F317158

General Info

Members Datasets Scaffolds Average Seq Length
207 178 414 229

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2912757875|2912758539
Length 251
Sequence IVSGTGTEIGKTVVTAAVAATALARDLDVAVLKPAQTGVGSDEPGDVDEVIRLAGGVTTVELARFPEPLAPATAARRAGAPPVRPHEIAETAGKLATEHDLVLVEGAGGLLVRFDEEGGTLADAARLLAAPVLVVAPAGLGTLNTTALTAEALRARGLAALGLVIGSWPAVPDLAARCNLADLPDVAGAPLLGAVPHGAGALTPARFRRSAADWLAPALGGGWDVARFTADAAPGARSRAAWDAGTGSAER

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
6 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
7 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
17 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
25 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
26 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
27 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
28 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
29 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
40 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
41 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
42 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
43 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
48 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
49 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
50 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
53 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
54 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
55 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
56 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
57 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
58 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
59 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
60 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
61 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
62 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
65 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
66 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
67 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
68 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
69 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
70 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
71 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
72 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
73 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
74 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
75 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
76 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
77 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
80 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
84 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
94 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
95 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
98 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
99 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
100 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
101 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
124 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
125 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
126 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
127 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
128 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
129 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
130 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
131 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
132 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
133 2643221647 Streptomyces sp. Root369 Isolate Unclassified
134 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
135 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
136 2643221714 Streptomyces sp. Root264 Isolate Unclassified
137 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
138 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
139 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
140 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
141 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
142 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
143 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
144 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
145 2808606448 Streptomyces sp. 193411 Isolate Unclassified
146 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
147 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
148 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
149 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
150 2867369537 Streptomyces sp. Z26 Isolate Unclassified
151 2867428634 Streptomyces sp. RP5T Isolate Unclassified
152 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
153 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
154 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
155 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
156 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
157 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
158 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
159 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
160 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
161 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
162 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
163 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
164 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
165 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
166 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
167 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
168 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
169 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
170 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
171 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
172 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
173 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
174 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
175 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
176 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
177 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
178 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.4
Metatranscriptomes 0.97
Isolates 24.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.83
Nodule 0.97
Rhizoplane 2.42
Rhizosphere 77.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10056318 3300003323 Bacteria 7550
2 JGI25160J50197_1038129 3300003354 Bacteria 1142
3 Ga0006562J51391_1073935 3300003578 Bacteria 1270
4 Ga0006562J51391_1073936 3300003578 Bacteria 1190
5 Ga0070683_100033044 3300005329 Bacteria 4714
6 Ga0070683_100485984 3300005329 Bacteria 1179
7 Ga0068867_100133947 3300005459 Bacteria 1929
8 Ga0070686_100505024 3300005544 Bacteria 939
9 Ga0070704_100333927 3300005549 Bacteria 1274
10 Ga0068857_100525229 3300005577 Bacteria 1113
11 Ga0068854_100166180 3300005578 Bacteria 1713
12 Ga0070702_100002668 3300005615 Bacteria 7788
13 Ga0068859_100132023 3300005617 Bacteria 2569
14 Ga0068864_100237380 3300005618 Bacteria 1688
15 Ga0075363_100294445 3300006048 Bacteria 941
16 Ga0075367_10013332 3300006178 Bacteria 4416
17 Ga0097620_100132020 3300006931 Bacteria 2569
18 Ga0105251_10172385 3300009011 Bacteria 975
19 Ga0105250_10161881 3300009092 Bacteria 934
20 Ga0105245_10036055 3300009098 Bacteria 4392
21 Ga0105245_10219145 3300009098 Bacteria 1835
22 Ga0105243_10031026 3300009148 Bacteria 4120
23 Ga0105249_10073516 3300009553 Bacteria 3162
24 Ga0157369_10220648 3300013105 Bacteria 1985
25 Ga0157375_10473881 3300013308 Bacteria 1417
26 Ga0163163_10501714 3300014325 Bacteria 1275
27 Ga0182008_10003514 3300014497 Bacteria 9442
28 Ga0157376_10499130 3300014969 Bacteria 1196
29 Ga0182007_10000170 3300015262 Bacteria 44373
30 Ga0209758_1012053 3300025297 Bacteria 4901
31 Ga0207426_1002017 3300025302 Bacteria 14333
32 Ga0207426_1002278 3300025302 Bacteria 12662
33 Ga0207426_1045661 3300025302 Bacteria 1331
34 Ga0207687_10105106 3300025927 Bacteria 2086
35 Ga0207709_10083285 3300025935 Bacteria 2068
36 Ga0207661_10431535 3300025944 Bacteria 1198
37 Ga0207661_10436920 3300025944 Bacteria 1190
38 Ga0207679_10551003 3300025945 Bacteria 1035
39 Ga0207703_10408318 3300026035 Bacteria 1261
40 Ga0207648_10190476 3300026089 Bacteria 1817
41 Ga0207676_10611018 3300026095 Bacteria 1048
42 Ga0207675_100169644 3300026118 Bacteria 2085
43 Ga0307517_10122853 3300028786 Bacteria 1910
44 Ga0307515_10095932 3300028794 Bacteria 3643
45 Ga0307511_10084924 3300030521 Bacteria 2193
46 Ga0307512_10064209 3300030522 Bacteria 2798
47 Ga0307513_10066836 3300031456 Bacteria 3775
48 Ga0307509_10343442 3300031507 Bacteria 1219
49 Ga0307516_10243925 3300031730 Bacteria 1494
50 Ga0307410_10094797 3300031852 Bacteria 2127
51 Ga0307409_100372869 3300031995 Bacteria 1354
52 Ga0307416_100232329 3300032002 Bacteria 1779
53 Ga0307415_100142305 3300032126 Bacteria 1834
54 Ga0395900_0294469 3300037418 Bacteria 1611
55 Ga0395898_0026940 3300037466 Bacteria 5776
56 Ga0436364_0382334 3300037853 Bacteria 20372
57 Ga0395901_0334593 3300038443 Bacteria 1565
58 Ga0439449_0087879 3300042007 Bacteria 1147
59 Ga0439457_001738 3300042014 Bacteria 6451
60 Ga0439462_0020599 3300042015 Bacteria 1720
61 Ga0450898_002040 3300042134 Bacteria 2769
62 Ga0450899_005803 3300042135 Bacteria 1330
63 Ga0450906_000760 3300042145 Bacteria 7004
64 Ga0466972_0051929 3300044658 Bacteria 1977
65 Ga0466965_0016133 3300044683 Bacteria 3550
66 Ga0466965_0179133 3300044683 Bacteria 1118
67 Ga0466966_0011697 3300044684 Bacteria 5817
68 Ga0466961_0001765 3300044693 Bacteria 13416
69 Ga0466963_0000303 3300044694 Bacteria 22217
70 Ga0466970_0007699 3300044765 Bacteria 5405
71 Ga0466960_0182924 3300044901 Bacteria 1137
72 Ga0495617_003333 3300046452 Bacteria 6071
73 Ga0495617_072418 3300046452 Bacteria 1133
74 Ga0495592_0355892 3300046454 Bacteria 937
75 Ga0495603_0051670 3300046455 Bacteria 2441
76 Ga0495603_0276979 3300046455 Bacteria 964
77 Ga0495629_0158632 3300046459 Bacteria 1571
78 Ga0495629_0184211 3300046459 Bacteria 1446
79 Ga0495605_0001821 3300046474 Bacteria 13622
80 Ga0495605_0066313 3300046474 Bacteria 1715
81 Ga0495584_0153580 3300046491 Bacteria 1169
82 Ga0495594_0012706 3300046499 Bacteria 4392
83 Ga0495594_0023118 3300046499 Bacteria 3329
84 Ga0495594_0163773 3300046499 Bacteria 1264
85 Ga0495607_0023993 3300046501 Bacteria 3809
86 Ga0495607_0070250 3300046501 Bacteria 1957
87 Ga0495583_0057096 3300046506 Bacteria 1757
88 Ga0495606_0005990 3300046507 Bacteria 11397
89 Ga0495610_0156133 3300046512 Bacteria 969
90 Ga0495616_0002310 3300046513 Bacteria 12756
91 Ga0495620_0028869 3300046515 Bacteria 2573
92 Ga0495628_0032166 3300046516 Bacteria 4237
93 Ga0495643_0001589 3300046522 Bacteria 20162
94 Ga0495648_0043754 3300046524 Bacteria 2803
95 Ga0495652_0229591 3300046529 Bacteria 1389
96 Ga0495640_0019064 3300046533 Bacteria 5072
97 Ga0495622_0020843 3300046557 Bacteria 3051
98 Ga0495667_0535730 3300046559 Bacteria 732
99 Ga0495668_0033011 3300046616 Bacteria 2909
100 Ga0495634_0073785 3300046642 Bacteria 2243
101 Ga0495611_0116636 3300046648 Bacteria 1244
102 Ga0495635_0075591 3300046663 Bacteria 2307
103 Ga0495646_0188073 3300046680 Bacteria 1130
104 Ga0495613_0012215 3300046689 Bacteria 6381
105 Ga0495589_0026381 3300046794 Bacteria 2943
106 Ga0495589_0062196 3300046794 Bacteria 1831
107 Ga0495600_0047883 3300046809 Bacteria 2789
108 Ga0495581_0085755 3300047315 Bacteria 1826
109 Ga0495604_0040360 3300047317 Bacteria 3665
110 Ga0495604_0122206 3300047317 Bacteria 1883
111 Ga0495636_0021767 3300047318 Bacteria 2590
112 Ga0495636_0037942 3300047318 Bacteria 1991
113 Ga0495636_0090933 3300047318 Bacteria 1325
114 Ga0495676_0060665 3300047321 Bacteria 2962
115 Ga0495676_0133126 3300047321 Bacteria 1791
116 Ga0495683_0097131 3300047323 Bacteria 1420
117 Ga0495687_000668 3300047443 Bacteria 39207
118 Ga0495685_010370 3300047447 Bacteria 3123
119 Ga0495685_025835 3300047447 Bacteria 2021
120 Ga0495593_0124382 3300047673 Bacteria 1311
121 Ga0495626_0020011 3300048091 Bacteria 3340
122 Ga0496109_0022899 3300048912 Bacteria 5537
123 Ga0496109_0127005 3300048912 Bacteria 2378
124 Ga0496109_0644770 3300048912 Bacteria 996
125 Ga0496113_0561347 3300048916 Bacteria 915
126 Ga0501031_0033790 3300049568 Bacteria 3338
127 Ga0501032_0057504 3300049569 Bacteria 2613
128 Ga0501033_0020968 3300049570 Bacteria 4934
129 Ga0501033_0046569 3300049570 Bacteria 3224
130 Ga0501034_0011784 3300049571 Bacteria 9048
131 Ga0501036_0083947 3300049572 Bacteria 2693
132 Ga0501037_0001735 3300049573 Bacteria 15823
133 Ga0501038_0051336 3300049574 Bacteria 3559
134 Ga0501039_0225073 3300049575 Bacteria 1474
135 Ga0501042_0012898 3300049578 Bacteria 5676
136 Ga0501043_0017014 3300049579 Bacteria 5700
137 Ga0501043_0084511 3300049579 Bacteria 2495
138 Ga0501046_0007160 3300049580 Bacteria 9814
139 Ga0501047_0000099 3300049581 Bacteria 106077
140 Ga0501047_0013829 3300049581 Bacteria 7662
141 Ga0501047_0039162 3300049581 Bacteria 4585
142 Ga0501048_0001490 3300049582 Bacteria 17770
143 Ga0501070_0260977 3300049586 Bacteria 1416
144 Ga0501073_0261759 3300049589 Bacteria 1194
145 Ga0501074_0108441 3300049590 Bacteria 1987
146 Ga0501035_0004750 3300049822 Bacteria 12897
147 Ga0501044_0016802 3300049823 Bacteria 7853
148 Ga0501044_0100667 3300049823 Bacteria 2908
149 Ga0501044_0142532 3300049823 Bacteria 2384
150 Ga0501044_0527153 3300049823 Bacteria 1080
151 nmdc:mga06z11_7405_c1 3300050494 Bacteria 4513
152 Ga0495655_0008608 3300053083 Bacteria 1946
153 Ga0500578_0269028 3300053086 Bacteria 1020
154 Ga0500616_0078010 3300053153 Bacteria 1671
155 Ga0501084_0560775 3300054114 Bacteria 965
156 Ga0466962_0013625 3300061719 Bacteria 3913
157 2912758539 2912757875 Bacteria 7940295
158 2547409113 2547132111 Bacteria 8013147
159 2585309702 2582581313 Bacteria 10042643
160 2616693019 2616644814 Bacteria 11555299
161 2616902736 2616644941 Bacteria 8510691
162 2644264264 2643221647 Bacteria 10741251
163 2644430046 2643221677 Bacteria 7584031
164 2644458507 2643221682 Bacteria 6743283
165 2644630047 2643221714 Bacteria 9015452
166 2676198160 2675902999 Bacteria 9438463
167 2768645312 2767802112 Bacteria 6465194
168 2774842738 2773857921 Bacteria 9435764
169 2785366904 2784746768 Bacteria 10036182
170 2786667941 2786546132 Bacteria 10419719
171 2793976562 2791355406 Bacteria 11364898
172 2808847404 2808606359 Bacteria 9866990
173 2808918124 2808606375 Bacteria 9466072
174 2809230017 2808606448 Bacteria 8656184
175 2811846750 2808606982 Bacteria 7791042
176 2819699324 2818991463 Bacteria 7948711
177 2862289964 2862281513 Bacteria 9621493
178 2863407267 2863404153 Bacteria 9672205
179 2867369626 2867369537 Bacteria 6501581
180 2867432548 2867428634 Bacteria 9590268
181 2877683637 2877676314 Bacteria 9512378
182 2918502283 2918501144 Bacteria 8668083
183 2919474362 2919468124 Bacteria 9133025
184 2928146385 2928142448 Bacteria 5288925
185 2935394075 2935390628 Bacteria 7043367
186 2946073690 2946072368 Bacteria 8999607
187 2947232122 2947224130 Bacteria 9938529
188 2954388896 2954380949 Bacteria 10050426
189 2954674227 2954673503 Bacteria 9685905
190 2954689905 2954682443 Bacteria 9862841
191 2954699687 2954691527 Bacteria 10720516
192 2954702513 2954701450 Bacteria 10834262
193 2954718628 2954711539 Bacteria 10867210
194 2954728599 2954721474 Bacteria 10456478
195 2954752093 2954749733 Bacteria 10366972
196 2954766611 2954759201 Bacteria 9358192
197 2966604668 2966598605 Bacteria 7676064
198 3006486813 3006486233 Bacteria 8157040
199 8023628638 8023623736 Bacteria 8593882
200 8025535978 8025530807 Bacteria 8495698
201 8047894474 8047893842 Bacteria 11723082
202 8048134809 8048127548 Bacteria 11053136
203 8048364578 8048356638 Bacteria 11044339
204 8048371491 8048369669 Bacteria 11666822
205 8048380292 8048379754 Bacteria 11877923
206 8048412951 8048406513 Bacteria 8936924
207 8056668753 8056667051 Bacteria 6953971
208 rootH1_10056318
209 JGI25160J50197_1038129
210 Ga0006562J51391_1073935
211 Ga0006562J51391_1073936
212 Ga0070683_100033044
213 Ga0070683_100485984
214 Ga0068867_100133947
215 Ga0070686_100505024
216 Ga0070704_100333927
217 Ga0068857_100525229
218 Ga0068854_100166180
219 Ga0070702_100002668
220 Ga0068859_100132023
221 Ga0068864_100237380
222 Ga0075363_100294445
223 Ga0075367_10013332
224 Ga0097620_100132020
225 Ga0105251_10172385
226 Ga0105250_10161881
227 Ga0105245_10036055
228 Ga0105245_10219145
229 Ga0105243_10031026
230 Ga0105249_10073516
231 Ga0157369_10220648
232 Ga0157375_10473881
233 Ga0163163_10501714
234 Ga0182008_10003514
235 Ga0157376_10499130
236 Ga0182007_10000170
237 Ga0209758_1012053
238 Ga0207426_1002017
239 Ga0207426_1002278
240 Ga0207426_1045661
241 Ga0207687_10105106
242 Ga0207709_10083285
243 Ga0207661_10431535
244 Ga0207661_10436920
245 Ga0207679_10551003
246 Ga0207703_10408318
247 Ga0207648_10190476
248 Ga0207676_10611018
249 Ga0207675_100169644
250 Ga0307517_10122853
251 Ga0307515_10095932
252 Ga0307511_10084924
253 Ga0307512_10064209
254 Ga0307513_10066836
255 Ga0307509_10343442
256 Ga0307516_10243925
257 Ga0307410_10094797
258 Ga0307409_100372869
259 Ga0307416_100232329
260 Ga0307415_100142305
261 Ga0395900_0294469
262 Ga0395898_0026940
263 Ga0436364_0382334
264 Ga0395901_0334593
265 Ga0439449_0087879
266 Ga0439457_001738
267 Ga0439462_0020599
268 Ga0450898_002040
269 Ga0450899_005803
270 Ga0450906_000760
271 Ga0466972_0051929
272 Ga0466965_0016133
273 Ga0466965_0179133
274 Ga0466966_0011697
275 Ga0466961_0001765
276 Ga0466963_0000303
277 Ga0466970_0007699
278 Ga0466960_0182924
279 Ga0495617_003333
280 Ga0495617_072418
281 Ga0495592_0355892
282 Ga0495603_0051670
283 Ga0495603_0276979
284 Ga0495629_0158632
285 Ga0495629_0184211
286 Ga0495605_0001821
287 Ga0495605_0066313
288 Ga0495584_0153580
289 Ga0495594_0012706
290 Ga0495594_0023118
291 Ga0495594_0163773
292 Ga0495607_0023993
293 Ga0495607_0070250
294 Ga0495583_0057096
295 Ga0495606_0005990
296 Ga0495610_0156133
297 Ga0495616_0002310
298 Ga0495620_0028869
299 Ga0495628_0032166
300 Ga0495643_0001589
301 Ga0495648_0043754
302 Ga0495652_0229591
303 Ga0495640_0019064
304 Ga0495622_0020843
305 Ga0495667_0535730
306 Ga0495668_0033011
307 Ga0495634_0073785
308 Ga0495611_0116636
309 Ga0495635_0075591
310 Ga0495646_0188073
311 Ga0495613_0012215
312 Ga0495589_0026381
313 Ga0495589_0062196
314 Ga0495600_0047883
315 Ga0495581_0085755
316 Ga0495604_0040360
317 Ga0495604_0122206
318 Ga0495636_0021767
319 Ga0495636_0037942
320 Ga0495636_0090933
321 Ga0495676_0060665
322 Ga0495676_0133126
323 Ga0495683_0097131
324 Ga0495687_000668
325 Ga0495685_010370
326 Ga0495685_025835
327 Ga0495593_0124382
328 Ga0495626_0020011
329 Ga0496109_0022899
330 Ga0496109_0127005
331 Ga0496109_0644770
332 Ga0496113_0561347
333 Ga0501031_0033790
334 Ga0501032_0057504
335 Ga0501033_0020968
336 Ga0501033_0046569
337 Ga0501034_0011784
338 Ga0501036_0083947
339 Ga0501037_0001735
340 Ga0501038_0051336
341 Ga0501039_0225073
342 Ga0501042_0012898
343 Ga0501043_0017014
344 Ga0501043_0084511
345 Ga0501046_0007160
346 Ga0501047_0000099
347 Ga0501047_0013829
348 Ga0501047_0039162
349 Ga0501048_0001490
350 Ga0501070_0260977
351 Ga0501073_0261759
352 Ga0501074_0108441
353 Ga0501035_0004750
354 Ga0501044_0016802
355 Ga0501044_0100667
356 Ga0501044_0142532
357 Ga0501044_0527153
358 nmdc:mga06z11_7405_c1
359 Ga0495655_0008608
360 Ga0500578_0269028
361 Ga0500616_0078010
362 Ga0501084_0560775
363 Ga0466962_0013625
364 2912758539
365 2547409113
366 2585309702
367 2616693019
368 2616902736
369 2644264264
370 2644430046
371 2644458507
372 2644630047
373 2676198160
374 2768645312
375 2774842738
376 2785366904
377 2786667941
378 2793976562
379 2808847404
380 2808918124
381 2809230017
382 2811846750
383 2819699324
384 2862289964
385 2863407267
386 2867369626
387 2867432548
388 2877683637
389 2918502283
390 2919474362
391 2928146385
392 2935394075
393 2946073690
394 2947232122
395 2954388896
396 2954674227
397 2954689905
398 2954699687
399 2954702513
400 2954718628
401 2954728599
402 2954752093
403 2954766611
404 2966604668
405 3006486813
406 8023628638
407 8025535978
408 8047894474
409 8048134809
410 8048364578
411 8048371491
412 8048380292
413 8048412951
414 8056668753

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13500

AAA_26

AAA domain

1

204

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e06-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis dethiobiotin synthetase in complex with cytidine triphosphate solved by precipitant-ligand exchange (crystals grown in citrate precipitant) 0.8863 2 214
3fmf-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate 0.8744 1 214
3fmf-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate 0.8624 2 223
3fmf-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate 0.8549 2 223
3fmf-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate 0.8231 1 214
ID Description Score Start End Superfamily
3fmfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8836 1 214 3.40.50.300
af_A0A1D8PS31_1_209_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8004 1 202 3.40.50.300
af_Q58695_1_213_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.776 4 189 3.40.50.300
af_Q2FVJ5_2_213_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7693 4 202 3.40.50.300
af_A0A1D8PS31_1_209_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7693 1 202 3.40.50.300
ID Description Score Start End GO Terms
AF-D9XX25-F1-model_v4 Dethiobiotin synthetase 0.997 124 225
AF-A0A2W6PNQ9-F1-model_v4 deleted 0.9957 20 225
AF-B5G8Z5-F1-model_v4 Dethiobiotin synthetase 0.9946 25 225 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A6B2RHC6-F1-model_v4 deleted 0.9939 59 225
AF-A0A6N9UN04-F1-model_v4 Dethiobiotin synthase 0.993 141 225

Map