F316458

General Info

Members Datasets Scaffolds Average Seq Length
207 149 189 223

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10076415|Ga0105239_100764153
Length 257
Sequence MGIEAAFGSWSASFIFTGPWVSCLICEQQSGKPARIMKIRAIITGATGMVGEGVLHECLLSEEVEAVLVVNRRTCGVTHPKLKEVIHADFFDFSPIRDLLSGYNACYFCLGVSSVGMDKETYYRMTYTLTMHVAETLSQLNRDMTFCYVSGAGTDSTEKGRSNWARVKGKTENDLMKLPFRAAFAFRPGFIRRMEGAKFTHPLYKYIGWMFPLGRALFPGGFAKIEEIGQAMMNVTLNGYPKKIIEGKDIIALGKKG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2739367651 Pedobacter sp. OK291 Isolate Unclassified
7 2739367656 Pedobacter sp. CF523 Isolate Unclassified
8 2739367663 Pedobacter sp. YR510 Isolate Unclassified
9 2818991437 Pedobacter terrae 518 Isolate Unclassified
10 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
11 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
12 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
13 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
14 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
15 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
16 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
17 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
18 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
19 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
23 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
85 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
86 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
87 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
88 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
93 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
148 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
149 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.3
Metatranscriptomes 0
Isolates 8.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.35
Nodule 0
Rhizoplane 0.97
Rhizosphere 83.57
Stem 0
Stem Tuber 0
Unclassified 11.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
2 JGI24737J22298_10000722 3300001990 Bacteria 11635
3 JGI24735J21928_10000009 3300002067 Bacteria 247425
4 JGI25157J39369_1005885 3300002741 Unclassified 1932
5 rootH1_10063162 3300003316 Bacteria 17351
6 rootH1_10126003 3300003316 Bacteria 1470
7 rootL2_10058701 3300003322 Bacteria 6697
8 rootL2_10060810 3300003322 Bacteria 3287
9 rootL2_10094233 3300003322 Bacteria 2140
10 rootL2_10215491 3300003322 Bacteria 3032
11 rootL2_10215492 3300003322 Unclassified 2811
12 rootH1_10003019 3300003323 Bacteria 12697
13 rootH1_10005226 3300003323 Bacteria 2737
14 rootH1_10151007 3300003323 Unclassified 4383
15 JGI25404J52841_10007615 3300003659 Bacteria 2293
16 Ga0055536_1000010 3300003781 Bacteria 304614
17 Ga0055530_10000816 3300003791 Bacteria 25857
18 Ga0065165_1002356 3300005262 Bacteria 16372
19 Ga0065714_10006464 3300005288 Bacteria 3449
20 Ga0065714_10064491 3300005288 Bacteria 50283
21 Ga0065704_10070140 3300005289 Bacteria 482257
22 Ga0065704_10084614 3300005289 Bacteria 3315
23 Ga0070666_10248705 3300005335 Bacteria 1258
24 Ga0070689_100612632 3300005340 Bacteria 944
25 Ga0068867_100001754 3300005459 Bacteria 15105
26 Ga0068853_100005185 3300005539 Bacteria 10193
27 Ga0068855_100020504 3300005563 Bacteria 7926
28 Ga0068855_100035551 3300005563 Bacteria 5934
29 Ga0068855_100109756 3300005563 Bacteria 3167
30 Ga0068854_100017908 3300005578 Bacteria 4749
31 Ga0068856_100056148 3300005614 Bacteria 3885
32 Ga0068856_100109272 3300005614 Bacteria 2762
33 Ga0068852_100003134 3300005616 Bacteria 11517
34 Ga0068859_100003163 3300005617 Bacteria 16740
35 Ga0068863_100206835 3300005841 Bacteria 1889
36 Ga0081540_1012916 3300005983 Bacteria 5460
37 Ga0070716_100343094 3300006173 Bacteria 1054
38 Ga0075366_10055054 3300006195 Bacteria 2363
39 Ga0075428_100442527 3300006844 Bacteria 1392
40 Ga0097620_100003163 3300006931 Bacteria 16740
41 Ga0105240_10006806 3300009093 Bacteria 16714
42 Ga0105240_10015435 3300009093 Bacteria 10386
43 Ga0105241_10463558 3300009174 Bacteria 1123
44 Ga0105237_10001107 3300009545 Bacteria 36103
45 Ga0105237_10001705 3300009545 Bacteria 28418
46 Ga0105237_10003285 3300009545 Bacteria 19310
47 Ga0105237_10017101 3300009545 Bacteria 7523
48 Ga0105237_10022729 3300009545 Bacteria 6434
49 Ga0105238_10054587 3300009551 Bacteria 4012
50 Ga0105239_10000009 3300010375 Bacteria 361182
51 Ga0105239_10005062 3300010375 Bacteria 15567
52 Ga0105239_10076415 3300010375 Bacteria 3683
53 Ga0105239_10861156 3300010375 Bacteria 1039
54 Ga0157373_10012106 3300013100 Bacteria 6341
55 Ga0157371_10000046 3300013102 Bacteria 187304
56 Ga0157371_10193671 3300013102 Bacteria 1456
57 Ga0157370_10114295 3300013104 Bacteria 2522
58 Ga0157370_10192739 3300013104 Bacteria 1892
59 Ga0157369_10000046 3300013105 Bacteria 172851
60 Ga0157369_10000710 3300013105 Bacteria 42913
61 Ga0157369_10036675 3300013105 Bacteria 5370
62 Ga0157369_10170540 3300013105 Bacteria 2293
63 Ga0163162_10000125 3300013306 Bacteria 68593
64 Ga0163162_10006294 3300013306 Bacteria 11497
65 Ga0163162_10266363 3300013306 Bacteria 1845
66 Ga0157372_10001517 3300013307 Bacteria 25239
67 Ga0157372_10009327 3300013307 Bacteria 10440
68 Ga0157372_10139144 3300013307 Bacteria 2796
69 Ga0157372_11118262 3300013307 Unclassified 911
70 Ga0157380_10812283 3300014326 Bacteria 953
71 Ga0182008_10000194 3300014497 Bacteria 47984
72 Ga0182006_1000243 3300015261 Bacteria 50809
73 Ga0182006_1000472 3300015261 Bacteria 31461
74 Ga0182007_10000009 3300015262 Bacteria 316298
75 Ga0183373_1008 3300015682 Bacteria 255339
76 Ga0163161_10000179 3300017792 Bacteria 57833
77 Ga0163161_10000301 3300017792 Bacteria 42977
78 Ga0163161_10005532 3300017792 Bacteria 8752
79 Ga0163161_10027469 3300017792 Bacteria 4037
80 Ga0163161_10034964 3300017792 Bacteria 3595
81 Ga0213872_10051103 3300021361 Bacteria 1876
82 Ga0209026_1000602 3300025250 Bacteria 23171
83 Ga0209676_1000009 3300025292 Bacteria 981719
84 Ga0209050_1000103 3300025298 Bacteria 229225
85 Ga0207680_10280224 3300025903 Bacteria 1158
86 Ga0207654_10279138 3300025911 Bacteria 1129
87 Ga0207654_10420792 3300025911 Bacteria 932
88 Ga0207695_10022228 3300025913 Bacteria 7212
89 Ga0207695_10071004 3300025913 Bacteria 3557
90 Ga0207671_10002014 3300025914 Bacteria 22347
91 Ga0207671_10006501 3300025914 Bacteria 10394
92 Ga0207671_10007857 3300025914 Bacteria 9161
93 Ga0207671_10041927 3300025914 Bacteria 3388
94 Ga0207671_10127605 3300025914 Bacteria 1950
95 Ga0207694_10039821 3300025924 Bacteria 3617
96 Ga0207644_10031964 3300025931 Bacteria 3670
97 Ga0207667_10005062 3300025949 Bacteria 16104
98 Ga0207667_10035131 3300025949 Bacteria 5378
99 Ga0207667_10407156 3300025949 Bacteria 1385
100 Ga0207640_10020061 3300025981 Bacteria 3962
101 Ga0207677_10714462 3300026023 Bacteria 890
102 Ga0207639_10010152 3300026041 Bacteria 6516
103 Ga0207639_10541216 3300026041 Bacteria 1068
104 Ga0207708_10544465 3300026075 Bacteria 978
105 Ga0207702_10037316 3300026078 Bacteria 4067
106 Ga0207676_10181612 3300026095 Bacteria 1843
107 Ga0207674_10000487 3300026116 Bacteria 52391
108 Ga0207698_10160497 3300026142 Bacteria 1965
109 Ga0268264_10003372 3300028381 Bacteria 13801
110 Ga0265326_10005530 3300028558 Bacteria 3984
111 Ga0265319_1009461 3300028563 Bacteria 4148
112 Ga0265334_10046973 3300028573 Bacteria 1667
113 Ga0265323_10000107 3300028653 Bacteria 48675
114 Ga0265322_10000843 3300028654 Bacteria 10929
115 Ga0307517_10000564 3300028786 Bacteria 63395
116 Ga0265338_10038544 3300028800 Bacteria 4525
117 Ga0265324_10002108 3300029957 Bacteria 10496
118 Ga0265330_10003153 3300031235 Bacteria 8727
119 Ga0265328_10012219 3300031239 Bacteria 3419
120 Ga0265320_10011142 3300031240 Bacteria 5306
121 Ga0265329_10000954 3300031242 Bacteria 14562
122 Ga0265340_10050084 3300031247 Bacteria 2027
123 Ga0265339_10005257 3300031249 Bacteria 8638
124 Ga0265331_10006829 3300031250 Bacteria 6683
125 Ga0265316_10008585 3300031344 Bacteria 9469
126 Ga0265316_10427354 3300031344 Bacteria 952
127 Ga0265313_10108280 3300031595 Bacteria 1225
128 Ga0265314_10011023 3300031711 Bacteria 7495
129 Ga0265342_10007720 3300031712 Bacteria 7830
130 Ga0307405_10000016 3300031731 Bacteria 197180
131 Ga0307407_10000006 3300031903 Bacteria 218714
132 Ga0307409_100019218 3300031995 Bacteria 4620
133 Ga0307416_100000058 3300032002 Bacteria 103674
134 Ga0307414_10193646 3300032004 Bacteria 1647
135 Ga0307411_10268153 3300032005 Bacteria 1352
136 Ga0307510_10350055 3300033180 Unclassified 927
137 Ga0373932_0149720 3300035112 Bacteria 800
138 Ga0395899_0001388 3300037312 Bacteria 20762
139 Ga0395900_0000275 3300037418 Bacteria 78207
140 Ga0395900_0011400 3300037418 Bacteria 9098
141 Ga0395898_0001454 3300037466 Bacteria 33553
142 Ga0395898_0501630 3300037466 Bacteria 1154
143 Ga0395905_0000248 3300037471 Bacteria 81042
144 Ga0395905_0000405 3300037471 Bacteria 60956
145 Ga0395905_0261511 3300037471 Bacteria 1616
146 Ga0395901_0000145 3300038443 Bacteria 91739
147 Ga0395901_0012530 3300038443 Bacteria 8603
148 Ga0436361_0868498 3300039447 Bacteria 16180
149 Ga0466966_0033853 3300044684 Unclassified 3307
150 Ga0466961_0050229 3300044693 Bacteria 2664
151 Ga0466958_0069029 3300045836 Bacteria 2161
152 Ga0495627_089885 3300046453 Bacteria 883
153 Ga0495603_0053295 3300046455 Bacteria 2400
154 Ga0495650_0000023 3300046471 Bacteria 527763
155 Ga0495606_0000264 3300046507 Bacteria 92733
156 Ga0495606_0029396 3300046507 Bacteria 3859
157 Ga0495606_0149065 3300046507 Bacteria 1374
158 Ga0495610_0001338 3300046512 Bacteria 21856
159 Ga0495610_0003476 3300046512 Bacteria 12259
160 Ga0495616_0024753 3300046513 Bacteria 3215
161 Ga0495637_0051848 3300046520 Bacteria 1715
162 Ga0495637_0073181 3300046520 Bacteria 1379
163 Ga0495645_0171362 3300046543 Bacteria 1494
164 Ga0495633_0000804 3300046558 Bacteria 27892
165 Ga0495633_0000838 3300046558 Bacteria 27124
166 Ga0495633_0013462 3300046558 Bacteria 4310
167 Ga0495625_0000211 3300046660 Bacteria 92222
168 Ga0495625_0018979 3300046660 Bacteria 5351
169 Ga0495635_0278522 3300046663 Bacteria 1124
170 Ga0495661_0003880 3300046665 Bacteria 10932
171 Ga0495661_0011783 3300046665 Bacteria 5922
172 Ga0495649_0000090 3300046694 Bacteria 78509
173 Ga0495660_0017320 3300046810 Bacteria 4148
174 Ga0495687_002088 3300047443 Bacteria 16801
175 Ga0495673_0058952 3300047469 Bacteria 1652
176 Ga0496107_0642054 3300048910 Bacteria 783
177 Ga0501033_0296157 3300049570 Bacteria 1140
178 Ga0501034_0005043 3300049571 Bacteria 14512
179 Ga0501036_0234399 3300049572 Bacteria 1540
180 Ga0501037_0054463 3300049573 Unclassified 2925
181 Ga0501039_0034227 3300049575 Bacteria 3921
182 Ga0501043_0013961 3300049579 Bacteria 6286
183 Ga0501047_0016404 3300049581 Bacteria 7071
184 Ga0501035_0037270 3300049822 Bacteria 4404
185 Ga0501044_0018813 3300049823 Bacteria 7399
186 nmdc:mga0k408_33088_c1 3300050493 Bacteria 2955
187 Ga0495655_0108554 3300053083 Bacteria 831
188 Ga0500618_026525 3300053125 Bacteria 1383
189 Ga0500636_0006249 3300053177 Bacteria 6829

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046453 Ga0495627_089885 Ga0495627_089885_31_624 191
2 3300003322 rootL2_10060810 rootL2_100608102 202
3 3300017792 Ga0163161_10034964 Ga0163161_100349642 206
4 3300025914 Ga0207671_10007857 Ga0207671_100078578 206
5 3300026041 Ga0207639_10541216 Ga0207639_105412161 206
6 3300001990 JGI24737J22298_10000722 JGI24737J22298_100007227 207
7 3300002067 JGI24735J21928_10000009 JGI24735J21928_10000009108 207
8 3300003316 rootH1_10063162 rootH1_100631627 207
9 3300003316 rootH1_10126003 rootH1_101260032 207
10 3300003323 rootH1_10005226 rootH1_100052261 207
11 3300005563 Ga0068855_100020504 Ga0068855_1000205046 207
12 3300005563 Ga0068855_100109756 Ga0068855_1001097562 207
13 3300006195 Ga0075366_10055054 Ga0075366_100550542 207
14 3300006844 Ga0075428_100442527 Ga0075428_1004425271 207
15 3300021361 Ga0213872_10051103 Ga0213872_100511031 207
16 3300025931 Ga0207644_10031964 Ga0207644_100319642 207
17 3300025949 Ga0207667_10035131 Ga0207667_100351314 207
18 3300033180 Ga0307510_10350055 Ga0307510_103500551 207
19 3300039447 Ga0436361_0868498 Ga0436361_0868498_2796_3467 207
20 iso_pu_bacteria 2821136567 2821143263 213
21 iso_pu_bacteria 2904467357 2904470158 213
22 3300003659 JGI25404J52841_10007615 JGI25404J52841_100076152 214
23 3300005983 Ga0081540_1012916 Ga0081540_10129163 214
24 3300014326 Ga0157380_10812283 Ga0157380_108122831 214
25 3300026075 Ga0207708_10544465 Ga0207708_105444652 214
26 3300035112 Ga0373932_0149720 Ga0373932_0149720_37_696 214
27 3300046455 Ga0495603_0053295 Ga0495603_0053295_164_823 214
28 3300048910 Ga0496107_0642054 Ga0496107_0642054_70_729 214
29 3300053083 Ga0495655_0108554 Ga0495655_0108554_85_744 214
30 3300053177 Ga0500636_0006249 Ga0500636_0006249_423_1082 214
31 3300003322 rootL2_10094233 rootL2_100942332 216
32 3300005340 Ga0070689_100612632 Ga0070689_1006126321 216
33 iso_pu_bacteria 2919437846 2919441080 216
34 3300002741 JGI25157J39369_1005885 JGI25157J39369_10058852 217
35 3300003781 Ga0055536_1000010 Ga0055536_1000010100 217
36 3300003791 Ga0055530_10000816 Ga0055530_1000081618 217
37 3300005288 Ga0065714_10006464 Ga0065714_100064641 217
38 3300005288 Ga0065714_10064491 Ga0065714_1006449117 217
39 3300013100 Ga0157373_10012106 Ga0157373_100121063 217
40 3300013102 Ga0157371_10000046 Ga0157371_10000046126 217
41 3300013104 Ga0157370_10114295 Ga0157370_101142952 217
42 3300013104 Ga0157370_10192739 Ga0157370_101927392 217
43 3300013105 Ga0157369_10000046 Ga0157369_10000046116 217
44 3300013306 Ga0163162_10000125 Ga0163162_1000012550 217
45 3300013307 Ga0157372_10139144 Ga0157372_101391442 217
46 3300014497 Ga0182008_10000194 Ga0182008_1000019438 217
47 3300015261 Ga0182006_1000243 Ga0182006_100024327 217
48 3300015261 Ga0182006_1000472 Ga0182006_100047218 217
49 3300015262 Ga0182007_10000009 Ga0182007_1000000992 217
50 3300015682 Ga0183373_1008 Ga0183373_1008132 217
51 3300017792 Ga0163161_10000179 Ga0163161_1000017928 217
52 3300017792 Ga0163161_10000301 Ga0163161_100003019 217
53 3300017792 Ga0163161_10027469 Ga0163161_100274693 217
54 3300025250 Ga0209026_1000602 Ga0209026_100060224 217
55 3300025292 Ga0209676_1000009 Ga0209676_1000009775 217
56 3300025298 Ga0209050_1000103 Ga0209050_100010398 217
57 3300031731 Ga0307405_10000016 Ga0307405_10000016168 217
58 3300031903 Ga0307407_10000006 Ga0307407_1000000685 217
59 3300031995 Ga0307409_100019218 Ga0307409_1000192183 217
60 3300032002 Ga0307416_100000058 Ga0307416_1000000587 217
61 3300032004 Ga0307414_10193646 Ga0307414_101936462 217
62 3300032005 Ga0307411_10268153 Ga0307411_102681531 217
63 3300037471 Ga0395905_0261511 Ga0395905_0261511_578_1276 217
64 3300046507 Ga0495606_0149065 Ga0495606_0149065_296_967 217
65 3300046512 Ga0495610_0001338 Ga0495610_0001338_11077_11748 217
66 3300046558 Ga0495633_0013462 Ga0495633_0013462_1559_2230 217
67 3300049570 Ga0501033_0296157 Ga0501033_0296157_164_832 217
68 3300049571 Ga0501034_0005043 Ga0501034_0005043_1233_1901 217
69 3300049572 Ga0501036_0234399 Ga0501036_0234399_838_1506 217
70 3300049573 Ga0501037_0054463 Ga0501037_0054463_1020_1688 217
71 3300049575 Ga0501039_0034227 Ga0501039_0034227_249_917 217
72 3300049579 Ga0501043_0013961 Ga0501043_0013961_5265_5927 217
73 3300049581 Ga0501047_0016404 Ga0501047_0016404_1392_2060 217
74 3300049822 Ga0501035_0037270 Ga0501035_0037270_1272_1940 217
75 3300049823 Ga0501044_0018813 Ga0501044_0018813_3613_4281 217
76 iso_pu_bacteria 2585427687 2586207234 217
77 iso_pu_bacteria 2738541302 2738854115 217
78 iso_pu_bacteria 2739367651 2739587595 217
79 iso_pu_bacteria 2739367656 2739618174 217
80 iso_pu_bacteria 2739367663 2739646281 217
81 iso_pu_bacteria 2818991437 2819545502 217
82 iso_pu_bacteria 2842722452 2842724618 217
83 iso_pu_bacteria 2842909656 2842911888 217
84 iso_pu_bacteria 2849281842 2849283522 217
85 iso_pu_bacteria 2904445276 2904447994 217
86 iso_pu_bacteria 2945997725 2945998523 217
87 iso_pu_bacteria 2954016120 2954020987 217
88 3300005563 Ga0068855_100035551 Ga0068855_1000355514 218
89 3300009545 Ga0105237_10017101 Ga0105237_100171012 218
90 3300010375 Ga0105239_10861156 Ga0105239_108611562 218
91 3300013306 Ga0163162_10266363 Ga0163162_102663632 218
92 3300028786 Ga0307517_10000564 Ga0307517_1000056434 218
93 3300046660 Ga0495625_0018979 Ga0495625_0018979_1885_2622 218
94 3300046665 Ga0495661_0011783 Ga0495661_0011783_1956_2621 218
95 2162886007 SwRhRL2b_contig_1663050 SwRhRL2b_0644.00008730 219
96 3300003322 rootL2_10058701 rootL2_100587016 219
97 3300003322 rootL2_10215491 rootL2_102154914 219
98 3300003322 rootL2_10215492 rootL2_102154923 219
99 3300003323 rootH1_10003019 rootH1_100030199 219
100 3300003323 rootH1_10151007 rootH1_101510073 219
101 3300005262 Ga0065165_1002356 Ga0065165_10023565 219
102 3300005289 Ga0065704_10070140 Ga0065704_1007014058 219
103 3300005289 Ga0065704_10084614 Ga0065704_100846143 219
104 3300005335 Ga0070666_10248705 Ga0070666_102487052 219
105 3300005459 Ga0068867_100001754 Ga0068867_10000175410 219
106 3300005539 Ga0068853_100005185 Ga0068853_1000051856 219
107 3300005578 Ga0068854_100017908 Ga0068854_1000179084 219
108 3300005614 Ga0068856_100056148 Ga0068856_1000561483 219
109 3300005614 Ga0068856_100109272 Ga0068856_1001092724 219
110 3300005616 Ga0068852_100003134 Ga0068852_1000031346 219
111 3300005617 Ga0068859_100003163 Ga0068859_10000316310 219
112 3300005841 Ga0068863_100206835 Ga0068863_1002068352 219
113 3300006173 Ga0070716_100343094 Ga0070716_1003430941 219
114 3300006931 Ga0097620_100003163 Ga0097620_10000316310 219
115 3300009093 Ga0105240_10006806 Ga0105240_100068068 219
116 3300009093 Ga0105240_10015435 Ga0105240_100154354 219
117 3300009174 Ga0105241_10463558 Ga0105241_104635582 219
118 3300009545 Ga0105237_10001107 Ga0105237_1000110719 219
119 3300009545 Ga0105237_10001705 Ga0105237_1000170517 219
120 3300009545 Ga0105237_10003285 Ga0105237_1000328517 219
121 3300009545 Ga0105237_10022729 Ga0105237_100227293 219
122 3300009551 Ga0105238_10054587 Ga0105238_100545874 219
123 3300010375 Ga0105239_10000009 Ga0105239_1000000915 219
124 3300010375 Ga0105239_10005062 Ga0105239_100050628 219
125 3300010375 Ga0105239_10076415 Ga0105239_100764153 219
126 3300013102 Ga0157371_10193671 Ga0157371_101936712 219
127 3300013105 Ga0157369_10000710 Ga0157369_1000071019 219
128 3300013105 Ga0157369_10036675 Ga0157369_100366753 219
129 3300013105 Ga0157369_10170540 Ga0157369_101705402 219
130 3300013306 Ga0163162_10006294 Ga0163162_100062944 219
131 3300013307 Ga0157372_10001517 Ga0157372_1000151713 219
132 3300013307 Ga0157372_10009327 Ga0157372_100093274 219
133 3300013307 Ga0157372_11118262 Ga0157372_111182621 219
134 3300017792 Ga0163161_10005532 Ga0163161_100055323 219
135 3300025903 Ga0207680_10280224 Ga0207680_102802242 219
136 3300025911 Ga0207654_10279138 Ga0207654_102791382 219
137 3300025911 Ga0207654_10420792 Ga0207654_104207921 219
138 3300025913 Ga0207695_10022228 Ga0207695_100222283 219
139 3300025913 Ga0207695_10071004 Ga0207695_100710044 219
140 3300025914 Ga0207671_10002014 Ga0207671_100020146 219
141 3300025914 Ga0207671_10006501 Ga0207671_100065016 219
142 3300025914 Ga0207671_10041927 Ga0207671_100419273 219
143 3300025914 Ga0207671_10127605 Ga0207671_101276052 219
144 3300025924 Ga0207694_10039821 Ga0207694_100398212 219
145 3300025949 Ga0207667_10005062 Ga0207667_1000506213 219
146 3300025949 Ga0207667_10407156 Ga0207667_104071562 219
147 3300025981 Ga0207640_10020061 Ga0207640_100200612 219
148 3300026023 Ga0207677_10714462 Ga0207677_107144621 219
149 3300026041 Ga0207639_10010152 Ga0207639_100101522 219
150 3300026078 Ga0207702_10037316 Ga0207702_100373164 219
151 3300026095 Ga0207676_10181612 Ga0207676_101816122 219
152 3300026116 Ga0207674_10000487 Ga0207674_1000048741 219
153 3300026142 Ga0207698_10160497 Ga0207698_101604972 219
154 3300028381 Ga0268264_10003372 Ga0268264_1000337211 219
155 3300028558 Ga0265326_10005530 Ga0265326_100055302 219
156 3300028563 Ga0265319_1009461 Ga0265319_10094614 219
157 3300028573 Ga0265334_10046973 Ga0265334_100469732 219
158 3300028653 Ga0265323_10000107 Ga0265323_1000010733 219
159 3300028654 Ga0265322_10000843 Ga0265322_1000084310 219
160 3300028800 Ga0265338_10038544 Ga0265338_100385444 219
161 3300029957 Ga0265324_10002108 Ga0265324_100021084 219
162 3300031235 Ga0265330_10003153 Ga0265330_100031534 219
163 3300031239 Ga0265328_10012219 Ga0265328_100122192 219
164 3300031240 Ga0265320_10011142 Ga0265320_100111423 219
165 3300031242 Ga0265329_10000954 Ga0265329_100009542 219
166 3300031247 Ga0265340_10050084 Ga0265340_100500842 219
167 3300031249 Ga0265339_10005257 Ga0265339_100052573 219
168 3300031250 Ga0265331_10006829 Ga0265331_100068293 219
169 3300031344 Ga0265316_10008585 Ga0265316_100085855 219
170 3300031344 Ga0265316_10427354 Ga0265316_104273541 219
171 3300031595 Ga0265313_10108280 Ga0265313_101082802 219
172 3300031711 Ga0265314_10011023 Ga0265314_100110234 219
173 3300031712 Ga0265342_10007720 Ga0265342_100077204 219
174 3300037312 Ga0395899_0001388 Ga0395899_0001388_2177_2848 219
175 3300037418 Ga0395900_0000275 Ga0395900_0000275_4914_5585 219
176 3300037418 Ga0395900_0011400 Ga0395900_0011400_6045_6740 219
177 3300037466 Ga0395898_0001454 Ga0395898_0001454_10784_11455 219
178 3300037466 Ga0395898_0501630 Ga0395898_0501630_301_996 219
179 3300037471 Ga0395905_0000248 Ga0395905_0000248_44324_44995 219
180 3300037471 Ga0395905_0000405 Ga0395905_0000405_48749_49444 219
181 3300038443 Ga0395901_0000145 Ga0395901_0000145_76081_76752 219
182 3300038443 Ga0395901_0012530 Ga0395901_0012530_7004_7699 219
183 3300044684 Ga0466966_0033853 Ga0466966_0033853_670_1362 219
184 3300044693 Ga0466961_0050229 Ga0466961_0050229_336_1028 219
185 3300045836 Ga0466958_0069029 Ga0466958_0069029_968_1660 219
186 3300046471 Ga0495650_0000023 Ga0495650_0000023_141616_142290 219
187 3300046507 Ga0495606_0000264 Ga0495606_0000264_68485_69159 219
188 3300046507 Ga0495606_0029396 Ga0495606_0029396_1794_2468 219
189 3300046512 Ga0495610_0003476 Ga0495610_0003476_5450_6124 219
190 3300046513 Ga0495616_0024753 Ga0495616_0024753_146_820 219
191 3300046520 Ga0495637_0051848 Ga0495637_0051848_151_825 219
192 3300046520 Ga0495637_0073181 Ga0495637_0073181_94_768 219
193 3300046543 Ga0495645_0171362 Ga0495645_0171362_791_1471 219
194 3300046558 Ga0495633_0000804 Ga0495633_0000804_6340_7014 219
195 3300046558 Ga0495633_0000838 Ga0495633_0000838_1076_1756 219
196 3300046660 Ga0495625_0000211 Ga0495625_0000211_23902_24576 219
197 3300046663 Ga0495635_0278522 Ga0495635_0278522_15_686 219
198 3300046665 Ga0495661_0003880 Ga0495661_0003880_360_1034 219
199 3300046694 Ga0495649_0000090 Ga0495649_0000090_24164_24838 219
200 3300046810 Ga0495660_0017320 Ga0495660_0017320_243_917 219
201 3300047443 Ga0495687_002088 Ga0495687_002088_7074_7748 219
202 3300047469 Ga0495673_0058952 Ga0495673_0058952_785_1459 219
203 3300050493 nmdc:mga0k408_33088_c1 nmdc:mga0k408_33088_c1_1615_2289 219
204 3300053125 Ga0500618_026525 Ga0500618_026525_68_742 219
205 iso_pu_bacteria 2522125168 2522551080 219
206 iso_pu_bacteria 2599185184 2599479260 219
207 iso_pu_bacteria 2932082852 2932087517 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

41

162

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fmu-assembly1.cif.gz_A crystal structure of a tat-interacting protein homologue (htatip2, aw111545, cc3, tip30) from mus musculus at 2.30 a resolution 0.8395 3 219
2bka-assembly1.cif.gz_A-2 cc3(tip30)crystal structure 0.8029 3 217
2gvc-assembly1.cif.gz_B crystal structure of flavin-containing monooxygenase (fmo)from s.pombe and substrate (methimazole) complex 0.7951 2 37
2bka-assembly1.cif.gz_A-2 cc3(tip30)crystal structure 0.7863 3 217
6o9n-assembly2.cif.gz_B structural insights on a new fungal aryl-alcohol oxidase 0.786 2 35
ID Description Score Start End Superfamily
af_Q54WF5_27_272_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9585 2 219 3.40.50.720
af_Q54WF5_27_272_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.95 2 219 3.40.50.720
2fmuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8395 3 219 3.40.50.720
af_Q5AP65_1_228_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8098 3 218 3.40.50.720
af_P40008_1_228_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8067 3 218 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6N4QXC0-F1-model_v4 Epimerase 0.9885 1 219
AF-A0A519SIT4-F1-model_v4 Epimerase 0.9881 1 218
AF-A0A6N7BEA7-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9879 1 217
AF-A0A520HM22-F1-model_v4 Epimerase 0.9854 2 197
AF-A0A6N4QXC0-F1-model_v4 Epimerase 0.984 1 219

Feature Viewer

pLDDT pTM Quality
93.12 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map