F316900

General Info

Members Datasets Scaffolds Average Seq Length
207 141 414 210

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0000205|Ga0495643_0000205_4165_4923
Length 252
Sequence MHRKAKKKPSPEGDAISPTPEAGAAGTAQNSQPSPVARLRMLVVDDHPVVRRGLIQTLTEAFPGVLLGEASNAQEAMEQIWNHEWDVVVLDVSMPGRSGLDVLKEVRQERTKLPVLVLSMYPEDEFALRVLQNGAAGYLTKQTAPHELVAAVKKVLSGGRYISPAVAEKLAEHLDRDMEKAPHHLLSDREYQVMCMLASGKTVKEIGGELSLSIKTISTYRSRILEKMLIKNNAELMRYAVEHELVDYRKAR

Samples

Sample ID Description Type Environment
1 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
104 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
141 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.28
Nodule 0
Rhizoplane 0.48
Rhizosphere 90.82
Stem 0
Stem Tuber 0
Unclassified 24.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495643_0000205 3300046522 Bacteria 91900
2 MBSR1b_contig_5761976 2162886012 Bacteria 1105
3 rootL2_10214606 3300003322 Bacteria 4392
4 rootL2_10220579 3300003322 Bacteria 2720
5 rootH1_10001094 3300003323 Bacteria 13959
6 Ga0055526_1016315 3300003771 Bacteria 2916
7 Ga0055537_1003111 3300003773 Bacteria 5211
8 Ga0055524_1000331 3300003775 Bacteria 43988
9 Ga0055534_1000031 3300003784 Bacteria 120517
10 Ga0070690_100465052 3300005330 Unclassified 940
11 Ga0070690_100697561 3300005330 Bacteria 779
12 Ga0070680_100189596 3300005336 Bacteria 1732
13 Ga0070680_100370163 3300005336 Bacteria 1219
14 Ga0070689_100004341 3300005340 Bacteria 9568
15 Ga0070689_100335383 3300005340 Unclassified 1266
16 Ga0070673_100160338 3300005364 Bacteria 1912
17 Ga0070688_100005426 3300005365 Bacteria 6716
18 Ga0070688_100238928 3300005365 Bacteria 1288
19 Ga0070667_100905278 3300005367 Unclassified 821
20 Ga0070709_10066184 3300005434 Unclassified 2317
21 Ga0070713_100539281 3300005436 Bacteria 1104
22 Ga0070701_10208995 3300005438 Unclassified 1158
23 Ga0070701_10289915 3300005438 Bacteria 1002
24 Ga0070681_10005091 3300005458 Bacteria 12681
25 Ga0068867_100398422 3300005459 Bacteria 1160
26 Ga0070706_100577455 3300005467 Bacteria 1045
27 Ga0070699_100287640 3300005518 Bacteria 1473
28 Ga0070679_100465146 3300005530 Bacteria 1209
29 Ga0070679_100737260 3300005530 Bacteria 928
30 Ga0070697_100728945 3300005536 Bacteria 875
31 Ga0070672_100197184 3300005543 Bacteria 1682
32 Ga0070686_100025849 3300005544 Unclassified 3536
33 Ga0070695_100425049 3300005545 Bacteria 1012
34 Ga0070704_100439482 3300005549 Unclassified 1121
35 Ga0070704_100575890 3300005549 Unclassified 987
36 Ga0068855_100381728 3300005563 Bacteria 1547
37 Ga0068855_100741602 3300005563 Bacteria 1048
38 Ga0070664_100139501 3300005564 Bacteria 2134
39 Ga0068857_100045451 3300005577 Bacteria 3896
40 Ga0068854_100221615 3300005578 Bacteria 1497
41 Ga0068852_100424793 3300005616 Unclassified 1311
42 Ga0068859_100102694 3300005617 Bacteria 2917
43 Ga0068859_100285909 3300005617 Bacteria 1742
44 Ga0068864_100151949 3300005618 Unclassified 2098
45 Ga0068864_100269857 3300005618 Unclassified 1585
46 Ga0068866_10577534 3300005718 Unclassified 755
47 Ga0068863_100220020 3300005841 Bacteria 1829
48 Ga0068863_101451085 3300005841 Bacteria 694
49 Ga0068858_100229620 3300005842 Unclassified 1759
50 Ga0070716_100015232 3300006173 Bacteria 3947
51 Ga0070716_100060039 3300006173 Unclassified 2195
52 Ga0070716_100098338 3300006173 Unclassified 1788
53 Ga0070712_100079850 3300006175 Bacteria 2366
54 Ga0075367_10039808 3300006178 Bacteria 2742
55 Ga0097621_100686548 3300006237 Bacteria 942
56 Ga0068871_100225252 3300006358 Bacteria 1626
57 Ga0068871_100735300 3300006358 Bacteria 906
58 Ga0075428_100122474 3300006844 Unclassified 2831
59 Ga0075431_100366604 3300006847 Bacteria 1446
60 Ga0075434_100169962 3300006871 Bacteria 2200
61 Ga0075429_100108186 3300006880 Bacteria 2430
62 Ga0075429_101071977 3300006880 Unclassified 704
63 Ga0075436_100008834 3300006914 Bacteria 6889
64 Ga0075436_100188694 3300006914 Bacteria 1458
65 Ga0075436_100293080 3300006914 Bacteria 1165
66 Ga0075436_100549267 3300006914 Bacteria 848
67 Ga0097620_100102689 3300006931 Bacteria 2917
68 Ga0097620_100285907 3300006931 Bacteria 1742
69 Ga0099794_10121691 3300007265 Bacteria 1313
70 Ga0105240_10182663 3300009093 Bacteria 2474
71 Ga0111539_10098500 3300009094 Bacteria 3434
72 Ga0111539_10204936 3300009094 Unclassified 2299
73 Ga0111539_10562995 3300009094 Bacteria 1327
74 Ga0111539_11103821 3300009094 Bacteria 922
75 Ga0111539_11747972 3300009094 Bacteria 721
76 Ga0105245_10114597 3300009098 Unclassified 2511
77 Ga0105245_10142310 3300009098 Bacteria 2260
78 Ga0105247_10321859 3300009101 Unclassified 1079
79 Ga0114129_10053729 3300009147 Bacteria 5650
80 Ga0114129_10089851 3300009147 Bacteria 4258
81 Ga0105243_10101907 3300009148 Unclassified 2384
82 Ga0105242_10568150 3300009176 Bacteria 1090
83 Ga0105249_10113589 3300009553 Bacteria 2563
84 Ga0157370_10003957 3300013104 Bacteria 17245
85 Ga0157374_10145196 3300013296 Bacteria 2305
86 Ga0157374_11414800 3300013296 Bacteria 718
87 Ga0157378_10045245 3300013297 Bacteria 3910
88 Ga0157378_10222933 3300013297 Unclassified 1793
89 Ga0157378_10764147 3300013297 Bacteria 990
90 Ga0163162_10147860 3300013306 Unclassified 2466
91 Ga0163162_10307319 3300013306 Unclassified 1718
92 Ga0163162_10787029 3300013306 Unclassified 1069
93 Ga0157372_10020787 3300013307 Bacteria 7088
94 Ga0157375_10000017 3300013308 Bacteria 286152
95 Ga0157375_10069117 3300013308 Bacteria 3537
96 Ga0157375_10808892 3300013308 Bacteria 1086
97 Ga0157375_11398596 3300013308 Bacteria 824
98 Ga0163163_10000060 3300014325 Bacteria 121560
99 Ga0163163_10076497 3300014325 Unclassified 3342
100 Ga0157380_10268473 3300014326 Unclassified 1554
101 Ga0157376_10293304 3300014969 Bacteria 1536
102 Ga0163161_10303307 3300017792 Unclassified 1258
103 Ga0206350_10036899 3300020080 Bacteria 1376
104 Ga0206350_11054895 3300020080 Bacteria 792
105 Ga0209565_1000072 3300025263 Bacteria 164988
106 Ga0209673_1031615 3300025273 Bacteria 1644
107 Ga0209675_1000049 3300025291 Bacteria 215042
108 Ga0209564_1000130 3300025295 Bacteria 194399
109 Ga0209256_1000126 3300025299 Bacteria 165242
110 Ga0207656_10342545 3300025321 Bacteria 745
111 Ga0207707_10020852 3300025912 Bacteria 5725
112 Ga0207693_10052757 3300025915 Bacteria 3189
113 Ga0207693_10300358 3300025915 Unclassified 1258
114 Ga0207663_10710219 3300025916 Bacteria 796
115 Ga0207652_10596957 3300025921 Bacteria 990
116 Ga0207681_10140779 3300025923 Unclassified 1796
117 Ga0207659_10129791 3300025926 Bacteria 1944
118 Ga0207687_10160329 3300025927 Unclassified 1725
119 Ga0207687_10198975 3300025927 Unclassified 1564
120 Ga0207700_10219927 3300025928 Bacteria 1609
121 Ga0207700_10395397 3300025928 Bacteria 1210
122 Ga0207706_10827424 3300025933 Unclassified 785
123 Ga0207686_10476137 3300025934 Bacteria 965
124 Ga0207670_10004029 3300025936 Bacteria 7855
125 Ga0207670_10216159 3300025936 Unclassified 1465
126 Ga0207670_10312399 3300025936 Bacteria 1234
127 Ga0207665_10016421 3300025939 Bacteria 4861
128 Ga0207665_10027636 3300025939 Bacteria 3748
129 Ga0207691_10116807 3300025940 Bacteria 2368
130 Ga0207661_10314405 3300025944 Unclassified 1407
131 Ga0207667_10334010 3300025949 Bacteria 1547
132 Ga0207683_10286673 3300026121 Bacteria 1505
133 Ga0207698_10157106 3300026142 Unclassified 1983
134 Ga0207698_11139056 3300026142 Bacteria 793
135 Ga0207428_10088029 3300027907 Unclassified 2415
136 Ga0268265_10025861 3300028380 Unclassified 4172
137 Ga0268264_10221296 3300028381 Unclassified 1743
138 Ga0265334_10033156 3300028573 Bacteria 2057
139 Ga0307517_10019452 3300028786 Bacteria 8710
140 Ga0265338_10034905 3300028800 Bacteria 4848
141 Ga0265338_10122936 3300028800 Bacteria 2065
142 Ga0265338_10314261 3300028800 Bacteria 1136
143 Ga0265324_10042664 3300029957 Unclassified 1568
144 Ga0265339_10285801 3300031249 Unclassified 789
145 Ga0265327_10001688 3300031251 Bacteria 26394
146 Ga0265316_10266134 3300031344 Bacteria 1256
147 Ga0307408_100207873 3300031548 Unclassified 1589
148 Ga0316577_10258067 3300031733 Unclassified 986
149 Ga0307510_10258039 3300033180 Unclassified 1226
150 Ga0373931_0221575 3300035691 Bacteria 1139
151 Ga0373925_0154711 3300037068 Bacteria 1803
152 Ga0373925_0774439 3300037068 Unclassified 791
153 Ga0436361_0849252 3300039447 Unclassified 4796
154 Ga0451577_0017027 3300042876 Bacteria 6722
155 Ga0451577_0366959 3300042876 Bacteria 1306
156 Ga0453683_0004746 3300044673 Bacteria 9586
157 Ga0453683_0156846 3300044673 Unclassified 1439
158 Ga0453683_0253603 3300044673 Bacteria 1122
159 Ga0453684_0004192 3300044712 Bacteria 31040
160 Ga0453684_0287505 3300044712 Bacteria 1873
161 Ga0453684_0678158 3300044712 Unclassified 1122
162 Ga0451576_0011417 3300045051 Bacteria 10093
163 Ga0451576_0659364 3300045051 Bacteria 1100
164 Ga0451576_0704977 3300045051 Bacteria 1061
165 Ga0451576_1577108 3300045051 Bacteria 681
166 Ga0495629_0039751 3300046459 Bacteria 3310
167 Ga0495629_0292156 3300046459 Bacteria 1117
168 Ga0495582_0044375 3300046473 Bacteria 2448
169 Ga0495664_0021795 3300046477 Bacteria 3703
170 Ga0495618_0009700 3300046514 Bacteria 5815
171 Ga0495630_0000401 3300046517 Bacteria 34034
172 Ga0495666_0003375 3300046526 Bacteria 8053
173 Ga0495652_0216736 3300046529 Bacteria 1441
174 Ga0495640_0031395 3300046533 Bacteria 3791
175 Ga0495640_0320344 3300046533 Bacteria 960
176 Ga0495586_0000005 3300046535 Bacteria 171839
177 Ga0495586_0001201 3300046535 Bacteria 14551
178 Ga0495586_0082237 3300046535 Bacteria 1771
179 Ga0495645_0021023 3300046543 Bacteria 4716
180 Ga0495667_0088608 3300046559 Bacteria 2006
181 Ga0495634_0004904 3300046642 Bacteria 10358
182 Ga0495634_0018984 3300046642 Bacteria 4889
183 Ga0495599_0003672 3300046678 Bacteria 8998
184 Ga0495599_0011219 3300046678 Bacteria 5502
185 Ga0495658_0026372 3300046683 Bacteria 3114
186 Ga0495613_0017375 3300046689 Bacteria 5360
187 Ga0495674_0013684 3300047319 Bacteria 7622
188 Ga0495674_0020790 3300047319 Bacteria 6077
189 Ga0495676_0031201 3300047321 Bacteria 4510
190 Ga0495676_0068029 3300047321 Bacteria 2753
191 Ga0496109_0522862 3300048912 Unclassified 1120
192 Ga0501040_0097295 3300049576 Unclassified 2050
193 Ga0501041_0430215 3300049577 Bacteria 837
194 nmdc:mga06z11_85591_c1 3300050494 Bacteria 1701
195 nmdc:mga05p37_111328_c1 3300050507 Bacteria 3367
196 nmdc:mga05p37_132609_c1 3300050507 Bacteria 3056
197 nmdc:mga09592_88129_c1 3300050508 Bacteria 2650
198 nmdc:mga06r32_154370_c1 3300050510 Bacteria 2276
199 nmdc:mga08y16_723024_c1 3300050511 Bacteria 994
200 nmdc:mga08y16_776441_c1 3300050511 Unclassified 953
201 nmdc:mga08y16_89515_c1 3300050511 Bacteria 3207
202 nmdc:mga0n895_195032_c1 3300050512 Bacteria 2056
203 nmdc:mga08x19_12375_c1 3300050514 Bacteria 5140
204 nmdc:mga08x19_604471_c1 3300050514 Bacteria 777
205 Ga0495619_0097046 3300053085 Bacteria 2002
206 Ga0500559_0086030 3300053136 Bacteria 1435
207 Ga0500568_0089591 3300053139 Bacteria 1161
208 Ga0495643_0000205
209 MBSR1b_contig_5761976
210 rootL2_10214606
211 rootL2_10220579
212 rootH1_10001094
213 Ga0055526_1016315
214 Ga0055537_1003111
215 Ga0055524_1000331
216 Ga0055534_1000031
217 Ga0070690_100465052
218 Ga0070690_100697561
219 Ga0070680_100189596
220 Ga0070680_100370163
221 Ga0070689_100004341
222 Ga0070689_100335383
223 Ga0070673_100160338
224 Ga0070688_100005426
225 Ga0070688_100238928
226 Ga0070667_100905278
227 Ga0070709_10066184
228 Ga0070713_100539281
229 Ga0070701_10208995
230 Ga0070701_10289915
231 Ga0070681_10005091
232 Ga0068867_100398422
233 Ga0070706_100577455
234 Ga0070699_100287640
235 Ga0070679_100465146
236 Ga0070679_100737260
237 Ga0070697_100728945
238 Ga0070672_100197184
239 Ga0070686_100025849
240 Ga0070695_100425049
241 Ga0070704_100439482
242 Ga0070704_100575890
243 Ga0068855_100381728
244 Ga0068855_100741602
245 Ga0070664_100139501
246 Ga0068857_100045451
247 Ga0068854_100221615
248 Ga0068852_100424793
249 Ga0068859_100102694
250 Ga0068859_100285909
251 Ga0068864_100151949
252 Ga0068864_100269857
253 Ga0068866_10577534
254 Ga0068863_100220020
255 Ga0068863_101451085
256 Ga0068858_100229620
257 Ga0070716_100015232
258 Ga0070716_100060039
259 Ga0070716_100098338
260 Ga0070712_100079850
261 Ga0075367_10039808
262 Ga0097621_100686548
263 Ga0068871_100225252
264 Ga0068871_100735300
265 Ga0075428_100122474
266 Ga0075431_100366604
267 Ga0075434_100169962
268 Ga0075429_100108186
269 Ga0075429_101071977
270 Ga0075436_100008834
271 Ga0075436_100188694
272 Ga0075436_100293080
273 Ga0075436_100549267
274 Ga0097620_100102689
275 Ga0097620_100285907
276 Ga0099794_10121691
277 Ga0105240_10182663
278 Ga0111539_10098500
279 Ga0111539_10204936
280 Ga0111539_10562995
281 Ga0111539_11103821
282 Ga0111539_11747972
283 Ga0105245_10114597
284 Ga0105245_10142310
285 Ga0105247_10321859
286 Ga0114129_10053729
287 Ga0114129_10089851
288 Ga0105243_10101907
289 Ga0105242_10568150
290 Ga0105249_10113589
291 Ga0157370_10003957
292 Ga0157374_10145196
293 Ga0157374_11414800
294 Ga0157378_10045245
295 Ga0157378_10222933
296 Ga0157378_10764147
297 Ga0163162_10147860
298 Ga0163162_10307319
299 Ga0163162_10787029
300 Ga0157372_10020787
301 Ga0157375_10000017
302 Ga0157375_10069117
303 Ga0157375_10808892
304 Ga0157375_11398596
305 Ga0163163_10000060
306 Ga0163163_10076497
307 Ga0157380_10268473
308 Ga0157376_10293304
309 Ga0163161_10303307
310 Ga0206350_10036899
311 Ga0206350_11054895
312 Ga0209565_1000072
313 Ga0209673_1031615
314 Ga0209675_1000049
315 Ga0209564_1000130
316 Ga0209256_1000126
317 Ga0207656_10342545
318 Ga0207707_10020852
319 Ga0207693_10052757
320 Ga0207693_10300358
321 Ga0207663_10710219
322 Ga0207652_10596957
323 Ga0207681_10140779
324 Ga0207659_10129791
325 Ga0207687_10160329
326 Ga0207687_10198975
327 Ga0207700_10219927
328 Ga0207700_10395397
329 Ga0207706_10827424
330 Ga0207686_10476137
331 Ga0207670_10004029
332 Ga0207670_10216159
333 Ga0207670_10312399
334 Ga0207665_10016421
335 Ga0207665_10027636
336 Ga0207691_10116807
337 Ga0207661_10314405
338 Ga0207667_10334010
339 Ga0207683_10286673
340 Ga0207698_10157106
341 Ga0207698_11139056
342 Ga0207428_10088029
343 Ga0268265_10025861
344 Ga0268264_10221296
345 Ga0265334_10033156
346 Ga0307517_10019452
347 Ga0265338_10034905
348 Ga0265338_10122936
349 Ga0265338_10314261
350 Ga0265324_10042664
351 Ga0265339_10285801
352 Ga0265327_10001688
353 Ga0265316_10266134
354 Ga0307408_100207873
355 Ga0316577_10258067
356 Ga0307510_10258039
357 Ga0373931_0221575
358 Ga0373925_0154711
359 Ga0373925_0774439
360 Ga0436361_0849252
361 Ga0451577_0017027
362 Ga0451577_0366959
363 Ga0453683_0004746
364 Ga0453683_0156846
365 Ga0453683_0253603
366 Ga0453684_0004192
367 Ga0453684_0287505
368 Ga0453684_0678158
369 Ga0451576_0011417
370 Ga0451576_0659364
371 Ga0451576_0704977
372 Ga0451576_1577108
373 Ga0495629_0039751
374 Ga0495629_0292156
375 Ga0495582_0044375
376 Ga0495664_0021795
377 Ga0495618_0009700
378 Ga0495630_0000401
379 Ga0495666_0003375
380 Ga0495652_0216736
381 Ga0495640_0031395
382 Ga0495640_0320344
383 Ga0495586_0000005
384 Ga0495586_0001201
385 Ga0495586_0082237
386 Ga0495645_0021023
387 Ga0495667_0088608
388 Ga0495634_0004904
389 Ga0495634_0018984
390 Ga0495599_0003672
391 Ga0495599_0011219
392 Ga0495658_0026372
393 Ga0495613_0017375
394 Ga0495674_0013684
395 Ga0495674_0020790
396 Ga0495676_0031201
397 Ga0495676_0068029
398 Ga0496109_0522862
399 Ga0501040_0097295
400 Ga0501041_0430215
401 nmdc:mga06z11_85591_c1
402 nmdc:mga05p37_111328_c1
403 nmdc:mga05p37_132609_c1
404 nmdc:mga09592_88129_c1
405 nmdc:mga06r32_154370_c1
406 nmdc:mga08y16_723024_c1
407 nmdc:mga08y16_776441_c1
408 nmdc:mga08y16_89515_c1
409 nmdc:mga0n895_195032_c1
410 nmdc:mga08x19_12375_c1
411 nmdc:mga08x19_604471_c1
412 Ga0495619_0097046
413 Ga0500559_0086030
414 Ga0500568_0089591

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

184

240

0.97

PF00072

Response_reg

Response regulator receiver domain

41

153

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1je8-assembly2.cif.gz_E two-component response regulator narl/dna complex: dna bending found in a high affinity site 0.9669 149 209
7od9-assembly1.cif.gz_B crystal structure of activated chey fused to the c-terminal domain of chef 0.96 1 119
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9556 146 209
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.9555 1 113
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9544 145 208
ID Description Score Start End Superfamily
af_O53213_1064_1134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9591 147 207 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9589 148 206 1.10.10.10
6ekhY00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9555 1 113 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.955 1 82 3.40.50.2300
af_P14375_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9539 1 119 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1Y6BGG7-F1-model_v4 DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains 0.9696 2 208 GO:0000160
GO:0003677
GO:0006355
AF-A0A367ZUY1-F1-model_v4 DNA-binding response regulator, LuxR family 0.9686 1 209 GO:0000160
GO:0003677
GO:0006355
AF-A0A3D6DF63-F1-model_v4 DNA-binding response regulator 0.9661 3 181 GO:0000160
GO:0003677
GO:0006355
AF-A0A7X9E5L5-F1-model_v4 Response regulator transcription factor 0.9638 1 208 GO:0000160
GO:0003677
GO:0006355
AF-A0A258U8R6-F1-model_v4 DNA-binding response regulator 0.9615 2 209 GO:0000160
GO:0003677
GO:0006355

Map