F316645

General Info

Members Datasets Scaffolds Average Seq Length
207 150 413 277

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10006272|Ga0265327_1000627211
Length 323
Sequence MKTFTNRTAAITGAGSGIGRALAARLARQNCNLALSDIDPVGLAGTAALLECMNVDITTTVVDVANCEQVTQWAAATAAHFGSVNLVFNNAGVAQSGSVEANSYADYEWVLQINLWGVIYGTKAFLPYLAASGDGHIVNVSSVFGLQAQPAVSAYNTSKFAVRGFTEALRQELDLLNNGVSATCVHPGGIRTDIVRRSRVGEGVSEVFGTGQSQVIDLFNSMLLTSPDKAAEVILTGVRRNSRRVRIGVDARLIDLEQRLLPTGYQVLNTALIKGLGRILDVLPNRFLPRPMERLPEIELTAPGTLTLGGAESGRIRTGLGTQ

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
50 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
51 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
59 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
60 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
61 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
64 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
68 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
69 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
70 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
73 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
74 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
75 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
86 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
89 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
129 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
133 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
134 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
138 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
139 2739367898 Nocardioides sp. CF479 Isolate Unclassified
140 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
141 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
142 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
143 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
144 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
145 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
146 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
147 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
148 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
149 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
150 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.24
Metatranscriptomes 0
Isolates 6.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.25
Nodule 0.48
Rhizoplane 5.8
Rhizosphere 78.26
Stem 0
Stem Tuber 0
Unclassified 3.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10006272 3300031251 Bacteria 9580
2 rootH1_10089868 3300003323 Bacteria 3445
3 rootH1_10089869 3300003316 Bacteria 2959
4 rootH1_10089869 3300003323 Bacteria 3142
5 Ga0055532_1000975 3300003758 Bacteria 9129
6 Ga0070683_100647488 3300005329 Bacteria 1012
7 Ga0070668_100077475 3300005347 Bacteria 2599
8 Ga0070668_100154683 3300005347 Unclassified 1857
9 Ga0070671_100046852 3300005355 Bacteria 3595
10 Ga0070674_100309126 3300005356 Bacteria 1263
11 Ga0070667_100554050 3300005367 Bacteria 1057
12 Ga0070705_100021823 3300005440 Bacteria 3411
13 Ga0070708_100291034 3300005445 Bacteria 1538
14 Ga0070663_100028986 3300005455 Bacteria 3776
15 Ga0070699_100283140 3300005518 Bacteria 1485
16 Ga0068859_100064038 3300005617 Bacteria 3709
17 Ga0068859_100809395 3300005617 Bacteria 1024
18 Ga0068859_100827736 3300005617 Bacteria 1012
19 Ga0068864_100423706 3300005618 Bacteria 1268
20 Ga0068861_100016403 3300005719 Bacteria 5241
21 Ga0068861_100450331 3300005719 Bacteria 1153
22 Ga0068863_100025198 3300005841 Bacteria 5671
23 Ga0068860_100044413 3300005843 Bacteria 4236
24 Ga0068860_100367843 3300005843 Bacteria 1417
25 Ga0068862_100086181 3300005844 Bacteria 2730
26 Ga0075365_10154532 3300006038 Bacteria 1597
27 Ga0075365_10230392 3300006038 Bacteria 1300
28 Ga0075363_100103177 3300006048 Unclassified 1580
29 Ga0075363_100141187 3300006048 Unclassified 1356
30 Ga0075364_10001557 3300006051 Bacteria 12541
31 Ga0075364_10091280 3300006051 Bacteria 2021
32 Ga0075432_10000001 3300006058 Bacteria 64068
33 Ga0068871_100120448 3300006358 Bacteria 2216
34 Ga0075436_100028990 3300006914 Bacteria 3808
35 Ga0097620_100064037 3300006931 Bacteria 3709
36 Ga0097620_100809508 3300006931 Bacteria 1024
37 Ga0097620_100827758 3300006931 Bacteria 1012
38 Ga0105240_10021793 3300009093 Bacteria 8514
39 Ga0111539_10332941 3300009094 Bacteria 1767
40 Ga0105245_10202531 3300009098 Bacteria 1906
41 Ga0105242_10243399 3300009176 Bacteria 1618
42 Ga0105249_10034613 3300009553 Bacteria 4579
43 Ga0105239_10106179 3300010375 Bacteria 3111
44 Ga0105246_10062373 3300011119 Bacteria 2597
45 Ga0157374_10316201 3300013296 Bacteria 1547
46 Ga0157372_10517477 3300013307 Bacteria 1391
47 Ga0157375_10042274 3300013308 Bacteria 4410
48 Ga0157375_10735045 3300013308 Unclassified 1139
49 Ga0157379_10203571 3300014968 Bacteria 1790
50 Ga0213875_10004655 3300021388 Bacteria 7474
51 Ga0209672_100042 3300025228 Bacteria 272005
52 Ga0207700_10010778 3300025928 Bacteria 5794
53 Ga0207711_10063519 3300025941 Bacteria 3187
54 Ga0207712_10011779 3300025961 Bacteria 5576
55 Ga0207676_10094845 3300026095 Bacteria 2459
56 Ga0207676_10357571 3300026095 Bacteria 1352
57 Ga0207675_100021701 3300026118 Bacteria 5975
58 Ga0207675_100027723 3300026118 Bacteria 5276
59 Ga0207683_10077250 3300026121 Bacteria 2948
60 Ga0207428_10000155 3300027907 Bacteria 93472
61 Ga0207428_10144947 3300027907 Bacteria 1810
62 Ga0268266_10443504 3300028379 Bacteria 1233
63 Ga0268265_10084367 3300028380 Bacteria 2518
64 Ga0268264_10326110 3300028381 Bacteria 1454
65 Ga0316176_1065273 3300030732 Bacteria 3601
66 Ga0265328_10003174 3300031239 Bacteria 7303
67 Ga0265328_10076320 3300031239 Bacteria 1233
68 Ga0265329_10015797 3300031242 Bacteria 2629
69 Ga0265327_10000019 3300031251 Bacteria 427653
70 Ga0265327_10000924 3300031251 Bacteria 42993
71 Ga0265327_10000964 3300031251 Bacteria 41214
72 Ga0265327_10001814 3300031251 Bacteria 25001
73 Ga0265316_10000026 3300031344 Bacteria 165508
74 Ga0265316_10003056 3300031344 Bacteria 17085
75 Ga0265316_10038571 3300031344 Bacteria 3848
76 Ga0265316_10119911 3300031344 Bacteria 1987
77 Ga0265316_10349494 3300031344 Bacteria 1071
78 Ga0265314_10046964 3300031711 Bacteria 3043
79 Ga0265314_10067148 3300031711 Bacteria 2417
80 Ga0265314_10074244 3300031711 Bacteria 2265
81 Ga0265342_10083033 3300031712 Bacteria 1847
82 Ga0307405_10283007 3300031731 Bacteria 1249
83 Ga0316577_10024529 3300031733 Bacteria 3353
84 Ga0307413_10000421 3300031824 Bacteria 13705
85 Ga0307406_10283539 3300031901 Bacteria 1265
86 Ga0373954_0001606 3300035118 Bacteria 9227
87 Ga0373956_0000744 3300035119 Bacteria 13428
88 Ga0373933_0149756 3300035724 Bacteria 1477
89 Ga0373937_0140380 3300036401 Bacteria 2260
90 Ga0316584_0181040 3300036712 Unclassified 1560
91 Ga0373925_0057097 3300037068 Bacteria 2925
92 Ga0395905_0000414 3300037471 Bacteria 59892
93 Ga0436364_0340800 3300037853 Bacteria 64191
94 Ga0400484_44275 3300038725 Bacteria 20333
95 Ga0439436_0013312 3300041404 Bacteria 2488
96 Ga0439438_003131 3300041405 Bacteria 6790
97 Ga0439452_001982 3300042010 Bacteria 7831
98 Ga0451577_0008507 3300042876 Bacteria 9983
99 Ga0451577_0028170 3300042876 Bacteria 5082
100 Ga0466972_0109392 3300044658 Bacteria 1306
101 Ga0466972_0129374 3300044658 Bacteria 1189
102 Ga0453683_0039586 3300044673 Bacteria 2963
103 Ga0466965_0017834 3300044683 Bacteria 3395
104 Ga0466966_0109712 3300044684 Bacteria 1702
105 Ga0466963_0001822 3300044694 Bacteria 11599
106 Ga0466963_0110844 3300044694 Bacteria 1884
107 Ga0453684_0000035 3300044712 Bacteria 725956
108 Ga0453684_0058898 3300044712 Bacteria 4957
109 Ga0466971_0074595 3300044719 Bacteria 1542
110 Ga0466957_0158377 3300044842 Bacteria 1469
111 Ga0466957_0178493 3300044842 Bacteria 1386
112 Ga0466960_0000560 3300044901 Bacteria 12845
113 Ga0466960_0008195 3300044901 Bacteria 4272
114 Ga0466960_0248603 3300044901 Bacteria 987
115 Ga0466959_0017669 3300045049 Bacteria 5230
116 Ga0451576_0849187 3300045051 Bacteria 958
117 Ga0466958_0019352 3300045836 Bacteria 3963
118 Ga0466958_0046422 3300045836 Bacteria 2621
119 Ga0466958_0061429 3300045836 Bacteria 2289
120 Ga0466958_0096777 3300045836 Bacteria 1831
121 Ga0466967_0087679 3300045976 Bacteria 2822
122 Ga0495641_0100627 3300046461 Bacteria 1290
123 Ga0495650_0000054 3300046471 Bacteria 313631
124 Ga0495650_0055939 3300046471 Bacteria 1603
125 Ga0495608_0193891 3300046511 Bacteria 1282
126 Ga0495618_0046444 3300046514 Bacteria 2741
127 Ga0495666_0154681 3300046526 Bacteria 1065
128 Ga0495634_0010657 3300046642 Bacteria 6729
129 Ga0495657_0090711 3300046675 Bacteria 1961
130 Ga0495647_0076971 3300046681 Bacteria 1346
131 Ga0495647_0203899 3300046681 Bacteria 868
132 Ga0495613_0000128 3300046689 Bacteria 74734
133 Ga0495581_0059337 3300047315 Bacteria 2211
134 Ga0495604_0237197 3300047317 Bacteria 1249
135 Ga0495672_0030339 3300047320 Bacteria 3393
136 Ga0495680_0095858 3300047322 Bacteria 2217
137 Ga0495680_0098346 3300047322 Bacteria 2184
138 Ga0495684_0140285 3300047471 Bacteria 1812
139 Ga0496101_0111887 3300048904 Bacteria 2056
140 Ga0496102_0017408 3300048905 Bacteria 6296
141 Ga0496103_0007102 3300048906 Bacteria 6687
142 Ga0496104_0206384 3300048907 Bacteria 1877
143 Ga0496105_0312113 3300048908 Bacteria 1262
144 Ga0496107_0115984 3300048910 Bacteria 1971
145 Ga0496108_0495567 3300048911 Bacteria 1067
146 Ga0496109_0141107 3300048912 Bacteria 2253
147 Ga0496109_0366288 3300048912 Bacteria 1361
148 Ga0496112_0048613 3300048915 Bacteria 4158
149 Ga0496113_0049327 3300048916 Bacteria 3134
150 Ga0496115_0040078 3300048918 Bacteria 3722
151 Ga0496121_0013255 3300048924 Bacteria 8878
152 Ga0496124_0017167 3300048927 Bacteria 6839
153 Ga0496124_0044571 3300048927 Bacteria 3805
154 Ga0496126_0060092 3300048929 Bacteria 3420
155 Ga0501032_0005861 3300049569 Bacteria 9087
156 Ga0501034_0027184 3300049571 Bacteria 5820
157 Ga0501034_0064056 3300049571 Bacteria 3690
158 Ga0501034_0448006 3300049571 Bacteria 1209
159 Ga0501036_0373751 3300049572 Bacteria 1190
160 Ga0501047_0123084 3300049581 Bacteria 2474
161 Ga0501047_0302045 3300049581 Bacteria 1443
162 Ga0501068_0222025 3300049584 Bacteria 1201
163 Ga0501069_0001530 3300049585 Bacteria 11434
164 Ga0501070_0001134 3300049586 Bacteria 23896
165 Ga0501070_0002163 3300049586 Bacteria 17260
166 Ga0501070_0008553 3300049586 Bacteria 8654
167 Ga0501070_0011179 3300049586 Bacteria 7578
168 Ga0501073_0047474 3300049589 Bacteria 3018
169 Ga0501074_0001493 3300049590 Bacteria 15746
170 Ga0501074_0064912 3300049590 Bacteria 2628
171 Ga0501079_0000113 3300049741 Bacteria 41839
172 Ga0501080_0002912 3300049742 Bacteria 15056
173 Ga0501080_0007512 3300049742 Bacteria 9844
174 Ga0501080_0016933 3300049742 Bacteria 6731
175 Ga0501080_0103644 3300049742 Bacteria 2638
176 Ga0501035_0010481 3300049822 Bacteria 8590
177 Ga0501044_0048125 3300049823 Bacteria 4406
178 Ga0501044_0122630 3300049823 Bacteria 2598
179 Ga0501044_0604100 3300049823 Bacteria 990
180 nmdc:mga03n38_62307_c1 3300050490 Unclassified 1701
181 nmdc:mga00v17_1327_c1 3300050491 Bacteria 12961
182 nmdc:mga00v17_73714_c1 3300050491 Bacteria 2120
183 nmdc:mga0yw44_143649_c1 3300050492 Bacteria 1552
184 nmdc:mga06z11_217123_c1 3300050494 Bacteria 1116
185 nmdc:mga08y16_133249_c1 3300050511 Bacteria 2583
186 nmdc:mga08x19_169939_c1 3300050514 Bacteria 1484
187 nmdc:mga08x19_71043_c1 3300050514 Bacteria 2269
188 Ga0495619_0146229 3300053085 Bacteria 1630
189 Ga0500566_0074613 3300053094 Bacteria 1899
190 Ga0500637_0157012 3300053178 Bacteria 1312
191 Ga0501084_0375629 3300054114 Bacteria 1201
192 Ga0501082_0134193 3300060353 Unclassified 2148
193 Ga0466962_0157343 3300061719 Bacteria 1104
194 2644457735 2643221681 Bacteria 3707866
195 2740166234 2739367898 Bacteria 4367674
196 2744956578 2744054611 Bacteria 5611514
197 2753039136 2751185725 Bacteria 5740550
198 2753327647 2751185792 Bacteria 5739090
199 2808940777 2808606379 Bacteria 5022697
200 2808969269 2808606384 Bacteria 8474373
201 2809004100 2808606390 Bacteria 8476311
202 2842890859 2842888712 Bacteria 4279094
203 2842892456 2842888712 Bacteria 4279094
204 2885384085 2885383462 Bacteria 9473874
205 2903768952 2903768456 Bacteria 9749579
206 8011351904 8011350971 Bacteria 6158957
207 8056682002 8056681323 Bacteria 8472857
208 Ga0265327_10006272
209 rootH1_10089868
210 rootH1_10089869
211 Ga0055532_1000975
212 Ga0070683_100647488
213 Ga0070668_100077475
214 Ga0070668_100154683
215 Ga0070671_100046852
216 Ga0070674_100309126
217 Ga0070667_100554050
218 Ga0070705_100021823
219 Ga0070708_100291034
220 Ga0070663_100028986
221 Ga0070699_100283140
222 Ga0068859_100064038
223 Ga0068859_100809395
224 Ga0068859_100827736
225 Ga0068864_100423706
226 Ga0068861_100016403
227 Ga0068861_100450331
228 Ga0068863_100025198
229 Ga0068860_100044413
230 Ga0068860_100367843
231 Ga0068862_100086181
232 Ga0075365_10154532
233 Ga0075365_10230392
234 Ga0075363_100103177
235 Ga0075363_100141187
236 Ga0075364_10001557
237 Ga0075364_10091280
238 Ga0075432_10000001
239 Ga0068871_100120448
240 Ga0075436_100028990
241 Ga0097620_100064037
242 Ga0097620_100809508
243 Ga0097620_100827758
244 Ga0105240_10021793
245 Ga0111539_10332941
246 Ga0105245_10202531
247 Ga0105242_10243399
248 Ga0105249_10034613
249 Ga0105239_10106179
250 Ga0105246_10062373
251 Ga0157374_10316201
252 Ga0157372_10517477
253 Ga0157375_10042274
254 Ga0157375_10735045
255 Ga0157379_10203571
256 Ga0213875_10004655
257 Ga0209672_100042
258 Ga0207700_10010778
259 Ga0207711_10063519
260 Ga0207712_10011779
261 Ga0207676_10094845
262 Ga0207676_10357571
263 Ga0207675_100021701
264 Ga0207675_100027723
265 Ga0207683_10077250
266 Ga0207428_10000155
267 Ga0207428_10144947
268 Ga0268266_10443504
269 Ga0268265_10084367
270 Ga0268264_10326110
271 Ga0316176_1065273
272 Ga0265328_10003174
273 Ga0265328_10076320
274 Ga0265329_10015797
275 Ga0265327_10000019
276 Ga0265327_10000924
277 Ga0265327_10000964
278 Ga0265327_10001814
279 Ga0265316_10000026
280 Ga0265316_10003056
281 Ga0265316_10038571
282 Ga0265316_10119911
283 Ga0265316_10349494
284 Ga0265314_10046964
285 Ga0265314_10067148
286 Ga0265314_10074244
287 Ga0265342_10083033
288 Ga0307405_10283007
289 Ga0316577_10024529
290 Ga0307413_10000421
291 Ga0307406_10283539
292 Ga0373954_0001606
293 Ga0373956_0000744
294 Ga0373933_0149756
295 Ga0373937_0140380
296 Ga0316584_0181040
297 Ga0373925_0057097
298 Ga0395905_0000414
299 Ga0436364_0340800
300 Ga0400484_44275
301 Ga0439436_0013312
302 Ga0439438_003131
303 Ga0439452_001982
304 Ga0451577_0008507
305 Ga0451577_0028170
306 Ga0466972_0109392
307 Ga0466972_0129374
308 Ga0453683_0039586
309 Ga0466965_0017834
310 Ga0466966_0109712
311 Ga0466963_0001822
312 Ga0466963_0110844
313 Ga0453684_0000035
314 Ga0453684_0058898
315 Ga0466971_0074595
316 Ga0466957_0158377
317 Ga0466957_0178493
318 Ga0466960_0000560
319 Ga0466960_0008195
320 Ga0466960_0248603
321 Ga0466959_0017669
322 Ga0451576_0849187
323 Ga0466958_0019352
324 Ga0466958_0046422
325 Ga0466958_0061429
326 Ga0466958_0096777
327 Ga0466967_0087679
328 Ga0495641_0100627
329 Ga0495650_0000054
330 Ga0495650_0055939
331 Ga0495608_0193891
332 Ga0495618_0046444
333 Ga0495666_0154681
334 Ga0495634_0010657
335 Ga0495657_0090711
336 Ga0495647_0076971
337 Ga0495647_0203899
338 Ga0495613_0000128
339 Ga0495581_0059337
340 Ga0495604_0237197
341 Ga0495672_0030339
342 Ga0495680_0095858
343 Ga0495680_0098346
344 Ga0495684_0140285
345 Ga0496101_0111887
346 Ga0496102_0017408
347 Ga0496103_0007102
348 Ga0496104_0206384
349 Ga0496105_0312113
350 Ga0496107_0115984
351 Ga0496108_0495567
352 Ga0496109_0141107
353 Ga0496109_0366288
354 Ga0496112_0048613
355 Ga0496113_0049327
356 Ga0496115_0040078
357 Ga0496121_0013255
358 Ga0496124_0017167
359 Ga0496124_0044571
360 Ga0496126_0060092
361 Ga0501032_0005861
362 Ga0501034_0027184
363 Ga0501034_0064056
364 Ga0501034_0448006
365 Ga0501036_0373751
366 Ga0501047_0123084
367 Ga0501047_0302045
368 Ga0501068_0222025
369 Ga0501069_0001530
370 Ga0501070_0001134
371 Ga0501070_0002163
372 Ga0501070_0008553
373 Ga0501070_0011179
374 Ga0501073_0047474
375 Ga0501074_0001493
376 Ga0501074_0064912
377 Ga0501079_0000113
378 Ga0501080_0002912
379 Ga0501080_0007512
380 Ga0501080_0016933
381 Ga0501080_0103644
382 Ga0501035_0010481
383 Ga0501044_0048125
384 Ga0501044_0122630
385 Ga0501044_0604100
386 nmdc:mga03n38_62307_c1
387 nmdc:mga00v17_1327_c1
388 nmdc:mga00v17_73714_c1
389 nmdc:mga0yw44_143649_c1
390 nmdc:mga06z11_217123_c1
391 nmdc:mga08y16_133249_c1
392 nmdc:mga08x19_169939_c1
393 nmdc:mga08x19_71043_c1
394 Ga0495619_0146229
395 Ga0500566_0074613
396 Ga0500637_0157012
397 Ga0501084_0375629
398 Ga0501082_0134193
399 Ga0466962_0157343
400 2644457735
401 2740166234
402 2744956578
403 2753039136
404 2753327647
405 2808940777
406 2808969269
407 2809004100
408 2842890859
409 2842892456
410 2885384085
411 2903768952
412 8011351904
413 8056682002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

7

203

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

13

211

0.93

PF08659

KR

KR domain

8

188

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zem-assembly1.cif.gz_A crystal structure of nad+-bound xylitol dehydrogenase 0.9599 3 187
2ew8-assembly1.cif.gz_D crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9589 3 187
2ew8-assembly1.cif.gz_C crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9568 3 187
4j2h-assembly1.cif.gz_A crystal structure of a putative short-chain alcohol dehydrogenase from sinorhizobium meliloti 1021 (target nysgrc-011708) 0.9547 1 195
2ewm-assembly1.cif.gz_A-2 crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9543 1 192
ID Description Score Start End Superfamily
af_P9WGP9_1_269_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9715 1 274 3.40.50.720
af_P9WGP9_1_269_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9644 1 274 3.40.50.720
4j2hA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9581 1 192 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9548 92 187 3.40.50.720
af_A0A0R0JBZ9_6_171_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9521 88 197 3.40.50.720
ID Description Score Start End GO Terms
AF-X8C438-F1-model_v4 deleted 0.9951 4 187
AF-A0A485ES45-F1-model_v4 deleted 0.9858 4 279
AF-A0A1H2LAF3-F1-model_v4 Short-chain dehydrogenase 0.9843 1 279 GO:0016491
AF-A0A024HJ63-F1-model_v4 Short-chain dehydrogenase 0.9825 1 279 GO:0016491
AF-A0A5E4TBS2-F1-model_v4 Oxidoreductase SadH (EC 1.-.-.-) 0.9818 1 280 GO:0016491

Map