F317333

General Info

Members Datasets Scaffolds Average Seq Length
208 129 197 202

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10000729|Ga0070676_1000072915
Length 218
Sequence MSSAASTERVEICYLYAMDTSTALQIFREHLKRYVNFNEAEWILFTQHLSFAKLKKKHYFAESGKVCNKVGFILKGSVRYFHIKDGEDITGYFSFENEFLSSYKSYLTGSPSHVYVQALEDSLLVTFTKKDMDEMLSDPMLAYKMERFGRLIAEQYLCCYEDRVAAFITQTPEERYLELLSNGREILQRMPQHYIANYLGITPVSLSRIRKRILETVR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541283 Pedobacter sp. OK701 Isolate Unclassified
3 2739367651 Pedobacter sp. OK291 Isolate Unclassified
4 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
5 2818991437 Pedobacter terrae 518 Isolate Unclassified
6 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
7 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
8 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
9 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
10 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
11 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
12 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
109 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
112 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
113 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
117 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
118 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
119 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
120 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
121 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
122 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
123 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
124 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
125 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
126 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
127 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
128 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
129 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.71
Metatranscriptomes 0
Isolates 5.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.65
Nodule 0
Rhizoplane 0.48
Rhizosphere 80.77
Stem 0
Stem Tuber 0
Unclassified 10.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_116274 2162886007 Bacteria 23863
2 JGI24737J22298_10003798 3300001990 Bacteria 5313
3 JGI24735J21928_10055556 3300002067 Bacteria 1140
4 JGI25162J39368_1000005 3300002737 Bacteria 435925
5 JGI25165J46597_1015232 3300003214 Bacteria 1039
6 rootH2_10005336 3300003320 Bacteria 90063
7 rootH2_10057394 3300003320 Unclassified 2948
8 rootL2_10029271 3300003322 Bacteria 5186
9 rootH1_10036469 3300003323 Unclassified 2048
10 rootH1_10239481 3300003323 Bacteria 4020
11 Ga0055531_10000239 3300003794 Bacteria 60012
12 Ga0065714_10006608 3300005288 Bacteria 4310
13 Ga0065714_10064604 3300005288 Bacteria 29598
14 Ga0065704_10000193 3300005289 Bacteria 203271
15 Ga0070658_10000028 3300005327 Bacteria 157278
16 Ga0070658_10363569 3300005327 Bacteria 1240
17 Ga0070676_10000729 3300005328 Bacteria 16102
18 Ga0068868_100067489 3300005338 Bacteria 2847
19 Ga0070660_100037380 3300005339 Bacteria 3681
20 Ga0070660_100131343 3300005339 Unclassified 2004
21 Ga0070660_100784730 3300005339 Bacteria 801
22 Ga0070669_100345092 3300005353 Bacteria 1207
23 Ga0070674_100317755 3300005356 Bacteria 1247
24 Ga0070673_100078407 3300005364 Bacteria 2672
25 Ga0070688_100537078 3300005365 Bacteria 887
26 Ga0070659_100005000 3300005366 Bacteria 9499
27 Ga0070659_100277694 3300005366 Bacteria 1393
28 Ga0070662_100000014 3300005457 Bacteria 110124
29 Ga0068853_100023921 3300005539 Bacteria 5120
30 Ga0068853_100062150 3300005539 Bacteria 3231
31 Ga0070665_100000032 3300005548 Bacteria 333352
32 Ga0068855_100032903 3300005563 Bacteria 6190
33 Ga0068855_100155847 3300005563 Bacteria 2595
34 Ga0068855_100162690 3300005563 Bacteria 2532
35 Ga0068857_100036767 3300005577 Bacteria 4338
36 Ga0068856_100000191 3300005614 Bacteria 64613
37 Ga0068856_100000960 3300005614 Bacteria 30788
38 Ga0068852_100028497 3300005616 Bacteria 4572
39 Ga0068852_100199015 3300005616 Bacteria 1895
40 Ga0068852_101073033 3300005616 Unclassified 825
41 Ga0097621_100008782 3300006237 Bacteria 7302
42 Ga0068871_100050991 3300006358 Bacteria 3349
43 Ga0068871_100658628 3300006358 Unclassified 956
44 Ga0105244_10032026 3300009036 Bacteria 2788
45 Ga0105240_10000010 3300009093 Bacteria 537830
46 Ga0105240_10018922 3300009093 Bacteria 9223
47 Ga0105240_10132839 3300009093 Bacteria 2983
48 Ga0105240_10302673 3300009093 Bacteria 1829
49 Ga0105245_10768354 3300009098 Unclassified 1000
50 Ga0105241_10002362 3300009174 Bacteria 14177
51 Ga0105241_10007402 3300009174 Bacteria 8077
52 Ga0105242_11589306 3300009176 Bacteria 687
53 Ga0105237_10002429 3300009545 Bacteria 23143
54 Ga0105237_10003264 3300009545 Bacteria 19375
55 Ga0105237_10019455 3300009545 Bacteria 7011
56 Ga0105237_10341535 3300009545 Bacteria 1502
57 Ga0105238_10009925 3300009551 Bacteria 9546
58 Ga0105238_10091888 3300009551 Bacteria 3022
59 Ga0105238_10206182 3300009551 Unclassified 1942
60 Ga0105239_10000001 3300010375 Bacteria 617353
61 Ga0105239_10019590 3300010375 Bacteria 7468
62 Ga0105239_10066016 3300010375 Bacteria 3975
63 Ga0105239_10958740 3300010375 Unclassified 983
64 Ga0105246_10035275 3300011119 Bacteria 3342
65 Ga0157373_10000136 3300013100 Bacteria 57912
66 Ga0157373_10003820 3300013100 Bacteria 11390
67 Ga0157373_10030765 3300013100 Bacteria 3862
68 Ga0157373_10062381 3300013100 Bacteria 2640
69 Ga0157371_10002946 3300013102 Bacteria 15852
70 Ga0157371_10178341 3300013102 Bacteria 1519
71 Ga0157370_10024231 3300013104 Bacteria 6013
72 Ga0157370_10266882 3300013104 Bacteria 1581
73 Ga0157370_10420230 3300013104 Bacteria 1230
74 Ga0157370_10495122 3300013104 Unclassified 1123
75 Ga0157369_10000040 3300013105 Bacteria 183469
76 Ga0157369_10069765 3300013105 Bacteria 3776
77 Ga0157369_11137177 3300013105 Unclassified 798
78 Ga0157374_10113292 3300013296 Bacteria 2610
79 Ga0157374_10186959 3300013296 Bacteria 2025
80 Ga0157374_10246186 3300013296 Bacteria 1759
81 Ga0157374_10459206 3300013296 Unclassified 1276
82 Ga0157378_10037601 3300013297 Bacteria 4289
83 Ga0163162_10000010 3300013306 Bacteria 302032
84 Ga0163162_10000163 3300013306 Bacteria 61153
85 Ga0163162_10040849 3300013306 Bacteria 4640
86 Ga0157372_10000173 3300013307 Bacteria 71416
87 Ga0157372_10023318 3300013307 Bacteria 6708
88 Ga0182008_10000237 3300014497 Bacteria 42829
89 Ga0157376_10042944 3300014969 Bacteria 3708
90 Ga0182006_1000302 3300015261 Bacteria 43116
91 Ga0182006_1001419 3300015261 Bacteria 14489
92 Ga0182006_1012968 3300015261 Bacteria 3634
93 Ga0182005_1000202 3300015265 Bacteria 40206
94 Ga0163161_10001618 3300017792 Bacteria 16584
95 Ga0213872_10009259 3300021361 Bacteria 4730
96 Ga0209437_100043 3300025233 Bacteria 440454
97 Ga0209233_1005361 3300025261 Bacteria 4260
98 Ga0209257_1000511 3300025304 Bacteria 67499
99 Ga0207655_1025137 3300025728 Bacteria 2898
100 Ga0207647_10000680 3300025904 Bacteria 26722
101 Ga0207647_10013369 3300025904 Bacteria 5693
102 Ga0207645_10000591 3300025907 Bacteria 30054
103 Ga0207705_10000045 3300025909 Bacteria 180625
104 Ga0207705_10267330 3300025909 Bacteria 1307
105 Ga0207654_10001057 3300025911 Bacteria 14992
106 Ga0207654_10026326 3300025911 Bacteria 3149
107 Ga0207695_10000019 3300025913 Bacteria 732137
108 Ga0207695_10050039 3300025913 Bacteria 4399
109 Ga0207695_10082874 3300025913 Bacteria 3241
110 Ga0207695_10205262 3300025913 Bacteria 1883
111 Ga0207671_10000598 3300025914 Bacteria 48008
112 Ga0207671_10008745 3300025914 Bacteria 8532
113 Ga0207671_10011734 3300025914 Bacteria 7099
114 Ga0207657_10009277 3300025919 Bacteria 9911
115 Ga0207657_10263594 3300025919 Bacteria 1371
116 Ga0207681_10318831 3300025923 Bacteria 1235
117 Ga0207694_10256111 3300025924 Bacteria 1433
118 Ga0207694_10462165 3300025924 Bacteria 1060
119 Ga0207687_10678683 3300025927 Bacteria 873
120 Ga0207690_10030399 3300025932 Bacteria 3445
121 Ga0207690_10134648 3300025932 Unclassified 1813
122 Ga0207706_10000057 3300025933 Bacteria 112805
123 Ga0207704_10000266 3300025938 Bacteria 25142
124 Ga0207667_10060807 3300025949 Bacteria 3954
125 Ga0207667_10139646 3300025949 Bacteria 2495
126 Ga0207640_10791097 3300025981 Bacteria 821
127 Ga0207677_10035102 3300026023 Bacteria 3253
128 Ga0207639_10011707 3300026041 Bacteria 6100
129 Ga0207639_10084747 3300026041 Unclassified 2518
130 Ga0207639_10375745 3300026041 Bacteria 1275
131 Ga0207639_10448403 3300026041 Bacteria 1171
132 Ga0207702_10003100 3300026078 Bacteria 15419
133 Ga0207702_10006957 3300026078 Bacteria 9686
134 Ga0207702_10532227 3300026078 Bacteria 1148
135 Ga0207648_10014266 3300026089 Bacteria 7345
136 Ga0207674_10056447 3300026116 Bacteria 3988
137 Ga0207683_10288650 3300026121 Bacteria 1500
138 Ga0268266_10000030 3300028379 Bacteria 417120
139 Ga0307517_10036080 3300028786 Bacteria 5573
140 Ga0307515_10000174 3300028794 Bacteria 157501
141 Ga0307515_10088637 3300028794 Bacteria 3908
142 Ga0265327_10198734 3300031251 Bacteria 909
143 Ga0307405_10000003 3300031731 Bacteria 569064
144 Ga0307412_10000067 3300031911 Bacteria 115549
145 Ga0307409_100003194 3300031995 Bacteria 8814
146 Ga0307416_100000014 3300032002 Bacteria 249053
147 Ga0307414_10006685 3300032004 Bacteria 6450
148 Ga0307414_10011105 3300032004 Bacteria 5267
149 Ga0307414_10297359 3300032004 Unclassified 1364
150 Ga0307411_10133213 3300032005 Bacteria 1820
151 Ga0307510_10000464 3300033180 Bacteria 39482
152 Ga0395899_0000887 3300037312 Bacteria 28407
153 Ga0395899_0119608 3300037312 Bacteria 1888
154 Ga0395900_0000143 3300037418 Bacteria 120234
155 Ga0395900_0003189 3300037418 Bacteria 17771
156 Ga0395900_0105430 3300037418 Bacteria 2896
157 Ga0395900_0581547 3300037418 Bacteria 1062
158 Ga0395898_0004789 3300037466 Bacteria 14725
159 Ga0395905_0000175 3300037471 Bacteria 104024
160 Ga0395905_0000981 3300037471 Bacteria 36581
161 Ga0395901_0000313 3300038443 Bacteria 59766
162 Ga0395901_0009480 3300038443 Bacteria 9877
163 Ga0395901_0123490 3300038443 Bacteria 2721
164 Ga0436361_1115729 3300039447 Bacteria 13860
165 Ga0439448_0001918 3300042005 Bacteria 5538
166 Ga0466972_0000055 3300044658 Bacteria 111338
167 Ga0495605_0155466 3300046474 Bacteria 1018
168 Ga0495596_0039913 3300046500 Bacteria 1853
169 Ga0495606_0025977 3300046507 Bacteria 4181
170 Ga0495606_0130952 3300046507 Bacteria 1491
171 Ga0495606_0210759 3300046507 Bacteria 1101
172 Ga0495606_0230212 3300046507 Unclassified 1039
173 Ga0495632_0196214 3300046519 Bacteria 921
174 Ga0495661_0000134 3300046665 Bacteria 87487
175 Ga0495661_0030646 3300046665 Bacteria 3422
176 Ga0495661_0263712 3300046665 Unclassified 874
177 Ga0495649_0019673 3300046694 Bacteria 3792
178 Ga0495686_0000492 3300047472 Bacteria 57976
179 Ga0495686_0000973 3300047472 Bacteria 35208
180 Ga0496115_0496457 3300048918 Bacteria 981
181 Ga0496116_0187934 3300048919 Bacteria 1097
182 Ga0496122_0000591 3300048925 Bacteria 74549
183 Ga0496123_0003951 3300048926 Bacteria 16069
184 Ga0496126_0043682 3300048929 Bacteria 4132
185 Ga0496126_0473233 3300048929 Bacteria 1005
186 Ga0500583_0016678 3300053092 Bacteria 2939
187 Ga0500569_000639 3300053109 Bacteria 5986
188 Ga0500607_210216 3300053121 Bacteria 824
189 Ga0500608_034323 3300053122 Bacteria 2416
190 Ga0500658_0005242 3300053134 Bacteria 4820
191 Ga0500577_0000229 3300053142 Bacteria 14905
192 Ga0500604_0001066 3300053151 Bacteria 7661
193 Ga0500622_0000026 3300053156 Bacteria 235660
194 Ga0500622_0000084 3300053156 Bacteria 100802
195 Ga0500622_0000606 3300053156 Bacteria 32518
196 Ga0500633_0000516 3300053160 Bacteria 6203
197 Ga0500634_0150575 3300053161 Bacteria 1088

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10029271 rootL2_100292715 180
2 3300009545 Ga0105237_10019455 Ga0105237_100194554 191
3 3300013104 Ga0157370_10024231 Ga0157370_100242317 191
4 3300014497 Ga0182008_10000237 Ga0182008_100002375 191
5 3300015261 Ga0182006_1012968 Ga0182006_10129683 191
6 3300025914 Ga0207671_10011734 Ga0207671_100117344 191
7 3300048925 Ga0496122_0000591 Ga0496122_0000591_32166_32786 191
8 3300048926 Ga0496123_0003951 Ga0496123_0003951_12685_13305 191
9 3300003323 rootH1_10239481 rootH1_102394811 193
10 3300017792 Ga0163161_10001618 Ga0163161_100016184 193
11 3300028794 Ga0307515_10000174 Ga0307515_10000174110 194
12 3300047472 Ga0495686_0000492 Ga0495686_0000492_35069_35665 194
13 3300053156 Ga0500622_0000606 Ga0500622_0000606_24120_24725 194
14 3300002737 JGI25162J39368_1000005 JGI25162J39368_100000586 195
15 3300003794 Ga0055531_10000239 Ga0055531_1000023923 195
16 3300005353 Ga0070669_100345092 Ga0070669_1003450922 195
17 3300013100 Ga0157373_10062381 Ga0157373_100623813 195
18 3300025233 Ga0209437_100043 Ga0209437_100043311 195
19 3300025304 Ga0209257_1000511 Ga0209257_100051142 195
20 3300025923 Ga0207681_10318831 Ga0207681_103188312 195
21 3300044658 Ga0466972_0000055 Ga0466972_0000055_73371_73973 195
22 3300048929 Ga0496126_0043682 Ga0496126_0043682_801_1391 195
23 3300053121 Ga0500607_210216 Ga0500607_210216_113_703 195
24 3300053151 Ga0500604_0001066 Ga0500604_0001066_6543_7133 195
25 3300053156 Ga0500622_0000026 Ga0500622_0000026_110565_111155 195
26 3300053156 Ga0500622_0000084 Ga0500622_0000084_29469_30059 195
27 3300053160 Ga0500633_0000516 Ga0500633_0000516_3836_4426 195
28 iso_pu_bacteria 2818991437 2819546532 195
29 3300053109 Ga0500569_000639 Ga0500569_000639_2513_3124 196
30 3300053134 Ga0500658_0005242 Ga0500658_0005242_2923_3534 196
31 3300053142 Ga0500577_0000229 Ga0500577_0000229_5469_6080 196
32 iso_pu_bacteria 2739367651 2739590868 196
33 iso_pu_bacteria 2842722452 2842725227 196
34 iso_pu_bacteria 2842909656 2842912502 196
35 iso_pu_bacteria 2919437846 2919438287 196
36 iso_pu_bacteria 2945997725 2946002149 196
37 iso_pu_bacteria 2954016120 2954019049 196
38 3300046507 Ga0495606_0130952 Ga0495606_0130952_799_1398 198
39 iso_pu_bacteria 2818991442 2819577455 198
40 iso_pu_bacteria 2910245624 2910250673 198
41 3300005288 Ga0065714_10064604 Ga0065714_1006460417 199
42 3300009036 Ga0105244_10032026 Ga0105244_100320262 199
43 3300013306 Ga0163162_10000163 Ga0163162_1000016321 199
44 3300015261 Ga0182006_1000302 Ga0182006_100030222 199
45 3300025728 Ga0207655_1025137 Ga0207655_10251372 199
46 3300025927 Ga0207687_10678683 Ga0207687_106786831 199
47 3300048919 Ga0496116_0187934 Ga0496116_0187934_24_623 199
48 3300001990 JGI24737J22298_10003798 JGI24737J22298_100037982 200
49 3300002067 JGI24735J21928_10055556 JGI24735J21928_100555562 200
50 3300003214 JGI25165J46597_1015232 JGI25165J46597_10152321 200
51 3300003320 rootH2_10005336 rootH2_1000533661 200
52 3300003320 rootH2_10057394 rootH2_100573941 200
53 3300003323 rootH1_10036469 rootH1_100364692 200
54 3300005288 Ga0065714_10006608 Ga0065714_100066083 200
55 3300005327 Ga0070658_10000028 Ga0070658_1000002872 200
56 3300005327 Ga0070658_10363569 Ga0070658_103635691 200
57 3300005339 Ga0070660_100037380 Ga0070660_1000373803 200
58 3300005339 Ga0070660_100131343 Ga0070660_1001313432 200
59 3300005339 Ga0070660_100784730 Ga0070660_1007847301 200
60 3300005356 Ga0070674_100317755 Ga0070674_1003177551 200
61 3300005366 Ga0070659_100005000 Ga0070659_1000050004 200
62 3300005366 Ga0070659_100277694 Ga0070659_1002776942 200
63 3300005457 Ga0070662_100000014 Ga0070662_10000001453 200
64 3300005539 Ga0068853_100023921 Ga0068853_1000239212 200
65 3300005539 Ga0068853_100062150 Ga0068853_1000621502 200
66 3300005548 Ga0070665_100000032 Ga0070665_100000032201 200
67 3300005563 Ga0068855_100032903 Ga0068855_1000329033 200
68 3300005563 Ga0068855_100155847 Ga0068855_1001558472 200
69 3300005563 Ga0068855_100162690 Ga0068855_1001626902 200
70 3300005577 Ga0068857_100036767 Ga0068857_1000367672 200
71 3300005614 Ga0068856_100000191 Ga0068856_10000019121 200
72 3300005614 Ga0068856_100000960 Ga0068856_10000096028 200
73 3300005616 Ga0068852_100199015 Ga0068852_1001990152 200
74 3300005616 Ga0068852_101073033 Ga0068852_1010730331 200
75 3300006237 Ga0097621_100008782 Ga0097621_1000087826 200
76 3300006358 Ga0068871_100050991 Ga0068871_1000509912 200
77 3300006358 Ga0068871_100658628 Ga0068871_1006586281 200
78 3300009093 Ga0105240_10000010 Ga0105240_1000001072 200
79 3300009093 Ga0105240_10018922 Ga0105240_100189223 200
80 3300009093 Ga0105240_10132839 Ga0105240_101328394 200
81 3300009093 Ga0105240_10302673 Ga0105240_103026732 200
82 3300009098 Ga0105245_10768354 Ga0105245_107683542 200
83 3300009174 Ga0105241_10002362 Ga0105241_100023628 200
84 3300009174 Ga0105241_10007402 Ga0105241_100074025 200
85 3300009176 Ga0105242_11589306 Ga0105242_115893061 200
86 3300009545 Ga0105237_10002429 Ga0105237_1000242912 200
87 3300009545 Ga0105237_10003264 Ga0105237_1000326412 200
88 3300009545 Ga0105237_10341535 Ga0105237_103415352 200
89 3300009551 Ga0105238_10091888 Ga0105238_100918881 200
90 3300009551 Ga0105238_10206182 Ga0105238_102061822 200
91 3300010375 Ga0105239_10000001 Ga0105239_10000001291 200
92 3300010375 Ga0105239_10019590 Ga0105239_100195903 200
93 3300010375 Ga0105239_10066016 Ga0105239_100660165 200
94 3300010375 Ga0105239_10958740 Ga0105239_109587401 200
95 3300011119 Ga0105246_10035275 Ga0105246_100352753 200
96 3300013100 Ga0157373_10003820 Ga0157373_100038205 200
97 3300013100 Ga0157373_10030765 Ga0157373_100307653 200
98 3300013102 Ga0157371_10002946 Ga0157371_1000294615 200
99 3300013102 Ga0157371_10178341 Ga0157371_101783412 200
100 3300013104 Ga0157370_10420230 Ga0157370_104202302 200
101 3300013104 Ga0157370_10495122 Ga0157370_104951221 200
102 3300013105 Ga0157369_10069765 Ga0157369_100697653 200
103 3300013105 Ga0157369_11137177 Ga0157369_111371771 200
104 3300013296 Ga0157374_10113292 Ga0157374_101132922 200
105 3300013296 Ga0157374_10186959 Ga0157374_101869592 200
106 3300013296 Ga0157374_10246186 Ga0157374_102461862 200
107 3300013296 Ga0157374_10459206 Ga0157374_104592062 200
108 3300013297 Ga0157378_10037601 Ga0157378_100376014 200
109 3300013306 Ga0163162_10000010 Ga0163162_10000010261 200
110 3300013306 Ga0163162_10040849 Ga0163162_100408494 200
111 3300013307 Ga0157372_10000173 Ga0157372_1000017331 200
112 3300013307 Ga0157372_10023318 Ga0157372_100233184 200
113 3300014969 Ga0157376_10042944 Ga0157376_100429444 200
114 3300015261 Ga0182006_1001419 Ga0182006_10014194 200
115 3300021361 Ga0213872_10009259 Ga0213872_100092594 200
116 3300025261 Ga0209233_1005361 Ga0209233_10053613 200
117 3300025904 Ga0207647_10000680 Ga0207647_1000068014 200
118 3300025904 Ga0207647_10013369 Ga0207647_100133695 200
119 3300025909 Ga0207705_10000045 Ga0207705_1000004572 200
120 3300025909 Ga0207705_10267330 Ga0207705_102673302 200
121 3300025911 Ga0207654_10001057 Ga0207654_1000105712 200
122 3300025911 Ga0207654_10026326 Ga0207654_100263262 200
123 3300025913 Ga0207695_10000019 Ga0207695_10000019379 200
124 3300025913 Ga0207695_10050039 Ga0207695_100500393 200
125 3300025913 Ga0207695_10082874 Ga0207695_100828743 200
126 3300025913 Ga0207695_10205262 Ga0207695_102052622 200
127 3300025914 Ga0207671_10000598 Ga0207671_1000059847 200
128 3300025914 Ga0207671_10008745 Ga0207671_100087451 200
129 3300025919 Ga0207657_10009277 Ga0207657_1000927712 200
130 3300025919 Ga0207657_10263594 Ga0207657_102635942 200
131 3300025924 Ga0207694_10256111 Ga0207694_102561112 200
132 3300025932 Ga0207690_10030399 Ga0207690_100303993 200
133 3300025932 Ga0207690_10134648 Ga0207690_101346482 200
134 3300025933 Ga0207706_10000057 Ga0207706_1000005783 200
135 3300025949 Ga0207667_10060807 Ga0207667_100608073 200
136 3300025949 Ga0207667_10139646 Ga0207667_101396462 200
137 3300025981 Ga0207640_10791097 Ga0207640_107910971 200
138 3300026041 Ga0207639_10011707 Ga0207639_100117073 200
139 3300026041 Ga0207639_10375745 Ga0207639_103757452 200
140 3300026041 Ga0207639_10448403 Ga0207639_104484032 200
141 3300026078 Ga0207702_10003100 Ga0207702_1000310011 200
142 3300026078 Ga0207702_10006957 Ga0207702_100069579 200
143 3300026078 Ga0207702_10532227 Ga0207702_105322272 200
144 3300026116 Ga0207674_10056447 Ga0207674_100564472 200
145 3300028379 Ga0268266_10000030 Ga0268266_10000030129 200
146 3300028786 Ga0307517_10036080 Ga0307517_100360802 200
147 3300031251 Ga0265327_10198734 Ga0265327_101987342 200
148 3300031731 Ga0307405_10000003 Ga0307405_10000003269 200
149 3300031995 Ga0307409_100003194 Ga0307409_1000031944 200
150 3300032002 Ga0307416_100000014 Ga0307416_10000001480 200
151 3300033180 Ga0307510_10000464 Ga0307510_1000046436 200
152 3300037312 Ga0395899_0000887 Ga0395899_0000887_8736_9341 200
153 3300037312 Ga0395899_0119608 Ga0395899_0119608_1104_1709 200
154 3300037418 Ga0395900_0000143 Ga0395900_0000143_9904_10509 200
155 3300037418 Ga0395900_0003189 Ga0395900_0003189_13438_14043 200
156 3300037418 Ga0395900_0105430 Ga0395900_0105430_172_777 200
157 3300037418 Ga0395900_0581547 Ga0395900_0581547_335_937 200
158 3300037466 Ga0395898_0004789 Ga0395898_0004789_3578_4183 200
159 3300037471 Ga0395905_0000175 Ga0395905_0000175_22172_22777 200
160 3300037471 Ga0395905_0000981 Ga0395905_0000981_202_807 200
161 3300038443 Ga0395901_0000313 Ga0395901_0000313_19056_19661 200
162 3300038443 Ga0395901_0009480 Ga0395901_0009480_170_775 200
163 3300038443 Ga0395901_0123490 Ga0395901_0123490_736_1338 200
164 3300039447 Ga0436361_1115729 Ga0436361_1115729_10432_11037 200
165 3300042005 Ga0439448_0001918 Ga0439448_0001918_191_796 200
166 3300046500 Ga0495596_0039913 Ga0495596_0039913_136_741 200
167 3300046507 Ga0495606_0025977 Ga0495606_0025977_1489_2094 200
168 3300046507 Ga0495606_0230212 Ga0495606_0230212_46_651 200
169 3300046519 Ga0495632_0196214 Ga0495632_0196214_215_820 200
170 3300046665 Ga0495661_0263712 Ga0495661_0263712_101_706 200
171 3300046694 Ga0495649_0019673 Ga0495649_0019673_2254_2859 200
172 3300047472 Ga0495686_0000973 Ga0495686_0000973_8545_9147 200
173 3300048918 Ga0496115_0496457 Ga0496115_0496457_50_655 200
174 3300048929 Ga0496126_0473233 Ga0496126_0473233_60_665 200
175 3300053092 Ga0500583_0016678 Ga0500583_0016678_1474_2097 200
176 3300053122 Ga0500608_034323 Ga0500608_034323_822_1427 200
177 3300053161 Ga0500634_0150575 Ga0500634_0150575_298_921 200
178 iso_pu_bacteria 2738541283 2738757261 200
179 iso_pu_bacteria 2775506987 2776613215 200
180 3300013105 Ga0157369_10000040 Ga0157369_10000040130 202
181 3300015265 Ga0182005_1000202 Ga0182005_100020235 202
182 3300028794 Ga0307515_10088637 Ga0307515_100886373 202
183 3300032004 Ga0307414_10011105 Ga0307414_100111053 202
184 3300032005 Ga0307411_10133213 Ga0307411_101332132 202
185 3300046474 Ga0495605_0155466 Ga0495605_0155466_176_787 202
186 3300046507 Ga0495606_0210759 Ga0495606_0210759_211_822 202
187 3300046665 Ga0495661_0000134 Ga0495661_0000134_67493_68104 202
188 3300046665 Ga0495661_0030646 Ga0495661_0030646_277_888 202
189 2162886007 SwRhRL2b_contig_116274 SwRhRL2b_0694.00004610 204
190 3300005289 Ga0065704_10000193 Ga0065704_1000019395 204
191 3300005328 Ga0070676_10000729 Ga0070676_1000072915 204
192 3300005338 Ga0068868_100067489 Ga0068868_1000674891 204
193 3300005364 Ga0070673_100078407 Ga0070673_1000784071 204
194 3300005365 Ga0070688_100537078 Ga0070688_1005370781 204
195 3300005616 Ga0068852_100028497 Ga0068852_1000284972 204
196 3300009551 Ga0105238_10009925 Ga0105238_1000992510 204
197 3300013100 Ga0157373_10000136 Ga0157373_1000013645 204
198 3300013104 Ga0157370_10266882 Ga0157370_102668822 204
199 3300025907 Ga0207645_10000591 Ga0207645_100005912 204
200 3300025924 Ga0207694_10462165 Ga0207694_104621652 204
201 3300025938 Ga0207704_10000266 Ga0207704_1000026611 204
202 3300026023 Ga0207677_10035102 Ga0207677_100351021 204
203 3300026041 Ga0207639_10084747 Ga0207639_100847473 204
204 3300026089 Ga0207648_10014266 Ga0207648_100142665 204
205 3300026121 Ga0207683_10288650 Ga0207683_102886502 204
206 3300031911 Ga0307412_10000067 Ga0307412_1000006793 204
207 3300032004 Ga0307414_10006685 Ga0307414_100066854 204
208 3300032004 Ga0307414_10297359 Ga0307414_102973592 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

51

138

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dn7-assembly1.cif.gz_A cyclic nucleotide binding regulatory protein from cytophaga hutchinsonii. 0.8726 7 156
3dn7-assembly1.cif.gz_A cyclic nucleotide binding regulatory protein from cytophaga hutchinsonii. 0.8618 7 156
8qto-assembly1.cif.gz_A-2 crystal structure of holo-l28h-fnr of a. fischeri 0.8592 17 203
7ssb-assembly1.cif.gz_A co-structure of pkg1 regulatory domain with compound 33 0.8481 9 121
5j3u-assembly1.cif.gz_A co-crystal structure of the regulatory domain of toxoplasma gondii pka with camp 0.8465 5 121
ID Description Score Start End Superfamily
3dn7A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8867 12 148 2.60.120.10
5kbfB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8512 5 121 2.60.120.10
5j3uA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8465 5 121 2.60.120.10
af_A0A1D6G3C8_362_502_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.846 11 152 2.60.120.10
af_Q5A368_580_696_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8391 32 124 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3G8WYU9-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9807 9 204
AF-A0A5B8VBR4-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9766 10 203
AF-A0A1G9P583-F1-model_v4 cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases 0.9753 1 201 GO:0016301
AF-A0A4Q3EQ68-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9746 35 203
AF-A0A5M9HDM7-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9729 1 200

Feature Viewer

pLDDT pTM Quality
94.35 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map