F316643

General Info

Members Datasets Scaffolds Average Seq Length
207 150 414 233

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10000986|Ga0265327_1000098627
Length 260
Sequence MLKISGLNQYYGGSHTLWDMNLDITAGSCLCLMGRNGVGKTTLLKCIMGLIAVRDGAIDYNGEALTLAKPEHRAELGIGFVPQGREIFPLLTVEENLKIGLRAVRKQGIKKVPEHIYELFPVLKQMLKRRGGDLSGGQQQQLAIGRALVLNPKLLILDEPTEGIQPNIVSEIGDVIIRLNRAKGITTPLLKQGDEAKDEVREGIIKIKNELGVTVLLVEQKLPFARKVADRFYIMDRGRGVAAGAMDELSDDMVKRYLTV

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
134 2547132374 Acidovorax radicis N35 Isolate Unclassified
135 2643221570 Acidovorax sp. Root568 Isolate Unclassified
136 2643221596 Acidovorax sp. Root70 Isolate Unclassified
137 2643221609 Acidovorax sp. Root217 Isolate Unclassified
138 2643221611 Acidovorax sp. Root219 Isolate Unclassified
139 2643221652 Acidovorax sp. Root402 Isolate Unclassified
140 2643221717 Acidovorax sp. Root267 Isolate Unclassified
141 2738543012 Acidovorax sp. CF301 Isolate Unclassified
142 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
143 2816332133 Acidovorax radicis 2721A Isolate Unclassified
144 2831864461 Roseateles noduli HZ7 Isolate Nodule
145 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
146 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
147 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
148 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
149 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
150 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.79
Metatranscriptomes 0
Isolates 8.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.38
Nodule 0.48
Rhizoplane 6.28
Rhizosphere 81.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10000986 3300031251 Bacteria 40541
2 JGI25406J46586_10043747 3300003203 Bacteria 1556
3 rootH1_10001360 3300003323 Bacteria 3136
4 Ga0055526_1024091 3300003771 Bacteria 2006
5 Ga0055543_1014948 3300004625 Bacteria 1502
6 Ga0065165_1000153 3300005262 Bacteria 120209
7 Ga0070683_100124031 3300005329 Bacteria 2441
8 Ga0070683_100157075 3300005329 Bacteria 2157
9 Ga0070670_100030223 3300005331 Bacteria 4665
10 Ga0068869_100535632 3300005334 Bacteria 982
11 Ga0068869_100611501 3300005334 Bacteria 922
12 Ga0070689_100006590 3300005340 Bacteria 8055
13 Ga0070689_100229076 3300005340 Bacteria 1527
14 Ga0070687_100380250 3300005343 Bacteria 920
15 Ga0070668_100163094 3300005347 Bacteria 1810
16 Ga0070669_100024809 3300005353 Bacteria 4303
17 Ga0070674_100008310 3300005356 Bacteria 6175
18 Ga0070673_100000314 3300005364 Bacteria 25487
19 Ga0070673_100012274 3300005364 Bacteria 5876
20 Ga0070667_100123654 3300005367 Bacteria 2253
21 Ga0070701_10466790 3300005438 Bacteria 813
22 Ga0070708_100048390 3300005445 Bacteria 3758
23 Ga0070708_100156296 3300005445 Bacteria 2123
24 Ga0070678_100645937 3300005456 Bacteria 949
25 Ga0068867_100056536 3300005459 Bacteria 2903
26 Ga0070685_10156755 3300005466 Bacteria 1448
27 Ga0070706_100110989 3300005467 Bacteria 2552
28 Ga0070706_100391032 3300005467 Bacteria 1295
29 Ga0070707_100001505 3300005468 Bacteria 22723
30 Ga0070707_100036304 3300005468 Bacteria 4702
31 Ga0070707_100286725 3300005468 Bacteria 1600
32 Ga0070698_100004704 3300005471 Bacteria 14997
33 Ga0070698_100030258 3300005471 Bacteria 5615
34 Ga0070698_100120385 3300005471 Bacteria 2585
35 Ga0070699_100008224 3300005518 Bacteria 9052
36 Ga0070697_100097058 3300005536 Bacteria 2445
37 Ga0070697_100115125 3300005536 Bacteria 2244
38 Ga0068853_100285905 3300005539 Bacteria 1521
39 Ga0070672_100026337 3300005543 Bacteria 4325
40 Ga0070672_100046210 3300005543 Bacteria 3372
41 Ga0070672_100210118 3300005543 Bacteria 1630
42 Ga0070686_100035526 3300005544 Bacteria 3079
43 Ga0070686_100567579 3300005544 Bacteria 890
44 Ga0070665_100740683 3300005548 Bacteria 996
45 Ga0068861_100042773 3300005719 Bacteria 3397
46 Ga0068863_101048980 3300005841 Bacteria 819
47 Ga0081539_10000166 3300005985 Bacteria 153758
48 Ga0070716_100221666 3300006173 Bacteria 1271
49 Ga0075366_10148319 3300006195 Bacteria 1420
50 Ga0097621_100964960 3300006237 Bacteria 796
51 Ga0075428_100000969 3300006844 Bacteria 30328
52 Ga0075428_100035320 3300006844 Bacteria 5511
53 Ga0075430_100090614 3300006846 Bacteria 2558
54 Ga0075431_100000214 3300006847 Bacteria 42782
55 Ga0075431_100072947 3300006847 Bacteria 3542
56 Ga0075431_100151149 3300006847 Bacteria 2391
57 Ga0075434_100043804 3300006871 Bacteria 4439
58 Ga0075429_100314594 3300006880 Bacteria 1370
59 Ga0075436_100003678 3300006914 Bacteria 10510
60 Ga0075435_100006360 3300007076 Bacteria 8349
61 Ga0075435_100017471 3300007076 Bacteria 5432
62 Ga0099794_10048832 3300007265 Bacteria 2032
63 Ga0111539_10189830 3300009094 Bacteria 2398
64 Ga0114129_10000029 3300009147 Bacteria 112121
65 Ga0114129_10002778 3300009147 Bacteria 24395
66 Ga0114129_10010175 3300009147 Bacteria 13407
67 Ga0114129_10015616 3300009147 Bacteria 10797
68 Ga0114129_10785412 3300009147 Bacteria 1216
69 Ga0105237_10052649 3300009545 Bacteria 4085
70 Ga0157319_1000016 3300012497 Bacteria 127256
71 Ga0157378_10044420 3300013297 Bacteria 3946
72 Ga0157376_10461617 3300014969 Bacteria 1241
73 Ga0209673_1015823 3300025273 Bacteria 2845
74 Ga0209564_1000008 3300025295 Bacteria 953227
75 Ga0207680_10082392 3300025903 Bacteria 2025
76 Ga0207684_10003645 3300025910 Bacteria 14965
77 Ga0207671_10124441 3300025914 Bacteria 1973
78 Ga0207662_10132177 3300025918 Bacteria 1574
79 Ga0207646_10547480 3300025922 Bacteria 1041
80 Ga0207681_10017458 3300025923 Bacteria 4505
81 Ga0207650_10008981 3300025925 Bacteria 6832
82 Ga0207686_10398152 3300025934 Bacteria 1048
83 Ga0207670_10001660 3300025936 Bacteria 11621
84 Ga0207670_10036563 3300025936 Bacteria 3194
85 Ga0207670_10202226 3300025936 Bacteria 1510
86 Ga0207669_10078835 3300025937 Bacteria 2100
87 Ga0207704_10002304 3300025938 Bacteria 8576
88 Ga0207691_10007776 3300025940 Bacteria 10322
89 Ga0207691_10036621 3300025940 Bacteria 4546
90 Ga0207691_10058805 3300025940 Bacteria 3496
91 Ga0207691_10624218 3300025940 Bacteria 911
92 Ga0207661_10019630 3300025944 Bacteria 5043
93 Ga0207661_10207550 3300025944 Bacteria 1725
94 Ga0207651_10003803 3300025960 Bacteria 7478
95 Ga0207651_10009689 3300025960 Bacteria 5294
96 Ga0207668_10006644 3300025972 Bacteria 6840
97 Ga0207640_10143935 3300025981 Bacteria 1742
98 Ga0207658_10281185 3300025986 Bacteria 1426
99 Ga0207677_10287943 3300026023 Bacteria 1352
100 Ga0207708_10042385 3300026075 Bacteria 3469
101 Ga0207708_10299523 3300026075 Bacteria 1308
102 Ga0207648_10146010 3300026089 Bacteria 2086
103 Ga0207674_10775811 3300026116 Bacteria 925
104 Ga0207675_100132771 3300026118 Bacteria 2361
105 Ga0209588_1002918 3300027671 Bacteria 4699
106 Ga0207428_10052087 3300027907 Bacteria 3270
107 Ga0268266_10397994 3300028379 Bacteria 1302
108 Ga0265332_10061969 3300031238 Bacteria 1599
109 Ga0265320_10083879 3300031240 Bacteria 1485
110 Ga0265325_10009438 3300031241 Bacteria 5694
111 Ga0265325_10102411 3300031241 Bacteria 1400
112 Ga0307513_10202590 3300031456 Bacteria 1824
113 Ga0307408_100117970 3300031548 Bacteria 2051
114 Ga0265313_10018307 3300031595 Bacteria 3938
115 Ga0265342_10095527 3300031712 Bacteria 1699
116 Ga0307409_100305678 3300031995 Bacteria 1482
117 Ga0307415_100137485 3300032126 Bacteria 1861
118 Ga0373953_0006858 3300035117 Bacteria 3781
119 Ga0373954_0010807 3300035118 Bacteria 4035
120 Ga0373956_0015224 3300035119 Bacteria 3218
121 Ga0373955_0103941 3300035172 Bacteria 1634
122 Ga0373935_0089291 3300035692 Bacteria 2015
123 Ga0373933_0063289 3300035724 Bacteria 2236
124 Ga0373947_0068856 3300035725 Bacteria 2165
125 Ga0373937_0001753 3300036401 Bacteria 18252
126 Ga0373937_0110376 3300036401 Bacteria 2558
127 Ga0316584_0012513 3300036712 Bacteria 5985
128 Ga0395900_0076427 3300037418 Bacteria 3442
129 Ga0395905_0004017 3300037471 Bacteria 15440
130 Ga0395905_0147800 3300037471 Bacteria 2211
131 Ga0395905_0394533 3300037471 Bacteria 1278
132 Ga0400483_158765 3300039062 Bacteria 9661
133 Ga0436365_1558431 3300039437 Bacteria 2436
134 Ga0436360_1209741 3300039438 Bacteria 1187
135 Ga0451577_0000479 3300042876 Bacteria 68148
136 Ga0451577_0017842 3300042876 Bacteria 6547
137 Ga0451577_0055136 3300042876 Bacteria 3547
138 Ga0453684_0002411 3300044712 Bacteria 45566
139 Ga0453684_0039923 3300044712 Bacteria 6383
140 Ga0453684_0056585 3300044712 Bacteria 5086
141 Ga0453684_0369841 3300044712 Bacteria 1612
142 Ga0451576_0001218 3300045051 Bacteria 45828
143 Ga0451576_0041903 3300045051 Bacteria 4837
144 Ga0451576_0056867 3300045051 Bacteria 4089
145 Ga0495630_0010293 3300046517 Bacteria 6748
146 Ga0495586_0026121 3300046535 Bacteria 3124
147 Ga0495634_0001496 3300046642 Bacteria 20684
148 Ga0495674_0006393 3300047319 Bacteria 11295
149 Ga0496100_0019923 3300048903 Bacteria 4013
150 Ga0496101_0032516 3300048904 Bacteria 3673
151 Ga0496104_0237914 3300048907 Bacteria 1733
152 Ga0496104_0302654 3300048907 Bacteria 1511
153 Ga0496104_0407454 3300048907 Bacteria 1272
154 Ga0496107_0117220 3300048910 Bacteria 1960
155 Ga0496108_0077760 3300048911 Bacteria 2807
156 Ga0496114_0001911 3300048917 Bacteria 15861
157 Ga0496114_0009131 3300048917 Bacteria 7861
158 Ga0496114_0010619 3300048917 Bacteria 7326
159 Ga0496115_0014571 3300048918 Bacteria 5952
160 Ga0496115_0111584 3300048918 Bacteria 2247
161 Ga0496118_0177882 3300048921 Bacteria 1290
162 Ga0496126_0337434 3300048929 Bacteria 1235
163 Ga0501067_0012092 3300049583 Bacteria 4785
164 Ga0501071_0210375 3300049587 Bacteria 1462
165 Ga0501073_0057553 3300049589 Bacteria 2718
166 Ga0501073_0114729 3300049589 Bacteria 1867
167 Ga0501075_0114994 3300049591 Bacteria 2046
168 Ga0501079_0236872 3300049741 Bacteria 1426
169 nmdc:mga00v17_181049_c1 3300050491 Bacteria 1360
170 nmdc:mga05p37_16650_c1 3300050507 Bacteria 8856
171 nmdc:mga05p37_1973_c1 3300050507 Bacteria 23917
172 nmdc:mga05p37_361_c1 3300050507 Bacteria 48892
173 nmdc:mga05p37_57588_c1 3300050507 Bacteria 4787
174 nmdc:mga09592_67062_c1 3300050508 Bacteria 3043
175 nmdc:mga09592_81596_c1 3300050508 Bacteria 2756
176 nmdc:mga0qj67_114707_c1 3300050509 Bacteria 2176
177 nmdc:mga0qj67_614214_c1 3300050509 Bacteria 869
178 nmdc:mga06r32_1636_c1 3300050510 Bacteria 20213
179 nmdc:mga06r32_43200_c1 3300050510 Bacteria 4288
180 nmdc:mga08y16_21820_c1 3300050511 Bacteria 6757
181 nmdc:mga08y16_314904_c1 3300050511 Bacteria 1611
182 nmdc:mga0n895_17606_c1 3300050512 Bacteria 6591
183 nmdc:mga0n895_80320_c1 3300050512 Bacteria 3249
184 nmdc:mga0rr50_17552_c1 3300050513 Bacteria 4781
185 nmdc:mga0rr50_8063_c1 3300050513 Bacteria 6534
186 nmdc:mga08x19_3126_c1 3300050514 Bacteria 9953
187 nmdc:mga0a205_169929_c1 3300050515 Bacteria 2076
188 nmdc:mga0a205_23025_c1 3300050515 Bacteria 5907
189 Ga0495601_0021209 3300053077 Bacteria 3978
190 Ga0495595_0115788 3300053084 Bacteria 1303
191 2548498913 2547132374 Bacteria 5530232
192 2643867884 2643221570 Bacteria 5103772
193 2643991751 2643221596 Bacteria 5006805
194 2644059020 2643221609 Bacteria 6756331
195 2644071243 2643221611 Bacteria 6820941
196 2644293495 2643221652 Bacteria 5140275
197 2644648372 2643221717 Bacteria 5676132
198 2739246278 2738543012 Bacteria 7115078
199 2787437941 2786546517 Bacteria 6614109
200 2816471339 2816332133 Bacteria 7249298
201 2831865602 2831864461 Bacteria 6502356
202 2840883212 2840878972 Bacteria 5483153
203 2894510617 2894510363 Bacteria 5121143
204 2899279342 2899275550 Bacteria 3958688
205 2989394257 2989392574 Bacteria 4554005
206 8001525925 8001522603 Bacteria 4726425
207 8057134588 8057132660 Bacteria 4061191
208 Ga0265327_10000986
209 JGI25406J46586_10043747
210 rootH1_10001360
211 Ga0055526_1024091
212 Ga0055543_1014948
213 Ga0065165_1000153
214 Ga0070683_100124031
215 Ga0070683_100157075
216 Ga0070670_100030223
217 Ga0068869_100535632
218 Ga0068869_100611501
219 Ga0070689_100006590
220 Ga0070689_100229076
221 Ga0070687_100380250
222 Ga0070668_100163094
223 Ga0070669_100024809
224 Ga0070674_100008310
225 Ga0070673_100000314
226 Ga0070673_100012274
227 Ga0070667_100123654
228 Ga0070701_10466790
229 Ga0070708_100048390
230 Ga0070708_100156296
231 Ga0070678_100645937
232 Ga0068867_100056536
233 Ga0070685_10156755
234 Ga0070706_100110989
235 Ga0070706_100391032
236 Ga0070707_100001505
237 Ga0070707_100036304
238 Ga0070707_100286725
239 Ga0070698_100004704
240 Ga0070698_100030258
241 Ga0070698_100120385
242 Ga0070699_100008224
243 Ga0070697_100097058
244 Ga0070697_100115125
245 Ga0068853_100285905
246 Ga0070672_100026337
247 Ga0070672_100046210
248 Ga0070672_100210118
249 Ga0070686_100035526
250 Ga0070686_100567579
251 Ga0070665_100740683
252 Ga0068861_100042773
253 Ga0068863_101048980
254 Ga0081539_10000166
255 Ga0070716_100221666
256 Ga0075366_10148319
257 Ga0097621_100964960
258 Ga0075428_100000969
259 Ga0075428_100035320
260 Ga0075430_100090614
261 Ga0075431_100000214
262 Ga0075431_100072947
263 Ga0075431_100151149
264 Ga0075434_100043804
265 Ga0075429_100314594
266 Ga0075436_100003678
267 Ga0075435_100006360
268 Ga0075435_100017471
269 Ga0099794_10048832
270 Ga0111539_10189830
271 Ga0114129_10000029
272 Ga0114129_10002778
273 Ga0114129_10010175
274 Ga0114129_10015616
275 Ga0114129_10785412
276 Ga0105237_10052649
277 Ga0157319_1000016
278 Ga0157378_10044420
279 Ga0157376_10461617
280 Ga0209673_1015823
281 Ga0209564_1000008
282 Ga0207680_10082392
283 Ga0207684_10003645
284 Ga0207671_10124441
285 Ga0207662_10132177
286 Ga0207646_10547480
287 Ga0207681_10017458
288 Ga0207650_10008981
289 Ga0207686_10398152
290 Ga0207670_10001660
291 Ga0207670_10036563
292 Ga0207670_10202226
293 Ga0207669_10078835
294 Ga0207704_10002304
295 Ga0207691_10007776
296 Ga0207691_10036621
297 Ga0207691_10058805
298 Ga0207691_10624218
299 Ga0207661_10019630
300 Ga0207661_10207550
301 Ga0207651_10003803
302 Ga0207651_10009689
303 Ga0207668_10006644
304 Ga0207640_10143935
305 Ga0207658_10281185
306 Ga0207677_10287943
307 Ga0207708_10042385
308 Ga0207708_10299523
309 Ga0207648_10146010
310 Ga0207674_10775811
311 Ga0207675_100132771
312 Ga0209588_1002918
313 Ga0207428_10052087
314 Ga0268266_10397994
315 Ga0265332_10061969
316 Ga0265320_10083879
317 Ga0265325_10009438
318 Ga0265325_10102411
319 Ga0307513_10202590
320 Ga0307408_100117970
321 Ga0265313_10018307
322 Ga0265342_10095527
323 Ga0307409_100305678
324 Ga0307415_100137485
325 Ga0373953_0006858
326 Ga0373954_0010807
327 Ga0373956_0015224
328 Ga0373955_0103941
329 Ga0373935_0089291
330 Ga0373933_0063289
331 Ga0373947_0068856
332 Ga0373937_0001753
333 Ga0373937_0110376
334 Ga0316584_0012513
335 Ga0395900_0076427
336 Ga0395905_0004017
337 Ga0395905_0147800
338 Ga0395905_0394533
339 Ga0400483_158765
340 Ga0436365_1558431
341 Ga0436360_1209741
342 Ga0451577_0000479
343 Ga0451577_0017842
344 Ga0451577_0055136
345 Ga0453684_0002411
346 Ga0453684_0039923
347 Ga0453684_0056585
348 Ga0453684_0369841
349 Ga0451576_0001218
350 Ga0451576_0041903
351 Ga0451576_0056867
352 Ga0495630_0010293
353 Ga0495586_0026121
354 Ga0495634_0001496
355 Ga0495674_0006393
356 Ga0496100_0019923
357 Ga0496101_0032516
358 Ga0496104_0237914
359 Ga0496104_0302654
360 Ga0496104_0407454
361 Ga0496107_0117220
362 Ga0496108_0077760
363 Ga0496114_0001911
364 Ga0496114_0009131
365 Ga0496114_0010619
366 Ga0496115_0014571
367 Ga0496115_0111584
368 Ga0496118_0177882
369 Ga0496126_0337434
370 Ga0501067_0012092
371 Ga0501071_0210375
372 Ga0501073_0057553
373 Ga0501073_0114729
374 Ga0501075_0114994
375 Ga0501079_0236872
376 nmdc:mga00v17_181049_c1
377 nmdc:mga05p37_16650_c1
378 nmdc:mga05p37_1973_c1
379 nmdc:mga05p37_361_c1
380 nmdc:mga05p37_57588_c1
381 nmdc:mga09592_67062_c1
382 nmdc:mga09592_81596_c1
383 nmdc:mga0qj67_114707_c1
384 nmdc:mga0qj67_614214_c1
385 nmdc:mga06r32_1636_c1
386 nmdc:mga06r32_43200_c1
387 nmdc:mga08y16_21820_c1
388 nmdc:mga08y16_314904_c1
389 nmdc:mga0n895_17606_c1
390 nmdc:mga0n895_80320_c1
391 nmdc:mga0rr50_17552_c1
392 nmdc:mga0rr50_8063_c1
393 nmdc:mga08x19_3126_c1
394 nmdc:mga0a205_169929_c1
395 nmdc:mga0a205_23025_c1
396 Ga0495601_0021209
397 Ga0495595_0115788
398 2548498913
399 2643867884
400 2643991751
401 2644059020
402 2644071243
403 2644293495
404 2644648372
405 2739246278
406 2787437941
407 2816471339
408 2831865602
409 2840883212
410 2894510617
411 2899279342
412 2989394257
413 8001525925
414 8057134588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

17

162

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9501 2 224
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9428 2 219
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9351 2 217
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9321 2 214
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9287 2 219
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9451 1 226 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9428 2 213 3.40.50.300
af_O69724_1_242_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9361 1 216 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9345 1 224 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.933 1 226 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V6WYU4-F1-model_v4 ABC transporter ATP-binding protein 0.9875 1 197 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A2V6WYU4-F1-model_v4 ABC transporter ATP-binding protein 0.9826 1 197 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A418UYB5-F1-model_v4 Urea ABC transporter ATP-binding subunit UrtE 0.9733 1 228 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-Q132A8-F1-model_v4 ABC transporter related 0.9726 1 228 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A135HQG9-F1-model_v4 Urea ABC transporter ATP-binding subunit UrtE 0.9721 1 228 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map