F316313

General Info

Members Datasets Scaffolds Average Seq Length
207 148 414 257

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100574429|Ga0075428_1005744292
Length 278
Sequence MEARLAAAEDGCICGQAPKICVMLKAWLAHPLTRGLEIDDPRTTHLRNQIIQEKRFLRQIYQEWYEAISTVLPSGEGSVLELGAGAGFMKDFIPGLITSEVFFCPNSRAVLDASHLPFVARSLRGIVMTDVLHHLPRPRQFFAEATRCIRPGGVIAMVEPWVTPWSKFVYRRLHHEPFQPETLWWELPNTGPLSGANGALPWIIFARDRLKFEEEFPQWRIELIKSIMPFCYLLSGGVSLRGLAPGWSFEFWRQIENAFDRWSNQLGMFAQIVLRRLD

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
133 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
134 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
135 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
136 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.93
Nodule 0
Rhizoplane 0.48
Rhizosphere 94.69
Stem 0
Stem Tuber 0
Unclassified 21.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100574429 3300006844 Bacteria 1205
2 Ga0065712_10082457 3300005290 Unclassified 2905
3 Ga0070658_10286087 3300005327 Bacteria 1404
4 Ga0070676_10082501 3300005328 Bacteria 1953
5 Ga0070670_100018169 3300005331 Bacteria 6033
6 Ga0070670_100663933 3300005331 Bacteria 936
7 Ga0068869_100288666 3300005334 Bacteria 1321
8 Ga0068868_100068753 3300005338 Bacteria 2821
9 Ga0068868_100610887 3300005338 Unclassified 967
10 Ga0070689_100064968 3300005340 Bacteria 2841
11 Ga0070669_100015593 3300005353 Bacteria 5418
12 Ga0070714_100645907 3300005435 Unclassified 1018
13 Ga0070713_100000255 3300005436 Bacteria 35004
14 Ga0070713_100153863 3300005436 Unclassified 2048
15 Ga0070711_100005944 3300005439 Bacteria 7326
16 Ga0070681_10008197 3300005458 Bacteria 10225
17 Ga0070685_10012545 3300005466 Bacteria 4455
18 Ga0070707_100111652 3300005468 Unclassified 2651
19 Ga0070684_100279346 3300005535 Bacteria 1530
20 Ga0070686_100203933 3300005544 Unclassified 1419
21 Ga0070696_100040814 3300005546 Bacteria 3205
22 Ga0070693_100064532 3300005547 Bacteria 2138
23 Ga0070665_100000292 3300005548 Bacteria 79257
24 Ga0070664_100293772 3300005564 Bacteria 1467
25 Ga0068864_100090236 3300005618 Bacteria 2701
26 Ga0068863_100352745 3300005841 Bacteria 1433
27 Ga0068862_100298493 3300005844 Bacteria 1481
28 Ga0070716_100210818 3300006173 Unclassified 1298
29 Ga0070712_100191877 3300006175 Bacteria 1599
30 Ga0075367_10037257 3300006178 Bacteria 2825
31 Ga0075428_100025160 3300006844 Bacteria 6586
32 Ga0075428_100287829 3300006844 Bacteria 1768
33 Ga0075431_100016594 3300006847 Bacteria 7474
34 Ga0075431_100043039 3300006847 Bacteria 4659
35 Ga0075431_100140254 3300006847 Bacteria 2491
36 Ga0075431_100330567 3300006847 Bacteria 1535
37 Ga0075433_10021655 3300006852 Bacteria 5393
38 Ga0075433_10039382 3300006852 Bacteria 4086
39 Ga0075433_10051788 3300006852 Bacteria 3576
40 Ga0075434_100008226 3300006871 Bacteria 9681
41 Ga0075434_100018236 3300006871 Bacteria 6778
42 Ga0075429_100019672 3300006880 Bacteria 5853
43 Ga0075429_100058357 3300006880 Bacteria 3360
44 Ga0068865_100041249 3300006881 Bacteria 3139
45 Ga0075436_100062269 3300006914 Bacteria 2578
46 Ga0075435_100093072 3300007076 Bacteria 2490
47 Ga0105240_10071149 3300009093 Bacteria 4302
48 Ga0105240_10369174 3300009093 Unclassified 1623
49 Ga0111539_10518128 3300009094 Bacteria 1389
50 Ga0111539_10643342 3300009094 Bacteria 1235
51 Ga0114129_10008937 3300009147 Bacteria 14275
52 Ga0114129_10035971 3300009147 Bacteria 6993
53 Ga0114129_10161451 3300009147 Bacteria 3061
54 Ga0114129_10226142 3300009147 Bacteria 2522
55 Ga0114129_10250591 3300009147 Bacteria 2377
56 Ga0114129_10430480 3300009147 Bacteria 1734
57 Ga0114129_10921229 3300009147 Unclassified 1106
58 Ga0105242_10267381 3300009176 Unclassified 1547
59 Ga0105248_10208958 3300009177 Unclassified 2199
60 Ga0105248_10360278 3300009177 Unclassified 1637
61 Ga0105237_10024757 3300009545 Bacteria 6140
62 Ga0105238_10633486 3300009551 Bacteria 1079
63 Ga0105249_10798594 3300009553 Unclassified 1008
64 Ga0105239_10215845 3300010375 Bacteria 2151
65 Ga0157370_10056228 3300013104 Bacteria 3745
66 Ga0157370_10315047 3300013104 Unclassified 1443
67 Ga0157369_10223284 3300013105 Bacteria 1971
68 Ga0157369_10893860 3300013105 Bacteria 911
69 Ga0157374_10017484 3300013296 Bacteria 6315
70 Ga0157378_10433464 3300013297 Unclassified 1301
71 Ga0163162_10035325 3300013306 Bacteria 4978
72 Ga0163162_10068781 3300013306 Bacteria 3593
73 Ga0163162_11002446 3300013306 Bacteria 944
74 Ga0163163_10105939 3300014325 Bacteria 2837
75 Ga0163163_10550622 3300014325 Bacteria 1216
76 Ga0157380_10911791 3300014326 Bacteria 906
77 Ga0157376_10143358 3300014969 Bacteria 2146
78 Ga0207680_10153348 3300025903 Bacteria 1538
79 Ga0207645_10065296 3300025907 Bacteria 2325
80 Ga0207705_10023220 3300025909 Bacteria 4425
81 Ga0207654_10038569 3300025911 Unclassified 2681
82 Ga0207707_10011736 3300025912 Bacteria 7624
83 Ga0207695_10049282 3300025913 Bacteria 4442
84 Ga0207693_10230740 3300025915 Bacteria 1454
85 Ga0207663_10011180 3300025916 Bacteria 4810
86 Ga0207646_10005160 3300025922 Bacteria 13831
87 Ga0207650_10264513 3300025925 Viruses 1396
88 Ga0207700_10002735 3300025928 Bacteria 10161
89 Ga0207664_10001604 3300025929 Bacteria 14869
90 Ga0207664_10291527 3300025929 Unclassified 1434
91 Ga0207665_10038259 3300025939 Bacteria 3193
92 Ga0207665_10063174 3300025939 Unclassified 2514
93 Ga0207689_10032542 3300025942 Bacteria 4337
94 Ga0207679_10217252 3300025945 Bacteria 1607
95 Ga0207668_10074223 3300025972 Bacteria 2441
96 Ga0207703_10600119 3300026035 Unclassified 1041
97 Ga0207639_10343250 3300026041 Unclassified 1332
98 Ga0207708_10547543 3300026075 Unclassified 975
99 Ga0207676_10094227 3300026095 Bacteria 2467
100 Ga0207428_10166289 3300027907 Bacteria 1672
101 Ga0268266_10005938 3300028379 Bacteria 11290
102 Ga0268265_10395985 3300028380 Unclassified 1275
103 Ga0268264_10015042 3300028381 Bacteria 6347
104 Ga0268264_10767004 3300028381 Bacteria 962
105 Ga0265319_1001551 3300028563 Bacteria 13561
106 Ga0265334_10030146 3300028573 Bacteria 2172
107 Ga0265318_10000261 3300028577 Bacteria 45628
108 Ga0265323_10053387 3300028653 Unclassified 1427
109 Ga0265324_10066455 3300029957 Bacteria 1230
110 Ga0265320_10000248 3300031240 Bacteria 44349
111 Ga0265329_10000124 3300031242 Bacteria 36843
112 Ga0265340_10000641 3300031247 Bacteria 19611
113 Ga0265331_10000323 3300031250 Bacteria 51707
114 Ga0265327_10001763 3300031251 Bacteria 25592
115 Ga0265316_10000016 3300031344 Bacteria 198693
116 Ga0265316_10009956 3300031344 Bacteria 8707
117 Ga0265313_10002873 3300031595 Bacteria 14437
118 Ga0316575_10043574 3300031665 Bacteria 1779
119 Ga0265342_10000300 3300031712 Bacteria 56198
120 Ga0307405_10056916 3300031731 Unclassified 2454
121 Ga0307413_10035816 3300031824 Unclassified 2851
122 Ga0307412_10031928 3300031911 Unclassified 3331
123 Ga0307416_100002903 3300032002 Bacteria 9990
124 Ga0373936_0059593 3300035113 Bacteria 1556
125 Ga0373954_0030488 3300035118 Unclassified 2487
126 Ga0373943_0003043 3300035170 Bacteria 7617
127 Ga0373947_0055160 3300035725 Bacteria 2399
128 Ga0316582_0003603 3300036647 Bacteria 7636
129 Ga0373925_0021051 3300037068 Bacteria 4752
130 Ga0395899_0033377 3300037312 Bacteria 3865
131 Ga0395900_0001881 3300037418 Bacteria 23875
132 Ga0395898_0003267 3300037466 Bacteria 18217
133 Ga0436364_0004458 3300037853 Bacteria 1089
134 Ga0436364_0148933 3300037853 Bacteria 1014
135 Ga0436364_0404404 3300037853 Bacteria 9120
136 Ga0436364_1177963 3300037853 Unclassified 3913
137 Ga0395901_0028489 3300038443 Bacteria 5743
138 Ga0400489_19491 3300039093 Bacteria 3199
139 Ga0436363_0518233 3300039450 Unclassified 1563
140 Ga0451797_0214115 3300041453 Bacteria 1166
141 Ga0451577_0000692 3300042876 Bacteria 52860
142 Ga0451577_0245550 3300042876 Bacteria 1620
143 Ga0453684_0000076 3300044712 Bacteria 437513
144 Ga0453684_0000329 3300044712 Bacteria 198284
145 Ga0453684_0001708 3300044712 Bacteria 59116
146 Ga0453684_0010324 3300044712 Bacteria 15988
147 Ga0453684_0051863 3300044712 Bacteria 5371
148 Ga0453684_0073760 3300044712 Bacteria 4300
149 Ga0453684_0210284 3300044712 Unclassified 2262
150 Ga0451576_0006334 3300045051 Bacteria 14542
151 Ga0451576_0018388 3300045051 Bacteria 7663
152 Ga0466967_0861010 3300045976 Bacteria 901
153 Ga0495592_0094974 3300046454 Bacteria 2133
154 Ga0495651_0047230 3300046462 Bacteria 3330
155 Ga0495662_0029950 3300046476 Bacteria 2627
156 Ga0495662_0045291 3300046476 Bacteria 2124
157 Ga0495664_0000334 3300046477 Bacteria 22728
158 Ga0495608_0066176 3300046511 Unclassified 2366
159 Ga0495628_0028267 3300046516 Bacteria 4557
160 Ga0495630_0096692 3300046517 Unclassified 2232
161 Ga0495665_0153519 3300046531 Unclassified 1201
162 Ga0495640_0030261 3300046533 Bacteria 3878
163 Ga0495640_0055891 3300046533 Bacteria 2699
164 Ga0495640_0200282 3300046533 Bacteria 1266
165 Ga0495587_0181491 3300046536 Unclassified 1193
166 Ga0495645_0111746 3300046543 Unclassified 1932
167 Ga0495634_0017768 3300046642 Bacteria 5071
168 Ga0495635_0011524 3300046663 Bacteria 6198
169 Ga0495599_0005161 3300046678 Bacteria 7783
170 Ga0495600_0032152 3300046809 Unclassified 3403
171 Ga0495604_0024786 3300047317 Unclassified 4786
172 Ga0495674_0051987 3300047319 Bacteria 3609
173 Ga0495674_0154202 3300047319 Bacteria 1925
174 Ga0495680_0091907 3300047322 Unclassified 2274
175 Ga0495684_0026864 3300047471 Bacteria 4422
176 Ga0495684_0323933 3300047471 Bacteria 1101
177 Ga0495602_0336632 3300048088 Unclassified 1093
178 Ga0501296_009521 3300049519 Bacteria 1139
179 Ga0501216_008545 3300049660 Bacteria 1615
180 Ga0501235_018936 3300049669 Bacteria 1527
181 Ga0501225_0012299 3300049705 Bacteria 2404
182 Ga0501083_0001520 3300049744 Bacteria 15846
183 nmdc:mga00v17_40989_c1 3300050491 Bacteria 2779
184 nmdc:mga06z11_19909_c1 3300050494 Bacteria 3094
185 nmdc:mga05p37_114962_c1 3300050507 Bacteria 3308
186 nmdc:mga05p37_141081_c1 3300050507 Bacteria 2953
187 nmdc:mga05p37_179775_c1 3300050507 Unclassified 2574
188 nmdc:mga05p37_186510_c1 3300050507 Bacteria 2521
189 nmdc:mga05p37_21633_c1 3300050507 Bacteria 7793
190 nmdc:mga05p37_420164_c1 3300050507 Bacteria 1556
191 nmdc:mga05p37_82127_c1 3300050507 Bacteria 3970
192 nmdc:mga09592_372990_c1 3300050508 Bacteria 1234
193 nmdc:mga09592_6531_c1 3300050508 Bacteria 9498
194 nmdc:mga09592_689944_c1 3300050508 Unclassified 870
195 nmdc:mga09592_70040_c1 3300050508 Bacteria 2975
196 nmdc:mga06r32_123679_c1 3300050510 Unclassified 2553
197 nmdc:mga06r32_37291_c1 3300050510 Bacteria 4599
198 nmdc:mga08y16_7765_c1 3300050511 Bacteria 11240
199 nmdc:mga0n895_20312_c1 3300050512 Bacteria 6192
200 nmdc:mga0n895_45264_c1 3300050512 Bacteria 4294
201 nmdc:mga0rr50_174040_c1 3300050513 Unclassified 1756
202 nmdc:mga0rr50_86653_c1 3300050513 Bacteria 2430
203 nmdc:mga08x19_68899_c1 3300050514 Bacteria 2303
204 nmdc:mga0a205_15737_c1 3300050515 Bacteria 7070
205 nmdc:mga0a205_37386_c1 3300050515 Bacteria 4669
206 Ga0495601_0034841 3300053077 Unclassified 3141
207 Ga0500568_0003408 3300053139 Bacteria 8875
208 Ga0075428_100574429
209 Ga0065712_10082457
210 Ga0070658_10286087
211 Ga0070676_10082501
212 Ga0070670_100018169
213 Ga0070670_100663933
214 Ga0068869_100288666
215 Ga0068868_100068753
216 Ga0068868_100610887
217 Ga0070689_100064968
218 Ga0070669_100015593
219 Ga0070714_100645907
220 Ga0070713_100000255
221 Ga0070713_100153863
222 Ga0070711_100005944
223 Ga0070681_10008197
224 Ga0070685_10012545
225 Ga0070707_100111652
226 Ga0070684_100279346
227 Ga0070686_100203933
228 Ga0070696_100040814
229 Ga0070693_100064532
230 Ga0070665_100000292
231 Ga0070664_100293772
232 Ga0068864_100090236
233 Ga0068863_100352745
234 Ga0068862_100298493
235 Ga0070716_100210818
236 Ga0070712_100191877
237 Ga0075367_10037257
238 Ga0075428_100025160
239 Ga0075428_100287829
240 Ga0075431_100016594
241 Ga0075431_100043039
242 Ga0075431_100140254
243 Ga0075431_100330567
244 Ga0075433_10021655
245 Ga0075433_10039382
246 Ga0075433_10051788
247 Ga0075434_100008226
248 Ga0075434_100018236
249 Ga0075429_100019672
250 Ga0075429_100058357
251 Ga0068865_100041249
252 Ga0075436_100062269
253 Ga0075435_100093072
254 Ga0105240_10071149
255 Ga0105240_10369174
256 Ga0111539_10518128
257 Ga0111539_10643342
258 Ga0114129_10008937
259 Ga0114129_10035971
260 Ga0114129_10161451
261 Ga0114129_10226142
262 Ga0114129_10250591
263 Ga0114129_10430480
264 Ga0114129_10921229
265 Ga0105242_10267381
266 Ga0105248_10208958
267 Ga0105248_10360278
268 Ga0105237_10024757
269 Ga0105238_10633486
270 Ga0105249_10798594
271 Ga0105239_10215845
272 Ga0157370_10056228
273 Ga0157370_10315047
274 Ga0157369_10223284
275 Ga0157369_10893860
276 Ga0157374_10017484
277 Ga0157378_10433464
278 Ga0163162_10035325
279 Ga0163162_10068781
280 Ga0163162_11002446
281 Ga0163163_10105939
282 Ga0163163_10550622
283 Ga0157380_10911791
284 Ga0157376_10143358
285 Ga0207680_10153348
286 Ga0207645_10065296
287 Ga0207705_10023220
288 Ga0207654_10038569
289 Ga0207707_10011736
290 Ga0207695_10049282
291 Ga0207693_10230740
292 Ga0207663_10011180
293 Ga0207646_10005160
294 Ga0207650_10264513
295 Ga0207700_10002735
296 Ga0207664_10001604
297 Ga0207664_10291527
298 Ga0207665_10038259
299 Ga0207665_10063174
300 Ga0207689_10032542
301 Ga0207679_10217252
302 Ga0207668_10074223
303 Ga0207703_10600119
304 Ga0207639_10343250
305 Ga0207708_10547543
306 Ga0207676_10094227
307 Ga0207428_10166289
308 Ga0268266_10005938
309 Ga0268265_10395985
310 Ga0268264_10015042
311 Ga0268264_10767004
312 Ga0265319_1001551
313 Ga0265334_10030146
314 Ga0265318_10000261
315 Ga0265323_10053387
316 Ga0265324_10066455
317 Ga0265320_10000248
318 Ga0265329_10000124
319 Ga0265340_10000641
320 Ga0265331_10000323
321 Ga0265327_10001763
322 Ga0265316_10000016
323 Ga0265316_10009956
324 Ga0265313_10002873
325 Ga0316575_10043574
326 Ga0265342_10000300
327 Ga0307405_10056916
328 Ga0307413_10035816
329 Ga0307412_10031928
330 Ga0307416_100002903
331 Ga0373936_0059593
332 Ga0373954_0030488
333 Ga0373943_0003043
334 Ga0373947_0055160
335 Ga0316582_0003603
336 Ga0373925_0021051
337 Ga0395899_0033377
338 Ga0395900_0001881
339 Ga0395898_0003267
340 Ga0436364_0004458
341 Ga0436364_0148933
342 Ga0436364_0404404
343 Ga0436364_1177963
344 Ga0395901_0028489
345 Ga0400489_19491
346 Ga0436363_0518233
347 Ga0451797_0214115
348 Ga0451577_0000692
349 Ga0451577_0245550
350 Ga0453684_0000076
351 Ga0453684_0000329
352 Ga0453684_0001708
353 Ga0453684_0010324
354 Ga0453684_0051863
355 Ga0453684_0073760
356 Ga0453684_0210284
357 Ga0451576_0006334
358 Ga0451576_0018388
359 Ga0466967_0861010
360 Ga0495592_0094974
361 Ga0495651_0047230
362 Ga0495662_0029950
363 Ga0495662_0045291
364 Ga0495664_0000334
365 Ga0495608_0066176
366 Ga0495628_0028267
367 Ga0495630_0096692
368 Ga0495665_0153519
369 Ga0495640_0030261
370 Ga0495640_0055891
371 Ga0495640_0200282
372 Ga0495587_0181491
373 Ga0495645_0111746
374 Ga0495634_0017768
375 Ga0495635_0011524
376 Ga0495599_0005161
377 Ga0495600_0032152
378 Ga0495604_0024786
379 Ga0495674_0051987
380 Ga0495674_0154202
381 Ga0495680_0091907
382 Ga0495684_0026864
383 Ga0495684_0323933
384 Ga0495602_0336632
385 Ga0501296_009521
386 Ga0501216_008545
387 Ga0501235_018936
388 Ga0501225_0012299
389 Ga0501083_0001520
390 nmdc:mga00v17_40989_c1
391 nmdc:mga06z11_19909_c1
392 nmdc:mga05p37_114962_c1
393 nmdc:mga05p37_141081_c1
394 nmdc:mga05p37_179775_c1
395 nmdc:mga05p37_186510_c1
396 nmdc:mga05p37_21633_c1
397 nmdc:mga05p37_420164_c1
398 nmdc:mga05p37_82127_c1
399 nmdc:mga09592_372990_c1
400 nmdc:mga09592_6531_c1
401 nmdc:mga09592_689944_c1
402 nmdc:mga09592_70040_c1
403 nmdc:mga06r32_123679_c1
404 nmdc:mga06r32_37291_c1
405 nmdc:mga08y16_7765_c1
406 nmdc:mga0n895_20312_c1
407 nmdc:mga0n895_45264_c1
408 nmdc:mga0rr50_174040_c1
409 nmdc:mga0rr50_86653_c1
410 nmdc:mga08x19_68899_c1
411 nmdc:mga0a205_15737_c1
412 nmdc:mga0a205_37386_c1
413 Ga0495601_0034841
414 Ga0500568_0003408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

80

157

0.94

PF13489

Methyltransf_23

Methyltransferase domain

52

226

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8s9o-assembly1.cif.gz_A dna cytosine-n4 methyltransferase (residues 61-324) from the bdelloid rotifer adineta vaga - p1 crystal form 0.7554 99 138
3dlc-assembly1.cif.gz_A crystal structure of a putative s-adenosyl-l-methionine-dependent methyltransferase (mmp1179) from methanococcus maripaludis at 1.15 a resolution 0.7495 14 137
1ve3-assembly2.cif.gz_B-2 crystal structure of ph0226 protein from pyrococcus horikoshii ot3 0.7424 37 138
4qtt-assembly2.cif.gz_D structure of s. cerevisiae bud23-trm112 complex involved in formation of m7g1575 on 18s rrna (apo-form) 0.7269 37 138
4yv1-assembly2.cif.gz_D crystal structure of trypanosoma cruzi spermidine synthase in complex with quinolin-8-yl piperidine-1-carboxylate 0.7169 41 140
ID Description Score Start End Superfamily
af_P75672_56_184_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8798 73 133 3.40.50.150
af_Q54LN8_1_115_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8396 91 141 3.40.50.150
af_A0A1D6K4H3_75_167_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8349 96 140 3.40.50.150
af_A0A1D6ET91_93_186_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8308 55 135 3.40.50.150
af_Q8I2Q6_244_413_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8002 42 140 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V8MTI9-F1-model_v4 Methyltransferase type 11 0.995 2 257 GO:0008757
GO:0032259
AF-A0A521G1Q1-F1-model_v4 Methyltransferase domain-containing protein 0.9929 7 257 GO:0008757
GO:0032259
AF-A0A3A4RYX5-F1-model_v4 Class I SAM-dependent methyltransferase 0.991 2 256 GO:0008757
GO:0032259
AF-A0A7X7X810-F1-model_v4 Class I SAM-dependent methyltransferase 0.9908 2 256 GO:0008757
GO:0032259
AF-A0A7X9EXH8-F1-model_v4 Methyltransferase domain-containing protein 0.9877 6 257 GO:0008168
GO:0032259

Map