
281 Ga0105241_10442472
282 Ga0099796_10053819
283 Ga0105246_10737451
284 Ga0157369_10459777
285 Ga0157378_10091814
286 Ga0163162_10467151
287 Ga0157372_10086696
288 Ga0157375_10521384
289 Ga0157375_11009832
290 Ga0157380_10000221
291 Ga0157380_10479152
292 Ga0157379_10000004
293 Ga0157376_10188752
294 Ga0157376_10451823
295 Ga0157376_10951072
296 Ga0213876_10012707
297 Ga0207696_1000263
298 Ga0207680_10205923
299 Ga0207660_10168835
300 Ga0207662_10137282
301 Ga0207652_10060068
302 Ga0207652_10723022
303 Ga0207650_10009512
304 Ga0207687_10000250
305 Ga0207644_10358401
306 Ga0207690_10812933
307 Ga0207706_10034844
308 Ga0207709_10202440
309 Ga0207691_10016467
310 Ga0207661_10114782
311 Ga0207661_10868746
312 Ga0207667_10001155
313 Ga0207640_10252741
314 Ga0207658_10076812
315 Ga0207658_10263167
316 Ga0207677_10869369
317 Ga0207708_10016425
318 Ga0207702_10034724
319 Ga0207641_10287673
320 Ga0207648_10032033
321 Ga0207676_10126070
322 Ga0207675_100056886
323 Ga0207675_100263888
324 Ga0207675_100521241
325 Ga0207683_10423425
326 Ga0207698_10447118
327 Ga0268265_10030829
328 Ga0268265_10050107
329 Ga0265334_10093048
330 Ga0265330_10019899
331 Ga0265330_10034301
332 Ga0265332_10000181
333 Ga0265328_10008750
334 Ga0265325_10031431
335 Ga0265329_10019133
336 Ga0265340_10000860
337 Ga0265339_10002563
338 Ga0265339_10168471
339 Ga0265331_10000278
340 Ga0265316_10000317
341 Ga0265316_10001420
342 Ga0307513_10023257
343 Ga0307508_10000396
344 Ga0307508_10060281
345 Ga0265314_10000003
346 Ga0265314_10000842
347 Ga0265342_10002733
348 Ga0307516_10002770
349 Ga0307405_10609718
350 Ga0307410_10596093
351 Ga0307415_100169544
352 Ga0373955_0057270
353 Ga0373933_0109704
354 Ga0373933_0148818
355 Ga0373937_0008005
356 Ga0373937_0816007
357 Ga0436365_0610073
358 Ga0451797_1335187
359 Ga0451807_1257073
360 Ga0451839_1045181
361 Ga0451853_2773787
362 Ga0466964_0129851
363 Ga0466960_0255232
364 Ga0451576_0872267
365 Ga0466967_0214963
366 Ga0495629_0276744
367 Ga0495638_0137500
368 Ga0495651_0012295
369 Ga0495648_0021177
370 Ga0495652_0298122
371 Ga0495587_0034949
372 Ga0495645_0009090
373 Ga0495667_0080399
374 Ga0495668_0015753
375 Ga0495634_0214292
376 Ga0495625_0020779
377 Ga0495635_0445756
378 Ga0495623_0241552
379 Ga0495658_0201680
380 Ga0495649_0016300
381 Ga0495600_0228192
382 Ga0495604_0066318
383 Ga0495604_0401922
384 Ga0495674_0100808
385 Ga0495680_0008200
386 Ga0495680_0269528
387 Ga0495602_0141972
388 Ga0501034_0383168
389 Ga0501038_0081672
390 Ga0501040_0003973
391 Ga0501071_0124654
392 Ga0501072_0007647
393 Ga0501074_0272443
394 Ga0501075_0003586
395 Ga0501076_0110559
396 Ga0501079_0002926
397 Ga0501080_0014504
398 Ga0501081_0001523
399 nmdc:mga05p37_113230_c1
400 nmdc:mga05p37_596762_c1
401 nmdc:mga09592_120889_c1
402 nmdc:mga09592_217276_c1
403 nmdc:mga06r32_217846_c1
404 nmdc:mga06r32_31192_c1
405 nmdc:mga06r32_587221_c1
406 nmdc:mga0n895_161860_c1
407 nmdc:mga0n895_20592_c1
408 nmdc:mga0a205_20177_c1
409 nmdc:mga0a205_74238_c1
410 nmdc:mga0a205_79214_c1
411 Ga0500604_0100490
412 Ga0501084_0033333
413 Ga0501084_0112197
414 Ga0501082_0016363
415 Ga0530510_0025564
416 2854684883

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

9

195

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

15

237

0.94

PF08659

KR

KR domain

10

178

0.84

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

11

236

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xew-assembly1.cif.gz_A structure of serratia marcescens 2,3-butanediol dehydrogenase 0.9485 8 232
5ovk-assembly1.cif.gz_C crystal structure maba bound to nadph from m. smegmatis 0.9445 10 232
3tzq-assembly1.cif.gz_C crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum 0.9439 6 234
1uzn-assembly1.cif.gz_A-2 maba from mycobacterium tuberculosis 0.9433 10 235
6t77-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae fabg(nadph-dependent) nadp-complex at 1.75 a resolution 0.9428 8 235
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9605 5 175 3.40.50.720
3lqfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9469 8 232 3.40.50.720
af_Q0E0D3_22_224_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9463 8 164 3.40.50.720
3tzqC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9439 6 234 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9382 5 237 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7C6ZQN5-F1-model_v4 SDR family oxidoreductase 0.9933 8 236 GO:0016616
GO:0030497
AF-A0A2N2G3Y0-F1-model_v4 Oxidoreductase 0.9906 7 180 GO:0006633
GO:0016616
GO:0048038
AF-A0A2N1PMI5-F1-model_v4 Oxidoreductase 0.9884 5 237 GO:0006633
GO:0016616
GO:0048038
AF-K1T6U1-F1-model_v4 3-oxoacyl-(Acyl-carrier-protein) reductase 0.9867 43 237 GO:0016616
AF-A0A0M9DXE3-F1-model_v4 Oxidoreductase 0.9855 6 236 GO:0016616

Map