F316226

General Info

Members Datasets Scaffolds Average Seq Length
207 148 182 113

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100127206|Ga0068854_1001272064
Length 125
Sequence MMTVNPQMSQAENLVNRIPNDIGGLEAGPVQITEHELLPWEKRCHALADVLDFHKIINTEEKRRGVEALGAEMVNTLTYYERWAVAFSNICFQKGILVPSQLAEKMDEVQRRWRAEAEKADKAGL

Samples

Sample ID Description Type Environment
1 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
2 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
3 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
4 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
5 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
6 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
7 2643221599 Rhizobium sp. Root708 Isolate Unclassified
8 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
9 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
10 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
11 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
12 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
13 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
14 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
15 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
16 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
17 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
18 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
19 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
20 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
21 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
22 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
89 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
104 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
105 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
106 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
107 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
108 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
109 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
128 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
131 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
142 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
143 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
144 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
145 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
146 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
147 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
148 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.92
Metatranscriptomes 0
Isolates 12.08

Biome Distribution

Category Percentage (%)
Aerial Root 1.45
Bulb 0
Endosphere 17.87
Nodule 3.86
Rhizoplane 2.9
Rhizosphere 44.44
Stem 0
Stem Tuber 0
Unclassified 29.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000968 3300002773 Bacteria 13991
2 JGI25151J46595_10001183 3300003187 Bacteria 18783
3 rootH1_10170941 3300003323 Bacteria 6625
4 Ga0055525_1000388 3300003759 Bacteria 28210
5 Ga0055542_1000060 3300003762 Bacteria 162275
6 Ga0055529_1000043 3300003763 Bacteria 221704
7 Ga0055529_1044736 3300003763 Unclassified 533
8 Ga0055526_1000046 3300003771 Bacteria 120614
9 Ga0055524_1002269 3300003775 Bacteria 10052
10 Ga0055530_10025524 3300003791 Bacteria 1648
11 Ga0055531_10011550 3300003794 Bacteria 4240
12 Ga0065165_1041075 3300005262 Bacteria 1375
13 Ga0070691_10518830 3300005341 Bacteria 691
14 Ga0070681_10118097 3300005458 Bacteria 2589
15 Ga0070707_100186844 3300005468 Bacteria 2020
16 Ga0070698_101345872 3300005471 Bacteria 664
17 Ga0070697_100036587 3300005536 Bacteria 3965
18 Ga0070696_100790854 3300005546 Bacteria 780
19 Ga0068857_100057398 3300005577 Bacteria 3455
20 Ga0068854_100032215 3300005578 Bacteria 3645
21 Ga0068854_100067148 3300005578 Bacteria 2612
22 Ga0068854_100127206 3300005578 Bacteria 1942
23 Ga0068863_100080919 3300005841 Bacteria 3077
24 Ga0068862_100906915 3300005844 Bacteria 867
25 Ga0105251_10315502 3300009011 Bacteria 710
26 Ga0105240_11079493 3300009093 Bacteria 855
27 Ga0105247_10051392 3300009101 Bacteria 2538
28 Ga0105243_11147620 3300009148 Bacteria 788
29 Ga0105248_10676318 3300009177 Bacteria 1164
30 Ga0105237_10000038 3300009545 Bacteria 190707
31 Ga0105237_10002242 3300009545 Bacteria 24086
32 Ga0105237_10005155 3300009545 Bacteria 14787
33 Ga0123342_1004047 3300009766 Bacteria 22851
34 Ga0105239_10000108 3300010375 Bacteria 116364
35 Ga0105239_10871834 3300010375 Bacteria 1033
36 Ga0105246_12596776 3300011119 Bacteria 500
37 Ga0157370_10344755 3300013104 Bacteria 1373
38 Ga0157369_10097084 3300013105 Unclassified 3143
39 Ga0163162_10741068 3300013306 Bacteria 1102
40 Ga0163162_12905215 3300013306 Bacteria 551
41 Ga0157375_11873068 3300013308 Bacteria 712
42 Ga0163163_10092163 3300014325 Bacteria 3045
43 Ga0182008_10041775 3300014497 Bacteria 2287
44 Ga0182008_10684353 3300014497 Bacteria 584
45 Ga0182007_10016959 3300015262 Bacteria 2672
46 Ga0213872_10082441 3300021361 Bacteria 1444
47 Ga0213871_10018263 3300021441 Bacteria 1714
48 Ga0209563_100106 3300025230 Bacteria 146256
49 Ga0207425_1035172 3300025245 Bacteria 979
50 Ga0209148_1000017 3300025254 Bacteria 787064
51 Ga0209129_1000016 3300025258 Bacteria 485491
52 Ga0209455_1000005 3300025272 Bacteria 1416756
53 Ga0209455_1007438 3300025272 Bacteria 3089
54 Ga0209673_1012196 3300025273 Bacteria 3482
55 Ga0209130_1055119 3300025284 Bacteria 708
56 Ga0209025_1000126 3300025294 Bacteria 200866
57 Ga0209025_1001131 3300025294 Bacteria 38214
58 Ga0209025_1065340 3300025294 Bacteria 1329
59 Ga0209564_1000277 3300025295 Bacteria 105818
60 Ga0209758_1020421 3300025297 Bacteria 3134
61 Ga0209758_1048968 3300025297 Bacteria 1496
62 Ga0209050_1000090 3300025298 Bacteria 253783
63 Ga0209050_1000638 3300025298 Bacteria 54267
64 Ga0209256_1000176 3300025299 Bacteria 126545
65 Ga0209256_1016283 3300025299 Bacteria 2544
66 Ga0207426_1013623 3300025302 Bacteria 3006
67 Ga0209051_1023488 3300025303 Bacteria 2561
68 Ga0209257_1000059 3300025304 Bacteria 378097
69 Ga0207710_10081841 3300025900 Bacteria 1499
70 Ga0207688_10411824 3300025901 Bacteria 839
71 Ga0207707_10245046 3300025912 Bacteria 1557
72 Ga0207671_10000045 3300025914 Bacteria 201245
73 Ga0207671_10002514 3300025914 Bacteria 19571
74 Ga0207671_10002588 3300025914 Bacteria 19121
75 Ga0207646_11037958 3300025922 Bacteria 723
76 Ga0207709_11728058 3300025935 Bacteria 520
77 Ga0207670_10157083 3300025936 Bacteria 1694
78 Ga0207640_10012155 3300025981 Bacteria 4896
79 Ga0207640_10031831 3300025981 Bacteria 3265
80 Ga0207640_10053247 3300025981 Bacteria 2641
81 Ga0207658_10084153 3300025986 Bacteria 2447
82 Ga0207708_11542394 3300026075 Bacteria 584
83 Ga0207674_10071323 3300026116 Bacteria 3491
84 Ga0265338_10000053 3300028800 Bacteria 208184
85 Ga0265338_10000160 3300028800 Bacteria 122713
86 Ga0265338_10092880 3300028800 Bacteria 2488
87 Ga0265324_10000163 3300029957 Bacteria 51372
88 Ga0316181_1229929 3300030744 Bacteria 1653
89 Ga0265339_10012521 3300031249 Bacteria 5176
90 Ga0265327_10034727 3300031251 Bacteria 2795
91 Ga0307405_10056560 3300031731 Bacteria 2461
92 Ga0307413_10181839 3300031824 Bacteria 1500
93 Ga0307413_10524411 3300031824 Bacteria 956
94 Ga0307406_10423184 3300031901 Bacteria 1062
95 Ga0307406_10586318 3300031901 Bacteria 917
96 Ga0307412_10001050 3300031911 Bacteria 15767
97 Ga0307412_10003966 3300031911 Bacteria 8249
98 Ga0307412_10991944 3300031911 Bacteria 742
99 Ga0307414_10137455 3300032004 Bacteria 1908
100 Ga0373935_0964582 3300035692 Bacteria 633
101 Ga0373937_0349404 3300036401 Bacteria 1401
102 Ga0436364_1012016 3300037853 Bacteria 3888
103 Ga0436365_0983772 3300039437 Bacteria 1407
104 Ga0436365_1413581 3300039437 Bacteria 1592
105 Ga0436360_0222245 3300039438 Bacteria 5330
106 Ga0436361_0868092 3300039447 Bacteria 1836
107 Ga0436362_0771886 3300039453 Bacteria 2366
108 Ga0436362_1115905 3300039453 Bacteria 1012
109 Ga0451833_0021712 3300041491 Bacteria 1145
110 Ga0451833_0569161 3300041491 Bacteria 1181
111 Ga0451835_1264588 3300041492 Bacteria 1178
112 Ga0451841_0772175 3300041498 Bacteria 2569
113 Ga0451845_0694386 3300041501 Bacteria 2649
114 Ga0451849_1433882 3300041505 Bacteria 852
115 Ga0451851_0456935 3300041507 Bacteria 632
116 Ga0451853_3508755 3300041512 Bacteria 4134
117 Ga0439451_040624 3300042009 Bacteria 934
118 Ga0495638_0275626 3300046460 Bacteria 916
119 Ga0495630_1505822 3300046517 Bacteria 505
120 Ga0495632_0006688 3300046519 Bacteria 7370
121 Ga0495632_0174305 3300046519 Bacteria 987
122 Ga0495597_0263040 3300046542 Bacteria 675
123 Ga0495625_0592326 3300046660 Bacteria 667
124 Ga0495658_0409920 3300046683 Bacteria 864
125 Ga0495686_0016627 3300047472 Bacteria 4983
126 Ga0496100_0023782 3300048903 Bacteria 3728
127 Ga0496102_0237578 3300048905 Bacteria 1718
128 Ga0496102_1287057 3300048905 Bacteria 650
129 Ga0496108_0206689 3300048911 Bacteria 1704
130 Ga0496112_0074877 3300048915 Bacteria 3348
131 Ga0496115_0123314 3300048918 Bacteria 2133
132 Ga0496116_0028271 3300048919 Bacteria 4065
133 Ga0496117_0028290 3300048920 Bacteria 4344
134 Ga0496117_0028452 3300048920 Bacteria 4327
135 Ga0496117_0078347 3300048920 Bacteria 2182
136 Ga0496118_0027838 3300048921 Bacteria 4774
137 Ga0496118_0032005 3300048921 Bacteria 4344
138 Ga0496118_0032196 3300048921 Bacteria 4327
139 Ga0496119_0008544 3300048922 Bacteria 8980
140 Ga0496120_0004122 3300048923 Bacteria 12535
141 Ga0496120_0040642 3300048923 Bacteria 2731
142 Ga0496121_0005337 3300048924 Bacteria 16524
143 Ga0496121_0024384 3300048924 Bacteria 5787
144 Ga0496121_0210500 3300048924 Unclassified 1378
145 Ga0496121_0447234 3300048924 Bacteria 834
146 Ga0496122_0005638 3300048925 Bacteria 14789
147 Ga0496122_0088014 3300048925 Bacteria 2131
148 Ga0496122_0116081 3300048925 Bacteria 1742
149 Ga0496122_0260675 3300048925 Bacteria 962
150 Ga0496122_0284990 3300048925 Bacteria 900
151 Ga0496123_0000992 3300048926 Bacteria 43625
152 Ga0496123_0012669 3300048926 Bacteria 7161
153 Ga0496123_0039055 3300048926 Bacteria 3325
154 Ga0496123_0040417 3300048926 Bacteria 3248
155 Ga0496123_0445862 3300048926 Bacteria 577
156 Ga0496124_0000129 3300048927 Bacteria 156648
157 Ga0496124_0000188 3300048927 Bacteria 122361
158 Ga0496124_0001109 3300048927 Bacteria 42348
159 Ga0496124_0003544 3300048927 Bacteria 18986
160 Ga0496124_0004448 3300048927 Bacteria 16342
161 Ga0496124_0332836 3300048927 Bacteria 1082
162 Ga0496125_0000561 3300048928 Bacteria 64016
163 Ga0496125_0000845 3300048928 Bacteria 49029
164 Ga0496125_0002726 3300048928 Bacteria 22440
165 Ga0496125_0015539 3300048928 Bacteria 7356
166 Ga0496126_0016586 3300048929 Bacteria 7362
167 Ga0496126_0016800 3300048929 Bacteria 7306
168 Ga0496126_0481354 3300048929 Unclassified 994
169 Ga0496126_0556069 3300048929 Bacteria 910
170 Ga0496126_0680086 3300048929 Bacteria 802
171 Ga0496126_1266778 3300048929 Bacteria 539
172 Ga0501033_0747478 3300049570 Bacteria 663
173 Ga0501043_0219690 3300049579 Bacteria 1471
174 Ga0501047_0444087 3300049581 Bacteria 1127
175 Ga0501044_1015715 3300049823 Bacteria 701
176 Ga0495601_0177675 3300053077 Bacteria 1392
177 Ga0495619_0033603 3300053085 Bacteria 3331
178 Ga0500578_0097768 3300053086 Bacteria 1860
179 Ga0500573_0152844 3300053140 Unclassified 1262
180 Ga0500588_0000474 3300053146 Bacteria 6356
181 Ga0500588_0002834 3300053146 Bacteria 3589
182 Ga0500627_0194521 3300053158 Bacteria 910

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053140 Ga0500573_0152844 Ga0500573_0152844_11_334 102
2 3300053146 Ga0500588_0000474 Ga0500588_0000474_1506_1826 105
3 3300005458 Ga0070681_10118097 Ga0070681_101180973 107
4 3300005546 Ga0070696_100790854 Ga0070696_1007908542 107
5 3300013105 Ga0157369_10097084 Ga0157369_100970842 107
6 3300014497 Ga0182008_10041775 Ga0182008_100417752 107
7 3300015262 Ga0182007_10016959 Ga0182007_100169595 107
8 3300025912 Ga0207707_10245046 Ga0207707_102450463 107
9 3300042009 Ga0439451_040624 Ga0439451_040624_391_714 107
10 3300046519 Ga0495632_0174305 Ga0495632_0174305_192_515 107
11 iso_pu_bacteria 2517093000 2517098937 107
12 iso_pu_bacteria 2517287029 2517407900 107
13 iso_pu_bacteria 2534681796 2535517592 107
14 iso_pu_bacteria 2582581308 2585283849 107
15 iso_pu_bacteria 2615840626 2616309725 107
16 iso_pu_bacteria 2818991439 2819561640 107
17 iso_pu_bacteria 2818991466 2819712297 107
18 iso_pu_bacteria 2821123053 2821129877 107
19 iso_pu_bacteria 2879163058 2879164114 107
20 iso_pu_bacteria 2928526807 2928526812 107
21 iso_pu_bacteria 2928968154 2928969639 107
22 iso_pu_bacteria 2939669807 2939674433 107
23 iso_pu_bacteria 3005445848 3005452466 107
24 iso_pu_bacteria 8005289223 8005294039 107
25 iso_pu_bacteria 8005542996 8005549618 107
26 iso_pu_bacteria 8005688590 8005693231 107
27 3300014325 Ga0163163_10092163 Ga0163163_100921632 108
28 iso_pu_bacteria 2537561836 2538832033 108
29 iso_pu_bacteria 2643221599 2644005597 108
30 iso_pu_bacteria 2883291878 2883295164 108
31 iso_pu_bacteria 2888419890 2888427386 108
32 iso_pu_bacteria 2919114240 2919119441 108
33 iso_pu_bacteria 2984509177 2984513952 108
34 iso_pu_bacteria 2984518228 2984522985 108
35 iso_pu_bacteria 2984537506 2984542479 108
36 iso_pu_bacteria 8005301065 8005302003 108
37 3300014497 Ga0182008_10684353 Ga0182008_106843532 109
38 3300031251 Ga0265327_10034727 Ga0265327_100347274 109
39 3300003763 Ga0055529_1044736 Ga0055529_10447361 110
40 3300003794 Ga0055531_10011550 Ga0055531_100115504 110
41 3300013306 Ga0163162_12905215 Ga0163162_129052152 110
42 3300025272 Ga0209455_1007438 Ga0209455_10074382 110
43 3300025298 Ga0209050_1000090 Ga0209050_1000090244 110
44 3300025304 Ga0209257_1000059 Ga0209257_1000059191 110
45 3300028800 Ga0265338_10000053 Ga0265338_10000053135 110
46 3300028800 Ga0265338_10000160 Ga0265338_100001609 110
47 3300029957 Ga0265324_10000163 Ga0265324_1000016340 110
48 3300031249 Ga0265339_10012521 Ga0265339_100125215 110
49 3300037853 Ga0436364_1012016 Ga0436364_1012016_2165_2500 110
50 3300039437 Ga0436365_0983772 Ga0436365_0983772_139_474 110
51 3300048925 Ga0496122_0088014 Ga0496122_0088014_540_875 110
52 3300002773 JGI25152J39213_1000968 JGI25152J39213_10009688 111
53 3300003187 JGI25151J46595_10001183 JGI25151J46595_100011837 111
54 3300003323 rootH1_10170941 rootH1_101709412 111
55 3300003759 Ga0055525_1000388 Ga0055525_100038821 111
56 3300003762 Ga0055542_1000060 Ga0055542_1000060136 111
57 3300003763 Ga0055529_1000043 Ga0055529_100004332 111
58 3300003771 Ga0055526_1000046 Ga0055526_100004657 111
59 3300003775 Ga0055524_1002269 Ga0055524_10022696 111
60 3300003791 Ga0055530_10025524 Ga0055530_100255243 111
61 3300005262 Ga0065165_1041075 Ga0065165_10410752 111
62 3300005341 Ga0070691_10518830 Ga0070691_105188302 111
63 3300005468 Ga0070707_100186844 Ga0070707_1001868443 111
64 3300005471 Ga0070698_101345872 Ga0070698_1013458722 111
65 3300005536 Ga0070697_100036587 Ga0070697_1000365876 111
66 3300005577 Ga0068857_100057398 Ga0068857_1000573982 111
67 3300005578 Ga0068854_100032215 Ga0068854_1000322154 111
68 3300005578 Ga0068854_100067148 Ga0068854_1000671485 111
69 3300005578 Ga0068854_100127206 Ga0068854_1001272064 111
70 3300005841 Ga0068863_100080919 Ga0068863_1000809193 111
71 3300005844 Ga0068862_100906915 Ga0068862_1009069152 111
72 3300009011 Ga0105251_10315502 Ga0105251_103155022 111
73 3300009093 Ga0105240_11079493 Ga0105240_110794931 111
74 3300009101 Ga0105247_10051392 Ga0105247_100513924 111
75 3300009148 Ga0105243_11147620 Ga0105243_111476202 111
76 3300009177 Ga0105248_10676318 Ga0105248_106763183 111
77 3300009545 Ga0105237_10000038 Ga0105237_1000003828 111
78 3300009545 Ga0105237_10002242 Ga0105237_1000224212 111
79 3300009545 Ga0105237_10005155 Ga0105237_100051555 111
80 3300009766 Ga0123342_1004047 Ga0123342_100404721 111
81 3300010375 Ga0105239_10000108 Ga0105239_1000010828 111
82 3300010375 Ga0105239_10871834 Ga0105239_108718342 111
83 3300011119 Ga0105246_12596776 Ga0105246_125967761 111
84 3300013104 Ga0157370_10344755 Ga0157370_103447552 111
85 3300013306 Ga0163162_10741068 Ga0163162_107410681 111
86 3300013308 Ga0157375_11873068 Ga0157375_118730682 111
87 3300021361 Ga0213872_10082441 Ga0213872_100824411 111
88 3300021441 Ga0213871_10018263 Ga0213871_100182632 111
89 3300025230 Ga0209563_100106 Ga0209563_100106111 111
90 3300025245 Ga0207425_1035172 Ga0207425_10351722 111
91 3300025254 Ga0209148_1000017 Ga0209148_1000017283 111
92 3300025258 Ga0209129_1000016 Ga0209129_1000016374 111
93 3300025272 Ga0209455_1000005 Ga0209455_1000005283 111
94 3300025273 Ga0209673_1012196 Ga0209673_10121962 111
95 3300025284 Ga0209130_1055119 Ga0209130_10551191 111
96 3300025294 Ga0209025_1000126 Ga0209025_1000126108 111
97 3300025294 Ga0209025_1001131 Ga0209025_100113134 111
98 3300025294 Ga0209025_1065340 Ga0209025_10653402 111
99 3300025295 Ga0209564_1000277 Ga0209564_100027751 111
100 3300025297 Ga0209758_1020421 Ga0209758_10204212 111
101 3300025297 Ga0209758_1048968 Ga0209758_10489682 111
102 3300025298 Ga0209050_1000638 Ga0209050_10006388 111
103 3300025299 Ga0209256_1000176 Ga0209256_1000176103 111
104 3300025299 Ga0209256_1016283 Ga0209256_10162832 111
105 3300025302 Ga0207426_1013623 Ga0207426_10136233 111
106 3300025303 Ga0209051_1023488 Ga0209051_10234883 111
107 3300025900 Ga0207710_10081841 Ga0207710_100818412 111
108 3300025901 Ga0207688_10411824 Ga0207688_104118242 111
109 3300025914 Ga0207671_10000045 Ga0207671_1000004582 111
110 3300025914 Ga0207671_10002514 Ga0207671_100025143 111
111 3300025914 Ga0207671_10002588 Ga0207671_1000258811 111
112 3300025922 Ga0207646_11037958 Ga0207646_110379582 111
113 3300025935 Ga0207709_11728058 Ga0207709_117280582 111
114 3300025936 Ga0207670_10157083 Ga0207670_101570832 111
115 3300025981 Ga0207640_10012155 Ga0207640_100121556 111
116 3300025981 Ga0207640_10031831 Ga0207640_100318314 111
117 3300025981 Ga0207640_10053247 Ga0207640_100532475 111
118 3300025986 Ga0207658_10084153 Ga0207658_100841534 111
119 3300026075 Ga0207708_11542394 Ga0207708_115423942 111
120 3300026116 Ga0207674_10071323 Ga0207674_100713234 111
121 3300028800 Ga0265338_10092880 Ga0265338_100928804 111
122 3300030744 Ga0316181_1229929 Ga0316181_12299292 111
123 3300031731 Ga0307405_10056560 Ga0307405_100565602 111
124 3300031824 Ga0307413_10181839 Ga0307413_101818394 111
125 3300031824 Ga0307413_10524411 Ga0307413_105244112 111
126 3300031901 Ga0307406_10423184 Ga0307406_104231842 111
127 3300031901 Ga0307406_10586318 Ga0307406_105863181 111
128 3300031911 Ga0307412_10001050 Ga0307412_1000105010 111
129 3300031911 Ga0307412_10003966 Ga0307412_100039669 111
130 3300031911 Ga0307412_10991944 Ga0307412_109919442 111
131 3300032004 Ga0307414_10137455 Ga0307414_101374552 111
132 3300035692 Ga0373935_0964582 Ga0373935_0964582_253_606 111
133 3300036401 Ga0373937_0349404 Ga0373937_0349404_783_1121 111
134 3300039437 Ga0436365_1413581 Ga0436365_1413581_885_1247 111
135 3300039438 Ga0436360_0222245 Ga0436360_0222245_2206_2544 111
136 3300039447 Ga0436361_0868092 Ga0436361_0868092_1009_1347 111
137 3300039453 Ga0436362_0771886 Ga0436362_0771886_1758_2096 111
138 3300039453 Ga0436362_1115905 Ga0436362_1115905_137_499 111
139 3300041491 Ga0451833_0021712 Ga0451833_0021712_545_886 111
140 3300041491 Ga0451833_0569161 Ga0451833_0569161_528_869 111
141 3300041492 Ga0451835_1264588 Ga0451835_1264588_342_683 111
142 3300041498 Ga0451841_0772175 Ga0451841_0772175_1039_1380 111
143 3300041501 Ga0451845_0694386 Ga0451845_0694386_151_492 111
144 3300041505 Ga0451849_1433882 Ga0451849_1433882_237_578 111
145 3300041507 Ga0451851_0456935 Ga0451851_0456935_124_465 111
146 3300041512 Ga0451853_3508755 Ga0451853_3508755_2750_3091 111
147 3300046460 Ga0495638_0275626 Ga0495638_0275626_479_829 111
148 3300046517 Ga0495630_1505822 Ga0495630_1505822_11_364 111
149 3300046519 Ga0495632_0006688 Ga0495632_0006688_5712_6068 111
150 3300046542 Ga0495597_0263040 Ga0495597_0263040_286_627 111
151 3300046660 Ga0495625_0592326 Ga0495625_0592326_146_496 111
152 3300046683 Ga0495658_0409920 Ga0495658_0409920_314_667 111
153 3300047472 Ga0495686_0016627 Ga0495686_0016627_3346_3687 111
154 3300048903 Ga0496100_0023782 Ga0496100_0023782_1992_2333 111
155 3300048905 Ga0496102_0237578 Ga0496102_0237578_327_668 111
156 3300048905 Ga0496102_1287057 Ga0496102_1287057_244_579 111
157 3300048911 Ga0496108_0206689 Ga0496108_0206689_85_429 111
158 3300048915 Ga0496112_0074877 Ga0496112_0074877_2315_2659 111
159 3300048918 Ga0496115_0123314 Ga0496115_0123314_658_1002 111
160 3300048919 Ga0496116_0028271 Ga0496116_0028271_1596_1937 111
161 3300048920 Ga0496117_0028290 Ga0496117_0028290_2172_2513 111
162 3300048920 Ga0496117_0028452 Ga0496117_0028452_2155_2496 111
163 3300048920 Ga0496117_0078347 Ga0496117_0078347_918_1274 111
164 3300048921 Ga0496118_0027838 Ga0496118_0027838_2741_3097 111
165 3300048921 Ga0496118_0032005 Ga0496118_0032005_2172_2513 111
166 3300048921 Ga0496118_0032196 Ga0496118_0032196_2155_2496 111
167 3300048922 Ga0496119_0008544 Ga0496119_0008544_7088_7429 111
168 3300048923 Ga0496120_0004122 Ga0496120_0004122_11310_11651 111
169 3300048923 Ga0496120_0040642 Ga0496120_0040642_1708_2043 111
170 3300048924 Ga0496121_0005337 Ga0496121_0005337_73_414 111
171 3300048924 Ga0496121_0024384 Ga0496121_0024384_1833_2174 111
172 3300048924 Ga0496121_0210500 Ga0496121_0210500_469_843 111
173 3300048924 Ga0496121_0447234 Ga0496121_0447234_431_766 111
174 3300048925 Ga0496122_0005638 Ga0496122_0005638_580_936 111
175 3300048925 Ga0496122_0116081 Ga0496122_0116081_32_367 111
176 3300048925 Ga0496122_0260675 Ga0496122_0260675_95_430 111
177 3300048925 Ga0496122_0284990 Ga0496122_0284990_382_723 111
178 3300048926 Ga0496123_0000992 Ga0496123_0000992_33723_34079 111
179 3300048926 Ga0496123_0012669 Ga0496123_0012669_1868_2203 111
180 3300048926 Ga0496123_0039055 Ga0496123_0039055_2569_2910 111
181 3300048926 Ga0496123_0040417 Ga0496123_0040417_1658_1993 111
182 3300048926 Ga0496123_0445862 Ga0496123_0445862_186_521 111
183 3300048927 Ga0496124_0000129 Ga0496124_0000129_66903_67238 111
184 3300048927 Ga0496124_0000188 Ga0496124_0000188_29612_29953 111
185 3300048927 Ga0496124_0001109 Ga0496124_0001109_19307_19648 111
186 3300048927 Ga0496124_0003544 Ga0496124_0003544_13337_13672 111
187 3300048927 Ga0496124_0004448 Ga0496124_0004448_5235_5570 111
188 3300048927 Ga0496124_0332836 Ga0496124_0332836_668_1012 111
189 3300048928 Ga0496125_0000561 Ga0496125_0000561_44626_44967 111
190 3300048928 Ga0496125_0000845 Ga0496125_0000845_7555_7911 111
191 3300048928 Ga0496125_0002726 Ga0496125_0002726_8025_8366 111
192 3300048928 Ga0496125_0015539 Ga0496125_0015539_2797_3141 111
193 3300048929 Ga0496126_0016586 Ga0496126_0016586_1136_1477 111
194 3300048929 Ga0496126_0016800 Ga0496126_0016800_4782_5123 111
195 3300048929 Ga0496126_0481354 Ga0496126_0481354_489_845 111
196 3300048929 Ga0496126_0556069 Ga0496126_0556069_95_430 111
197 3300048929 Ga0496126_0680086 Ga0496126_0680086_341_718 111
198 3300048929 Ga0496126_1266778 Ga0496126_1266778_130_471 111
199 3300049570 Ga0501033_0747478 Ga0501033_0747478_297_650 111
200 3300049579 Ga0501043_0219690 Ga0501043_0219690_299_652 111
201 3300049581 Ga0501047_0444087 Ga0501047_0444087_607_960 111
202 3300049823 Ga0501044_1015715 Ga0501044_1015715_164_517 111
203 3300053077 Ga0495601_0177675 Ga0495601_0177675_807_1160 111
204 3300053085 Ga0495619_0033603 Ga0495619_0033603_1345_1698 111
205 3300053086 Ga0500578_0097768 Ga0500578_0097768_758_1102 111
206 3300053146 Ga0500588_0002834 Ga0500588_0002834_2343_2681 111
207 3300053158 Ga0500627_0194521 Ga0500627_0194521_373_726 111

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21006

NHase_beta_N

Nitrile hydratase beta subunit, N-terminal

17

124

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zgd-assembly1.cif.gz_B mutant r157a of fe-type nitrile hydratase from comamonas testosteroni ni1 0.7928 12 98
3qyh-assembly2.cif.gz_D crystal structure of co-type nitrile hydratase beta-h71l from pseudomonas putida. 0.7836 12 97
3qz9-assembly4.cif.gz_H crystal structure of co-type nitrile hydratase beta-y215f from pseudomonas putida. 0.7774 12 97
3qxe-assembly3.cif.gz_F crystal structure of co-type nitrile hydratase from pseudomonas putida. 0.7737 12 97
3qyg-assembly4.cif.gz_H crystal structure of co-type nitrile hydratase beta-e56q from pseudomonas putida. 0.7732 12 97
ID Description Score Start End Superfamily
3qxeB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.7751 12 97 1.10.472.20
4fm4B01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.7491 2 97 1.10.472.20
1ireB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.7096 13 108 1.10.472.20
2dd4H00 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.7031 3 104 1.10.472.20
3hhtB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.6659 11 111 1.10.472.20
ID Description Score Start End GO Terms
AF-A0A7W0JMP0-F1-model_v4 Nitrile hydratase subunit beta 0.9361 30 96
AF-A0A0L0FXY1-F1-model_v4 nitrile hydratase (EC 4.2.1.84) 0.9187 22 96 GO:0016829
GO:0046914
AF-A0A6N6JBK5-F1-model_v4 Nitrile hydratase beta subunit-like N-terminal domain-containing protein 0.9121 25 104
AF-A0A1S8D4S4-F1-model_v4 Nitrile hydratase (EC 4.2.1.84) 0.9096 23 95 GO:0018822
AF-A0A820KDC5-F1-model_v4 Nitrile hydratase beta subunit-like N-terminal domain-containing protein 0.8981 19 97

Feature Viewer

pLDDT pTM Quality
80.82 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map