F316716

General Info

Members Datasets Scaffolds Average Seq Length
207 120 414 276

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0125204|Ga0373935_0125204_613_1605
Length 322
Sequence VARRAHRRQLAAVVADRGRTASTGAAAATEKGGEEAMNRRLEERRAQHARYKQDVKTRGKPFYPYAMFHDTVMSLFVVCVIVGLAVVWKYSTPHEDPSSSGWLGKLYDEKADPGTTNFVPRPDWYFYFLFYLLRIFKWPESVILGTVLIPTLLVVLLIALPFVDIGRERRPLRRPVAMTAAILVIISMGALTYKGATAKEPLAAENLVLVPQWAQKQGYADNQAAVDGAKIFAQVGCMNCHTYLGAGSSNLGAPDLSSIGKTSNRGVAGFASYVANPSKFGNNVMPQFADLGADNLRKLGTFLQSSGTCSPKSDTCPAAGGQ

Samples

Sample ID Description Type Environment
1 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
26 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
38 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
39 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
40 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
41 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
42 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
43 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
44 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
45 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
46 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
47 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
48 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
49 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
50 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
51 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
52 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
55 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
56 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
57 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
58 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
59 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
60 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
61 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
62 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
63 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
64 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
65 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
66 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
67 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
68 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
69 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
70 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
71 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
72 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
73 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
74 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
75 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
76 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
77 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
78 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
79 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
80 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
81 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
82 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
95 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
96 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
101 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
102 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
103 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
104 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
107 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
115 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
116 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
117 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
119 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
120 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.8
Rhizosphere 93.72
Stem 0
Stem Tuber 0
Unclassified 10.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373935_0125204 3300035692 Bacteria 1721
2 Ga0070683_100001132 3300005329 Bacteria 20179
3 Ga0070683_100064193 3300005329 Bacteria 3417
4 Ga0070683_100396075 3300005329 Bacteria 1317
5 Ga0070683_100401280 3300005329 Bacteria 1307
6 Ga0068869_100147335 3300005334 Bacteria 1823
7 Ga0070709_10452373 3300005434 Unclassified 968
8 Ga0070714_100034494 3300005435 Bacteria 4237
9 Ga0070714_100174722 3300005435 Bacteria 1951
10 Ga0070714_100474416 3300005435 Unclassified 1191
11 Ga0070714_100552090 3300005435 Bacteria 1103
12 Ga0070713_100022899 3300005436 Bacteria 4836
13 Ga0070713_100090882 3300005436 Bacteria 2625
14 Ga0070713_100401050 3300005436 Unclassified 1281
15 Ga0070713_100410693 3300005436 Unclassified 1266
16 Ga0070705_100305687 3300005440 Bacteria 1142
17 Ga0070685_10063164 3300005466 Bacteria 2174
18 Ga0070706_100324345 3300005467 Bacteria 1436
19 Ga0070706_100373236 3300005467 Bacteria 1329
20 Ga0070698_100119204 3300005471 Bacteria 2600
21 Ga0070698_100138428 3300005471 Bacteria 2387
22 Ga0070699_100228353 3300005518 Bacteria 1659
23 Ga0070684_100001822 3300005535 Bacteria 15602
24 Ga0070684_100074200 3300005535 Bacteria 2998
25 Ga0070684_100644988 3300005535 Unclassified 986
26 Ga0070696_100016767 3300005546 Bacteria 4942
27 Ga0068857_100017934 3300005577 Bacteria 6208
28 Ga0068857_100329937 3300005577 Bacteria 1410
29 Ga0068857_100403629 3300005577 Bacteria 1272
30 Ga0081455_10033223 3300005937 Bacteria 4639
31 Ga0081455_10035501 3300005937 Bacteria 4454
32 Ga0081455_10047762 3300005937 Bacteria 3704
33 Ga0081540_1001805 3300005983 Bacteria 17953
34 Ga0081539_10001630 3300005985 Bacteria 36632
35 Ga0070717_10384007 3300006028 Bacteria 1260
36 Ga0075431_100047398 3300006847 Bacteria 4431
37 Ga0075433_10279210 3300006852 Unclassified 1480
38 Ga0075434_100356459 3300006871 Bacteria 1484
39 Ga0111539_10039082 3300009094 Bacteria 5721
40 Ga0114129_10055647 3300009147 Bacteria 5544
41 Ga0114129_10065037 3300009147 Bacteria 5090
42 Ga0114129_10168967 3300009147 Bacteria 2982
43 Ga0114129_11099658 3300009147 Unclassified 995
44 Ga0105243_10254025 3300009148 Unclassified 1571
45 Ga0157376_10625617 3300014969 Unclassified 1074
46 Ga0207684_10117577 3300025910 Bacteria 2278
47 Ga0207693_10212782 3300025915 Bacteria 1519
48 Ga0207652_10353731 3300025921 Unclassified 1326
49 Ga0207646_10281818 3300025922 Unclassified 1502
50 Ga0207700_10000001 3300025928 Bacteria 1122509
51 Ga0207700_10024867 3300025928 Bacteria 4151
52 Ga0207664_10000933 3300025929 Bacteria 19646
53 Ga0207664_10110113 3300025929 Bacteria 2289
54 Ga0207664_10213444 3300025929 Bacteria 1671
55 Ga0207664_10313210 3300025929 Unclassified 1383
56 Ga0207664_10332812 3300025929 Bacteria 1342
57 Ga0207661_10010084 3300025944 Bacteria 6789
58 Ga0207661_10058078 3300025944 Unclassified 3113
59 Ga0207661_10133779 3300025944 Bacteria 2127
60 Ga0207679_10032467 3300025945 Bacteria 3665
61 Ga0207674_10016441 3300026116 Bacteria 8099
62 Ga0207674_10034524 3300026116 Bacteria 5285
63 Ga0207674_10152714 3300026116 Bacteria 2266
64 Ga0207675_100033693 3300026118 Bacteria 4772
65 Ga0207683_10363197 3300026121 Bacteria 1330
66 Ga0265329_10094588 3300031242 Bacteria 949
67 Ga0265339_10126220 3300031249 Bacteria 1311
68 Ga0265313_10143301 3300031595 Unclassified 1026
69 Ga0265314_10260485 3300031711 Bacteria 990
70 Ga0373956_0254448 3300035119 Bacteria 835
71 Ga0373937_0496200 3300036401 Bacteria 1160
72 Ga0395899_0023131 3300037312 Bacteria 4710
73 Ga0395899_0026035 3300037312 Bacteria 4414
74 Ga0395899_0164812 3300037312 Unclassified 1564
75 Ga0395900_0002867 3300037418 Bacteria 18800
76 Ga0395900_0011694 3300037418 Bacteria 8979
77 Ga0395900_0016696 3300037418 Bacteria 7489
78 Ga0395900_0031358 3300037418 Bacteria 5460
79 Ga0395900_0038544 3300037418 Bacteria 4926
80 Ga0395900_0059210 3300037418 Bacteria 3943
81 Ga0395900_0061615 3300037418 Bacteria 3857
82 Ga0395900_0265704 3300037418 Bacteria 1712
83 Ga0395898_0003529 3300037466 Bacteria 17437
84 Ga0395898_0008156 3300037466 Bacteria 11089
85 Ga0395898_0021437 3300037466 Bacteria 6553
86 Ga0395898_0029132 3300037466 Bacteria 5531
87 Ga0395898_0075830 3300037466 Bacteria 3247
88 Ga0395898_0157944 3300037466 Bacteria 2169
89 Ga0395898_0235725 3300037466 Unclassified 1745
90 Ga0395898_0255149 3300037466 Unclassified 1672
91 Ga0395898_0569647 3300037466 Bacteria 1075
92 Ga0395905_0012828 3300037471 Bacteria 8057
93 Ga0395905_0027347 3300037471 Bacteria 5378
94 Ga0395905_0032751 3300037471 Bacteria 4886
95 Ga0395905_0057099 3300037471 Bacteria 3651
96 Ga0395905_0067610 3300037471 Bacteria 3347
97 Ga0395905_0110512 3300037471 Bacteria 2581
98 Ga0395901_0005773 3300038443 Bacteria 12533
99 Ga0395901_0027605 3300038443 Bacteria 5833
100 Ga0395901_0033901 3300038443 Bacteria 5272
101 Ga0395901_0045948 3300038443 Bacteria 4534
102 Ga0395901_0058641 3300038443 Bacteria 4004
103 Ga0395901_0063272 3300038443 Bacteria 3850
104 Ga0395901_0063852 3300038443 Bacteria 3833
105 Ga0395901_0064421 3300038443 Bacteria 3815
106 Ga0395901_0103574 3300038443 Bacteria 2986
107 Ga0395901_0388451 3300038443 Bacteria 1435
108 Ga0451800_1574409 3300041459 Bacteria 1140
109 Ga0451833_0157328 3300041491 Bacteria 1169
110 Ga0439451_007879 3300042009 Bacteria 2163
111 Ga0466966_0013214 3300044684 Bacteria 5466
112 Ga0466971_0012650 3300044719 Bacteria 3701
113 Ga0466971_0276928 3300044719 Bacteria 803
114 Ga0466967_0049082 3300045976 Bacteria 3690
115 Ga0466967_0272420 3300045976 Bacteria 1622
116 Ga0495592_0255739 3300046454 Bacteria 1156
117 Ga0495629_0308713 3300046459 Bacteria 1082
118 Ga0495641_0260507 3300046461 Bacteria 780
119 Ga0495582_0013288 3300046473 Bacteria 4533
120 Ga0495616_0031096 3300046513 Bacteria 2799
121 Ga0495663_0030314 3300046525 Bacteria 1602
122 Ga0495652_0159100 3300046529 Bacteria 1756
123 Ga0495640_0208294 3300046533 Bacteria 1237
124 Ga0495586_0082169 3300046535 Bacteria 1771
125 Ga0495634_0044844 3300046642 Bacteria 2991
126 Ga0495635_0320021 3300046663 Bacteria 1038
127 Ga0495588_0020315 3300046674 Bacteria 3263
128 Ga0495647_0050653 3300046681 Bacteria 1612
129 Ga0495589_0041380 3300046794 Bacteria 2300
130 Ga0495581_0006326 3300047315 Bacteria 6870
131 Ga0495604_0235573 3300047317 Bacteria 1254
132 Ga0495674_0085642 3300047319 Bacteria 2699
133 Ga0495676_0023162 3300047321 Bacteria 5393
134 Ga0495680_0009780 3300047322 Bacteria 8600
135 Ga0495684_0153024 3300047471 Unclassified 1724
136 Ga0495686_0205879 3300047472 Bacteria 1127
137 Ga0496101_0180014 3300048904 Bacteria 1628
138 Ga0496102_0203933 3300048905 Bacteria 1864
139 Ga0496106_0344792 3300048909 Bacteria 1196
140 Ga0496108_0139729 3300048911 Bacteria 2087
141 Ga0496108_0511187 3300048911 Bacteria 1049
142 Ga0496109_0043890 3300048912 Bacteria 4054
143 Ga0496109_0088800 3300048912 Bacteria 2857
144 Ga0496110_0085007 3300048913 Bacteria 2824
145 Ga0496110_0105937 3300048913 Bacteria 2523
146 Ga0496110_0234293 3300048913 Bacteria 1670
147 Ga0496112_0042440 3300048915 Bacteria 4450
148 Ga0501032_0085390 3300049569 Bacteria 2098
149 Ga0501033_0041406 3300049570 Bacteria 3437
150 Ga0501034_0002671 3300049571 Bacteria 21060
151 Ga0501034_0208712 3300049571 Bacteria 1909
152 Ga0501036_0316279 3300049572 Unclassified 1305
153 Ga0501037_0017564 3300049573 Bacteria 5265
154 Ga0501038_0031616 3300049574 Bacteria 4676
155 Ga0501039_0340962 3300049575 Bacteria 1178
156 Ga0501040_0022925 3300049576 Bacteria 4182
157 Ga0501042_0009387 3300049578 Bacteria 6518
158 Ga0501043_0005116 3300049579 Bacteria 10614
159 Ga0501046_0014694 3300049580 Bacteria 6592
160 Ga0501046_0112032 3300049580 Bacteria 2084
161 Ga0501047_0119024 3300049581 Bacteria 2523
162 Ga0501067_0029882 3300049583 Bacteria 3021
163 Ga0501067_0050967 3300049583 Bacteria 2294
164 Ga0501067_0166163 3300049583 Bacteria 1229
165 Ga0501067_0167068 3300049583 Bacteria 1225
166 Ga0501068_0001925 3300049584 Bacteria 11040
167 Ga0501068_0111001 3300049584 Bacteria 1705
168 Ga0501069_0003402 3300049585 Bacteria 8168
169 Ga0501069_0009407 3300049585 Bacteria 5156
170 Ga0501070_0012450 3300049586 Bacteria 7174
171 Ga0501071_0094634 3300049587 Unclassified 2198
172 Ga0501072_0136919 3300049588 Bacteria 1952
173 Ga0501073_0060810 3300049589 Bacteria 2636
174 Ga0501073_0127438 3300049589 Bacteria 1764
175 Ga0501074_0028924 3300049590 Bacteria 4014
176 Ga0501074_0241259 3300049590 Bacteria 1285
177 Ga0501075_0034219 3300049591 Bacteria 3782
178 Ga0501075_0115854 3300049591 Bacteria 2037
179 Ga0501075_0677923 3300049591 Unclassified 786
180 Ga0501076_0017477 3300049592 Bacteria 5451
181 Ga0501076_0202738 3300049592 Bacteria 1620
182 Ga0501079_0221363 3300049741 Bacteria 1479
183 Ga0501080_0140541 3300049742 Bacteria 2232
184 Ga0501080_0179274 3300049742 Bacteria 1950
185 Ga0501080_0462935 3300049742 Unclassified 1136
186 Ga0501081_0009598 3300049743 Bacteria 6310
187 Ga0501083_0007856 3300049744 Bacteria 7556
188 Ga0501083_0112644 3300049744 Bacteria 1788
189 Ga0501035_0017196 3300049822 Bacteria 6666
190 Ga0501045_0015069 3300049824 Bacteria 5487
191 Ga0501045_0056401 3300049824 Bacteria 2873
192 nmdc:mga05p37_219431_c1 3300050507 Bacteria 2295
193 nmdc:mga08y16_72139_c1 3300050511 Bacteria 3598
194 nmdc:mga08x19_198932_c1 3300050514 Bacteria 1373
195 nmdc:mga08x19_84458_c1 3300050514 Bacteria 2088
196 nmdc:mga0a205_111060_c1 3300050515 Bacteria 2640
197 Ga0495619_0153573 3300053085 Bacteria 1588
198 Ga0501084_0246187 3300054114 Bacteria 1509
199 Ga0590075_011109 3300059424 Bacteria 2173
200 Ga0590077_020188 3300059426 Bacteria 1414
201 Ga0501082_0076156 3300060353 Bacteria 2891
202 Ga0501082_0703588 3300060353 Bacteria 884
203 Ga0466962_0013045 3300061719 Bacteria 3996
204 Ga0530510_0016039 3300061734 Bacteria 5295
205 Ga0530510_0031010 3300061734 Bacteria 3842
206 Ga0530510_0183041 3300061734 Bacteria 1554
207 Ga0530510_0288786 3300061734 Bacteria 1226
208 Ga0373935_0125204
209 Ga0070683_100001132
210 Ga0070683_100064193
211 Ga0070683_100396075
212 Ga0070683_100401280
213 Ga0068869_100147335
214 Ga0070709_10452373
215 Ga0070714_100034494
216 Ga0070714_100174722
217 Ga0070714_100474416
218 Ga0070714_100552090
219 Ga0070713_100022899
220 Ga0070713_100090882
221 Ga0070713_100401050
222 Ga0070713_100410693
223 Ga0070705_100305687
224 Ga0070685_10063164
225 Ga0070706_100324345
226 Ga0070706_100373236
227 Ga0070698_100119204
228 Ga0070698_100138428
229 Ga0070699_100228353
230 Ga0070684_100001822
231 Ga0070684_100074200
232 Ga0070684_100644988
233 Ga0070696_100016767
234 Ga0068857_100017934
235 Ga0068857_100329937
236 Ga0068857_100403629
237 Ga0081455_10033223
238 Ga0081455_10035501
239 Ga0081455_10047762
240 Ga0081540_1001805
241 Ga0081539_10001630
242 Ga0070717_10384007
243 Ga0075431_100047398
244 Ga0075433_10279210
245 Ga0075434_100356459
246 Ga0111539_10039082
247 Ga0114129_10055647
248 Ga0114129_10065037
249 Ga0114129_10168967
250 Ga0114129_11099658
251 Ga0105243_10254025
252 Ga0157376_10625617
253 Ga0207684_10117577
254 Ga0207693_10212782
255 Ga0207652_10353731
256 Ga0207646_10281818
257 Ga0207700_10000001
258 Ga0207700_10024867
259 Ga0207664_10000933
260 Ga0207664_10110113
261 Ga0207664_10213444
262 Ga0207664_10313210
263 Ga0207664_10332812
264 Ga0207661_10010084
265 Ga0207661_10058078
266 Ga0207661_10133779
267 Ga0207679_10032467
268 Ga0207674_10016441
269 Ga0207674_10034524
270 Ga0207674_10152714
271 Ga0207675_100033693
272 Ga0207683_10363197
273 Ga0265329_10094588
274 Ga0265339_10126220
275 Ga0265313_10143301
276 Ga0265314_10260485
277 Ga0373956_0254448
278 Ga0373937_0496200
279 Ga0395899_0023131
280 Ga0395899_0026035
281 Ga0395899_0164812
282 Ga0395900_0002867
283 Ga0395900_0011694
284 Ga0395900_0016696
285 Ga0395900_0031358
286 Ga0395900_0038544
287 Ga0395900_0059210
288 Ga0395900_0061615
289 Ga0395900_0265704
290 Ga0395898_0003529
291 Ga0395898_0008156
292 Ga0395898_0021437
293 Ga0395898_0029132
294 Ga0395898_0075830
295 Ga0395898_0157944
296 Ga0395898_0235725
297 Ga0395898_0255149
298 Ga0395898_0569647
299 Ga0395905_0012828
300 Ga0395905_0027347
301 Ga0395905_0032751
302 Ga0395905_0057099
303 Ga0395905_0067610
304 Ga0395905_0110512
305 Ga0395901_0005773
306 Ga0395901_0027605
307 Ga0395901_0033901
308 Ga0395901_0045948
309 Ga0395901_0058641
310 Ga0395901_0063272
311 Ga0395901_0063852
312 Ga0395901_0064421
313 Ga0395901_0103574
314 Ga0395901_0388451
315 Ga0451800_1574409
316 Ga0451833_0157328
317 Ga0439451_007879
318 Ga0466966_0013214
319 Ga0466971_0012650
320 Ga0466971_0276928
321 Ga0466967_0049082
322 Ga0466967_0272420
323 Ga0495592_0255739
324 Ga0495629_0308713
325 Ga0495641_0260507
326 Ga0495582_0013288
327 Ga0495616_0031096
328 Ga0495663_0030314
329 Ga0495652_0159100
330 Ga0495640_0208294
331 Ga0495586_0082169
332 Ga0495634_0044844
333 Ga0495635_0320021
334 Ga0495588_0020315
335 Ga0495647_0050653
336 Ga0495589_0041380
337 Ga0495581_0006326
338 Ga0495604_0235573
339 Ga0495674_0085642
340 Ga0495676_0023162
341 Ga0495680_0009780
342 Ga0495684_0153024
343 Ga0495686_0205879
344 Ga0496101_0180014
345 Ga0496102_0203933
346 Ga0496106_0344792
347 Ga0496108_0139729
348 Ga0496108_0511187
349 Ga0496109_0043890
350 Ga0496109_0088800
351 Ga0496110_0085007
352 Ga0496110_0105937
353 Ga0496110_0234293
354 Ga0496112_0042440
355 Ga0501032_0085390
356 Ga0501033_0041406
357 Ga0501034_0002671
358 Ga0501034_0208712
359 Ga0501036_0316279
360 Ga0501037_0017564
361 Ga0501038_0031616
362 Ga0501039_0340962
363 Ga0501040_0022925
364 Ga0501042_0009387
365 Ga0501043_0005116
366 Ga0501046_0014694
367 Ga0501046_0112032
368 Ga0501047_0119024
369 Ga0501067_0029882
370 Ga0501067_0050967
371 Ga0501067_0166163
372 Ga0501067_0167068
373 Ga0501068_0001925
374 Ga0501068_0111001
375 Ga0501069_0003402
376 Ga0501069_0009407
377 Ga0501070_0012450
378 Ga0501071_0094634
379 Ga0501072_0136919
380 Ga0501073_0060810
381 Ga0501073_0127438
382 Ga0501074_0028924
383 Ga0501074_0241259
384 Ga0501075_0034219
385 Ga0501075_0115854
386 Ga0501075_0677923
387 Ga0501076_0017477
388 Ga0501076_0202738
389 Ga0501079_0221363
390 Ga0501080_0140541
391 Ga0501080_0179274
392 Ga0501080_0462935
393 Ga0501081_0009598
394 Ga0501083_0007856
395 Ga0501083_0112644
396 Ga0501035_0017196
397 Ga0501045_0015069
398 Ga0501045_0056401
399 nmdc:mga05p37_219431_c1
400 nmdc:mga08y16_72139_c1
401 nmdc:mga08x19_198932_c1
402 nmdc:mga08x19_84458_c1
403 nmdc:mga0a205_111060_c1
404 Ga0495619_0153573
405 Ga0501084_0246187
406 Ga0590075_011109
407 Ga0590077_020188
408 Ga0501082_0076156
409 Ga0501082_0703588
410 Ga0466962_0013045
411 Ga0530510_0016039
412 Ga0530510_0031010
413 Ga0530510_0183041
414 Ga0530510_0288786

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00032

Cytochrom_B_C

Cytochrome b(C-terminal)/b6/petD

110

212

0.85

Map