F316550

General Info

Members Datasets Scaffolds Average Seq Length
207 136 414 124

Family's Representative Sequence

Representative Sequence 3300025908|Ga0207643_10599343|Ga0207643_105993432
Length 153
Sequence MAYPAELKYTKDHEWVRVTGDTAEVGITDYAQQQLGDVVYVELPDVGREISAGESFGSIESVKAVSELFAPMSGEVVEINPALKDHPEKVNSDPHITWMIPRIASPRDSEPPRYRVTACSIASRCSACLRSVMSTMVPMRPATSSPAPAKVAL

Samples

Sample ID Description Type Environment
1 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
102 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
103 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
111 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
119 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
120 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
123 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
124 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
125 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
126 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
131 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
132 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
133 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
134 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
135 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
136 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.45
Nodule 0
Rhizoplane 1.93
Rhizosphere 96.14
Stem 0
Stem Tuber 0
Unclassified 1.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207643_10599343 3300025908 Bacteria 709
2 JGI25406J46586_10000932 3300003203 Bacteria 13775
3 JGI25406J46586_10001588 3300003203 Bacteria 10728
4 JGI25406J46586_10044626 3300003203 Bacteria 1533
5 Ga0065712_10185927 3300005290 Bacteria 1169
6 Ga0065715_10583237 3300005293 Bacteria 719
7 Ga0065707_10286047 3300005295 Bacteria 1036
8 Ga0065707_10342333 3300005295 Bacteria 931
9 Ga0065707_11006578 3300005295 Bacteria 537
10 Ga0070683_100244718 3300005329 Bacteria 1706
11 Ga0070677_10019951 3300005333 Bacteria 2436
12 Ga0070677_10064851 3300005333 Bacteria 1518
13 Ga0068869_100055717 3300005334 Bacteria 2882
14 Ga0068869_100074596 3300005334 Bacteria 2518
15 Ga0070689_101316217 3300005340 Bacteria 651
16 Ga0070661_100428285 3300005344 Bacteria 1050
17 Ga0070661_100854052 3300005344 Bacteria 749
18 Ga0070668_100525590 3300005347 Bacteria 1027
19 Ga0070675_100002578 3300005354 Bacteria 13585
20 Ga0070675_100038662 3300005354 Bacteria 3890
21 Ga0070675_100183371 3300005354 Bacteria 1811
22 Ga0070671_101147244 3300005355 Bacteria 683
23 Ga0070671_101591355 3300005355 Bacteria 579
24 Ga0070674_100572357 3300005356 Bacteria 951
25 Ga0070674_101288519 3300005356 Bacteria 651
26 Ga0070673_100238820 3300005364 Bacteria 1579
27 Ga0070673_100275459 3300005364 Bacteria 1474
28 Ga0070673_100401471 3300005364 Unclassified 1226
29 Ga0070688_100144392 3300005365 Bacteria 1620
30 Ga0070659_100081794 3300005366 Bacteria 2580
31 Ga0070700_100310480 3300005441 Bacteria 1155
32 Ga0070694_101082848 3300005444 Bacteria 668
33 Ga0070678_100328570 3300005456 Bacteria 1308
34 Ga0070662_101538118 3300005457 Bacteria 574
35 Ga0068867_100784738 3300005459 Bacteria 848
36 Ga0070698_100154586 3300005471 Bacteria 2240
37 Ga0070699_100019842 3300005518 Bacteria 5794
38 Ga0070684_101214675 3300005535 Bacteria 709
39 Ga0070684_101562640 3300005535 Bacteria 622
40 Ga0070672_100084996 3300005543 Bacteria 2542
41 Ga0070672_100120824 3300005543 Bacteria 2144
42 Ga0070686_100242847 3300005544 Bacteria 1312
43 Ga0070686_100918484 3300005544 Bacteria 713
44 Ga0070696_101726865 3300005546 Bacteria 540
45 Ga0070664_100020561 3300005564 Bacteria 5435
46 Ga0068857_101233382 3300005577 Bacteria 725
47 Ga0068854_101018227 3300005578 Bacteria 734
48 Ga0070702_100326334 3300005615 Bacteria 1072
49 Ga0070702_100436871 3300005615 Bacteria 946
50 Ga0070702_100734931 3300005615 Bacteria 756
51 Ga0068852_100700536 3300005616 Bacteria 1023
52 Ga0068859_100788832 3300005617 Bacteria 1038
53 Ga0068859_102580710 3300005617 Bacteria 559
54 Ga0068861_100392060 3300005719 Bacteria 1230
55 Ga0068861_100458135 3300005719 Bacteria 1144
56 Ga0068870_10403241 3300005840 Bacteria 890
57 Ga0068858_101283247 3300005842 Bacteria 721
58 Ga0068860_100447630 3300005843 Bacteria 1284
59 Ga0068860_101107675 3300005843 Bacteria 811
60 Ga0068862_100301574 3300005844 Bacteria 1474
61 Ga0068862_100563867 3300005844 Bacteria 1089
62 Ga0068862_100971111 3300005844 Bacteria 839
63 Ga0068862_101226420 3300005844 Bacteria 749
64 Ga0081538_10030261 3300005981 Bacteria 3679
65 Ga0081539_10000056 3300005985 Bacteria 256522
66 Ga0081539_10000722 3300005985 Bacteria 66164
67 Ga0081539_10003038 3300005985 Bacteria 21740
68 Ga0070712_100084226 3300006175 Bacteria 2311
69 Ga0068871_100229466 3300006358 Bacteria 1611
70 Ga0068871_101416288 3300006358 Unclassified 655
71 Ga0075428_100165381 3300006844 Bacteria 2400
72 Ga0075433_10083802 3300006852 Bacteria 2814
73 Ga0097620_100788677 3300006931 Bacteria 1038
74 Ga0097620_102580564 3300006931 Bacteria 559
75 Ga0111539_11463340 3300009094 Bacteria 792
76 Ga0111539_12017492 3300009094 Bacteria 669
77 Ga0105245_10163598 3300009098 Bacteria 2113
78 Ga0114129_10784589 3300009147 Bacteria 1217
79 Ga0105243_10887683 3300009148 Bacteria 886
80 Ga0105248_10302568 3300009177 Bacteria 1801
81 Ga0105248_10393449 3300009177 Bacteria 1561
82 Ga0105248_10751647 3300009177 Bacteria 1100
83 Ga0105246_10741094 3300011119 Bacteria 866
84 Ga0157371_11551097 3300013102 Unclassified 517
85 Ga0157370_10416033 3300013104 Bacteria 1237
86 Ga0157374_10285944 3300013296 Bacteria 1629
87 Ga0163162_10984814 3300013306 Bacteria 953
88 Ga0163162_11186028 3300013306 Bacteria 866
89 Ga0157375_11558063 3300013308 Bacteria 781
90 Ga0157380_10011193 3300014326 Bacteria 6475
91 Ga0157380_10578305 3300014326 Bacteria 1107
92 Ga0157380_11813828 3300014326 Bacteria 669
93 Ga0157380_13342631 3300014326 Bacteria 513
94 Ga0157376_12184578 3300014969 Bacteria 592
95 Ga0157376_12778401 3300014969 Bacteria 529
96 Ga0163161_10711716 3300017792 Bacteria 837
97 Ga0207688_10834415 3300025901 Bacteria 584
98 Ga0207645_10653523 3300025907 Bacteria 714
99 Ga0207705_10453577 3300025909 Bacteria 994
100 Ga0207693_10358109 3300025915 Bacteria 1141
101 Ga0207657_10354026 3300025919 Bacteria 1158
102 Ga0207657_10858712 3300025919 Bacteria 700
103 Ga0207649_10768095 3300025920 Bacteria 751
104 Ga0207681_10102360 3300025923 Bacteria 2068
105 Ga0207681_10422627 3300025923 Bacteria 1080
106 Ga0207659_10002116 3300025926 Bacteria 11762
107 Ga0207659_10034868 3300025926 Bacteria 3474
108 Ga0207659_10416079 3300025926 Bacteria 1127
109 Ga0207644_11868765 3300025931 Bacteria 502
110 Ga0207690_10036545 3300025932 Bacteria 3181
111 Ga0207709_11456654 3300025935 Bacteria 568
112 Ga0207669_10195596 3300025937 Bacteria 1463
113 Ga0207669_11667745 3300025937 Bacteria 544
114 Ga0207691_10253839 3300025940 Bacteria 1517
115 Ga0207711_10670167 3300025941 Bacteria 968
116 Ga0207689_10094186 3300025942 Bacteria 2460
117 Ga0207689_10161014 3300025942 Bacteria 1849
118 Ga0207661_10225789 3300025944 Bacteria 1657
119 Ga0207651_10217936 3300025960 Bacteria 1541
120 Ga0207651_10303199 3300025960 Bacteria 1329
121 Ga0207651_10353324 3300025960 Bacteria 1238
122 Ga0207668_10376795 3300025972 Bacteria 1193
123 Ga0207677_10320977 3300026023 Bacteria 1287
124 Ga0207703_10700434 3300026035 Bacteria 963
125 Ga0207708_10140655 3300026075 Bacteria 1893
126 Ga0207641_12363015 3300026088 Bacteria 531
127 Ga0207648_10465783 3300026089 Bacteria 1153
128 Ga0207683_10366480 3300026121 Bacteria 1323
129 Ga0207698_11635214 3300026142 Bacteria 659
130 Ga0268265_10156565 3300028380 Bacteria 1929
131 Ga0268265_10636992 3300028380 Bacteria 1023
132 Ga0268265_10701037 3300028380 Bacteria 978
133 Ga0268264_10630319 3300028381 Bacteria 1059
134 Ga0268264_11013146 3300028381 Bacteria 837
135 Ga0307405_10249671 3300031731 Bacteria 1319
136 Ga0307405_10299740 3300031731 Bacteria 1219
137 Ga0307405_10735687 3300031731 Bacteria 820
138 Ga0307405_11462972 3300031731 Bacteria 599
139 Ga0307413_10282561 3300031824 Bacteria 1249
140 Ga0307410_10007670 3300031852 Bacteria 5922
141 Ga0307410_10200802 3300031852 Bacteria 1522
142 Ga0307410_11002214 3300031852 Bacteria 720
143 Ga0307406_10290725 3300031901 Bacteria 1251
144 Ga0307406_11865292 3300031901 Bacteria 535
145 Ga0307407_10000955 3300031903 Bacteria 9839
146 Ga0307407_10227395 3300031903 Bacteria 1265
147 Ga0307407_10696095 3300031903 Bacteria 765
148 Ga0307407_11191570 3300031903 Bacteria 595
149 Ga0307412_10112803 3300031911 Bacteria 1944
150 Ga0307412_12191232 3300031911 Bacteria 514
151 Ga0307412_12229215 3300031911 Unclassified 510
152 Ga0307409_100009811 3300031995 Bacteria 5905
153 Ga0307409_100625948 3300031995 Bacteria 1067
154 Ga0307416_100282807 3300032002 Bacteria 1637
155 Ga0307414_10315078 3300032004 Bacteria 1329
156 Ga0307414_10370727 3300032004 Bacteria 1235
157 Ga0307414_11744398 3300032004 Bacteria 581
158 Ga0307411_10004203 3300032005 Bacteria 6845
159 Ga0307411_10358096 3300032005 Bacteria 1192
160 Ga0307411_11086427 3300032005 Bacteria 720
161 Ga0307415_100105775 3300032126 Bacteria 2076
162 Ga0307415_101454630 3300032126 Bacteria 654
163 Ga0373939_0088640 3300035114 Bacteria 1042
164 Ga0373931_0570328 3300035691 Bacteria 737
165 Ga0439439_0233742 3300041406 Bacteria 541
166 Ga0451791_0417111 3300041451 Bacteria 653
167 Ga0451800_0325767 3300041459 Bacteria 526
168 Ga0451853_3641819 3300041512 Bacteria 798
169 Ga0439433_0079146 3300041999 Bacteria 798
170 Ga0495638_0003000 3300046460 Bacteria 13481
171 Ga0495634_0424872 3300046642 Bacteria 787
172 Ga0496108_0326985 3300048911 Bacteria 1337
173 Ga0496114_0611844 3300048917 Bacteria 960
174 Ga0501298_016330 3300049521 Bacteria 1345
175 Ga0501299_157767 3300049522 Bacteria 577
176 Ga0501040_0276223 3300049576 Bacteria 1200
177 Ga0501042_0315624 3300049578 Bacteria 1129
178 Ga0501070_0783550 3300049586 Bacteria 750
179 Ga0501074_0784335 3300049590 Bacteria 672
180 Ga0501075_0817854 3300049591 Bacteria 709
181 Ga0501076_1092574 3300049592 Archaea 657
182 Ga0501256_037679 3300049685 Bacteria 565
183 Ga0501225_0050521 3300049705 Bacteria 1157
184 Ga0501225_0240263 3300049705 Bacteria 591
185 Ga0501234_113185 3300049707 Bacteria 501
186 Ga0501080_0502366 3300049742 Bacteria 1084
187 Ga0501241_111681 3300049758 Bacteria 599
188 Ga0501263_029770 3300049760 Bacteria 766
189 Ga0501263_069232 3300049760 Bacteria 567
190 Ga0501264_027030 3300049761 Bacteria 641
191 Ga0501267_029143 3300049764 Bacteria 643
192 Ga0501283_008862 3300049779 Bacteria 1458
193 Ga0501283_012339 3300049779 Bacteria 1283
194 nmdc:mga05p37_341539_c1 3300050507 Bacteria 1765
195 nmdc:mga0n895_1489390_c1 3300050512 Bacteria 643
196 nmdc:mga0a205_51370_c1 3300050515 Bacteria 3979
197 Ga0500592_023705 3300053116 Bacteria 989
198 Ga0500658_0325948 3300053134 Bacteria 706
199 Ga0500611_009040 3300053727 Bacteria 1564
200 Ga0590071_000723 3300059421 Bacteria 9316
201 Ga0590071_111571 3300059421 Bacteria 694
202 Ga0590071_155801 3300059421 Bacteria 593
203 Ga0590074_000042 3300059423 Bacteria 12110
204 Ga0590075_000135 3300059424 Bacteria 19348
205 Ga0590075_006232 3300059424 Bacteria 2829
206 Ga0590075_048783 3300059424 Bacteria 1086
207 Ga0590077_000999 3300059426 Bacteria 7159
208 Ga0207643_10599343
209 JGI25406J46586_10000932
210 JGI25406J46586_10001588
211 JGI25406J46586_10044626
212 Ga0065712_10185927
213 Ga0065715_10583237
214 Ga0065707_10286047
215 Ga0065707_10342333
216 Ga0065707_11006578
217 Ga0070683_100244718
218 Ga0070677_10019951
219 Ga0070677_10064851
220 Ga0068869_100055717
221 Ga0068869_100074596
222 Ga0070689_101316217
223 Ga0070661_100428285
224 Ga0070661_100854052
225 Ga0070668_100525590
226 Ga0070675_100002578
227 Ga0070675_100038662
228 Ga0070675_100183371
229 Ga0070671_101147244
230 Ga0070671_101591355
231 Ga0070674_100572357
232 Ga0070674_101288519
233 Ga0070673_100238820
234 Ga0070673_100275459
235 Ga0070673_100401471
236 Ga0070688_100144392
237 Ga0070659_100081794
238 Ga0070700_100310480
239 Ga0070694_101082848
240 Ga0070678_100328570
241 Ga0070662_101538118
242 Ga0068867_100784738
243 Ga0070698_100154586
244 Ga0070699_100019842
245 Ga0070684_101214675
246 Ga0070684_101562640
247 Ga0070672_100084996
248 Ga0070672_100120824
249 Ga0070686_100242847
250 Ga0070686_100918484
251 Ga0070696_101726865
252 Ga0070664_100020561
253 Ga0068857_101233382
254 Ga0068854_101018227
255 Ga0070702_100326334
256 Ga0070702_100436871
257 Ga0070702_100734931
258 Ga0068852_100700536
259 Ga0068859_100788832
260 Ga0068859_102580710
261 Ga0068861_100392060
262 Ga0068861_100458135
263 Ga0068870_10403241
264 Ga0068858_101283247
265 Ga0068860_100447630
266 Ga0068860_101107675
267 Ga0068862_100301574
268 Ga0068862_100563867
269 Ga0068862_100971111
270 Ga0068862_101226420
271 Ga0081538_10030261
272 Ga0081539_10000056
273 Ga0081539_10000722
274 Ga0081539_10003038
275 Ga0070712_100084226
276 Ga0068871_100229466
277 Ga0068871_101416288
278 Ga0075428_100165381
279 Ga0075433_10083802
280 Ga0097620_100788677
281 Ga0097620_102580564
282 Ga0111539_11463340
283 Ga0111539_12017492
284 Ga0105245_10163598
285 Ga0114129_10784589
286 Ga0105243_10887683
287 Ga0105248_10302568
288 Ga0105248_10393449
289 Ga0105248_10751647
290 Ga0105246_10741094
291 Ga0157371_11551097
292 Ga0157370_10416033
293 Ga0157374_10285944
294 Ga0163162_10984814
295 Ga0163162_11186028
296 Ga0157375_11558063
297 Ga0157380_10011193
298 Ga0157380_10578305
299 Ga0157380_11813828
300 Ga0157380_13342631
301 Ga0157376_12184578
302 Ga0157376_12778401
303 Ga0163161_10711716
304 Ga0207688_10834415
305 Ga0207645_10653523
306 Ga0207705_10453577
307 Ga0207693_10358109
308 Ga0207657_10354026
309 Ga0207657_10858712
310 Ga0207649_10768095
311 Ga0207681_10102360
312 Ga0207681_10422627
313 Ga0207659_10002116
314 Ga0207659_10034868
315 Ga0207659_10416079
316 Ga0207644_11868765
317 Ga0207690_10036545
318 Ga0207709_11456654
319 Ga0207669_10195596
320 Ga0207669_11667745
321 Ga0207691_10253839
322 Ga0207711_10670167
323 Ga0207689_10094186
324 Ga0207689_10161014
325 Ga0207661_10225789
326 Ga0207651_10217936
327 Ga0207651_10303199
328 Ga0207651_10353324
329 Ga0207668_10376795
330 Ga0207677_10320977
331 Ga0207703_10700434
332 Ga0207708_10140655
333 Ga0207641_12363015
334 Ga0207648_10465783
335 Ga0207683_10366480
336 Ga0207698_11635214
337 Ga0268265_10156565
338 Ga0268265_10636992
339 Ga0268265_10701037
340 Ga0268264_10630319
341 Ga0268264_11013146
342 Ga0307405_10249671
343 Ga0307405_10299740
344 Ga0307405_10735687
345 Ga0307405_11462972
346 Ga0307413_10282561
347 Ga0307410_10007670
348 Ga0307410_10200802
349 Ga0307410_11002214
350 Ga0307406_10290725
351 Ga0307406_11865292
352 Ga0307407_10000955
353 Ga0307407_10227395
354 Ga0307407_10696095
355 Ga0307407_11191570
356 Ga0307412_10112803
357 Ga0307412_12191232
358 Ga0307412_12229215
359 Ga0307409_100009811
360 Ga0307409_100625948
361 Ga0307416_100282807
362 Ga0307414_10315078
363 Ga0307414_10370727
364 Ga0307414_11744398
365 Ga0307411_10004203
366 Ga0307411_10358096
367 Ga0307411_11086427
368 Ga0307415_100105775
369 Ga0307415_101454630
370 Ga0373939_0088640
371 Ga0373931_0570328
372 Ga0439439_0233742
373 Ga0451791_0417111
374 Ga0451800_0325767
375 Ga0451853_3641819
376 Ga0439433_0079146
377 Ga0495638_0003000
378 Ga0495634_0424872
379 Ga0496108_0326985
380 Ga0496114_0611844
381 Ga0501298_016330
382 Ga0501299_157767
383 Ga0501040_0276223
384 Ga0501042_0315624
385 Ga0501070_0783550
386 Ga0501074_0784335
387 Ga0501075_0817854
388 Ga0501076_1092574
389 Ga0501256_037679
390 Ga0501225_0050521
391 Ga0501225_0240263
392 Ga0501234_113185
393 Ga0501080_0502366
394 Ga0501241_111681
395 Ga0501263_029770
396 Ga0501263_069232
397 Ga0501264_027030
398 Ga0501267_029143
399 Ga0501283_008862
400 Ga0501283_012339
401 nmdc:mga05p37_341539_c1
402 nmdc:mga0n895_1489390_c1
403 nmdc:mga0a205_51370_c1
404 Ga0500592_023705
405 Ga0500658_0325948
406 Ga0500611_009040
407 Ga0590071_000723
408 Ga0590071_111571
409 Ga0590071_155801
410 Ga0590074_000042
411 Ga0590075_000135
412 Ga0590075_006232
413 Ga0590075_048783
414 Ga0590077_000999

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

7

111

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9817 20 138
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9793 23 139
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9782 20 139
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9732 23 137
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9575 20 139
ID Description Score Start End Superfamily
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9785 23 139 2.40.50.100
af_A4IC11_1_107_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9509 37 140 2.40.50.100
af_Q5AKX1_36_173_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9506 20 139 2.40.50.100
af_K7TZ76_31_128_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9416 53 139 2.40.50.100
3a8jE00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9415 20 139 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A2N3UGE6-F1-model_v4 deleted 0.9965 19 139
AF-A0A7V8YY86-F1-model_v4 Glycine cleavage system H protein 0.993 20 139 GO:0005829
GO:0005960
GO:0019464
AF-A0A532DA06-F1-model_v4 Glycine cleavage system H protein 0.9912 20 139 GO:0005829
GO:0005960
GO:0019464
AF-A0A365XV80-F1-model_v4 Glycine cleavage system H protein 0.9909 19 139 GO:0005829
GO:0005960
GO:0019464
AF-A0A3N5NVZ4-F1-model_v4 Glycine cleavage system H protein 0.99 19 140 GO:0005737
GO:0005960
GO:0019464

Map