F316122

General Info

Members Datasets Scaffolds Average Seq Length
207 140 414 220

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100405985|Ga0070713_1004059852
Length 270
Sequence MDAILFWDRFKGRWLRGTEFHYPEQPKDLPSMIPLKNWPKFDSRNARSAVCNLYSITTNQAAIIALFRVMNRYVGNLQPMPGVFPDYPAPVVRNAGAERELTMMGWGMPPPPRAGGYPVTNIRNTSSPHWRAWLKPENRCLVPFNSFGEYAPEPNPGTEKKDVVWFALNDDRPLAAFGGIWTEFRGDRGTKSKPIPGPHLVYGFLTTAPNAVVEPIHPKAMPVILTTDEERDVWMRAPWDEAKALQRPFPDDALKIVARGADKEDRAAAA

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
33 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
52 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
53 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
54 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
55 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
56 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
57 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
58 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
59 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
60 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
61 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
62 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
63 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
64 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
71 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
72 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
73 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
74 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
75 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
76 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
77 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
78 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
79 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
80 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
81 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
82 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
83 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
94 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
97 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
101 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
102 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
103 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
106 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
107 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
108 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
109 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
130 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
131 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
132 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
133 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
134 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
135 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
136 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
137 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
138 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
139 2904699407
140 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 0
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.38
Nodule 1.93
Rhizoplane 7.73
Rhizosphere 77.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100405985 3300005436 Bacteria 1273
2 JGI25406J46586_10000096 3300003203 Bacteria 39663
3 Ga0070680_100016307 3300005336 Bacteria 5845
4 Ga0070680_100136498 3300005336 Bacteria 2055
5 Ga0070714_100206996 3300005435 Bacteria 1797
6 Ga0070714_100336457 3300005435 Bacteria 1415
7 Ga0070713_100080999 3300005436 Bacteria 2769
8 Ga0070713_100390585 3300005436 Bacteria 1298
9 Ga0070710_10113952 3300005437 Bacteria 1628
10 Ga0070710_10170911 3300005437 Bacteria 1354
11 Ga0070711_100726148 3300005439 Bacteria 838
12 Ga0070708_100222842 3300005445 Bacteria 1769
13 Ga0070663_100421491 3300005455 Bacteria 1095
14 Ga0070681_10000318 3300005458 Bacteria 39116
15 Ga0070681_10037709 3300005458 Bacteria 4849
16 Ga0070681_10086596 3300005458 Bacteria 3086
17 Ga0070681_10632617 3300005458 Bacteria 985
18 Ga0070681_10772516 3300005458 Bacteria 877
19 Ga0070707_100094009 3300005468 Bacteria 2903
20 Ga0070707_100635975 3300005468 Bacteria 1029
21 Ga0070698_100066815 3300005471 Bacteria 3617
22 Ga0070698_100394676 3300005471 Bacteria 1317
23 Ga0070699_100393628 3300005518 Bacteria 1252
24 Ga0070679_100001441 3300005530 Bacteria 21033
25 Ga0070679_100073080 3300005530 Bacteria 3422
26 Ga0070679_100268261 3300005530 Bacteria 1661
27 Ga0070679_100389426 3300005530 Bacteria 1340
28 Ga0070684_100065886 3300005535 Bacteria 3180
29 Ga0070697_100291289 3300005536 Bacteria 1402
30 Ga0070665_100018318 3300005548 Bacteria 7019
31 Ga0070665_100038621 3300005548 Bacteria 4799
32 Ga0068855_100429865 3300005563 Bacteria 1443
33 Ga0068861_100248220 3300005719 Bacteria 1517
34 Ga0068860_100046699 3300005843 Bacteria 4129
35 Ga0068862_100109687 3300005844 Bacteria 2421
36 Ga0081540_1002012 3300005983 Bacteria 16963
37 Ga0081540_1002740 3300005983 Bacteria 14339
38 Ga0081539_10000051 3300005985 Bacteria 268337
39 Ga0070717_10013256 3300006028 Bacteria 6309
40 Ga0070717_10074456 3300006028 Bacteria 2838
41 Ga0070716_100784444 3300006173 Bacteria 736
42 Ga0070712_100081306 3300006175 Bacteria 2347
43 Ga0099794_10004726 3300007265 Bacteria 5396
44 Ga0099794_10014116 3300007265 Bacteria 3493
45 Ga0105247_10139483 3300009101 Bacteria 1587
46 Ga0105242_11409359 3300009176 Bacteria 724
47 Ga0105237_10529278 3300009545 Bacteria 1185
48 Ga0157374_10689423 3300013296 Bacteria 1034
49 Ga0163163_10132440 3300014325 Bacteria 2533
50 Ga0213876_10000511 3300021384 Bacteria 29990
51 Ga0207692_10041146 3300025898 Bacteria 2286
52 Ga0207692_10144797 3300025898 Bacteria 1355
53 Ga0207699_10068232 3300025906 Bacteria 2165
54 Ga0207699_10093080 3300025906 Bacteria 1896
55 Ga0207707_10000655 3300025912 Bacteria 34282
56 Ga0207707_10019755 3300025912 Bacteria 5881
57 Ga0207707_10173932 3300025912 Bacteria 1881
58 Ga0207693_10023727 3300025915 Bacteria 4867
59 Ga0207663_10074841 3300025916 Bacteria 2196
60 Ga0207663_10298601 3300025916 Bacteria 1202
61 Ga0207660_10006165 3300025917 Bacteria 7783
62 Ga0207660_10434711 3300025917 Bacteria 1060
63 Ga0207652_10001447 3300025921 Bacteria 21012
64 Ga0207652_10323290 3300025921 Bacteria 1393
65 Ga0207652_10328453 3300025921 Bacteria 1381
66 Ga0207652_10723349 3300025921 Bacteria 887
67 Ga0207646_10194403 3300025922 Bacteria 1832
68 Ga0207646_10464009 3300025922 Bacteria 1142
69 Ga0207700_10125525 3300025928 Bacteria 2087
70 Ga0207700_10421870 3300025928 Bacteria 1172
71 Ga0207700_10455454 3300025928 Bacteria 1128
72 Ga0207665_10215344 3300025939 Bacteria 1405
73 Ga0207661_10083403 3300025944 Bacteria 2645
74 Ga0207668_10131934 3300025972 Bacteria 1909
75 Ga0207658_10242032 3300025986 Bacteria 1529
76 Ga0207703_10158401 3300026035 Bacteria 1981
77 Ga0207678_10319637 3300026067 Bacteria 1335
78 Ga0207683_10177657 3300026121 Bacteria 1930
79 Ga0268266_10014353 3300028379 Bacteria 6813
80 Ga0268266_10297755 3300028379 Bacteria 1504
81 Ga0268264_10000043 3300028381 Bacteria 371761
82 Ga0307517_10101292 3300028786 Bacteria 2268
83 Ga0307513_10647211 3300031456 Bacteria 764
84 Ga0307509_10004442 3300031507 Bacteria 20222
85 Ga0307508_10100089 3300031616 Bacteria 2493
86 Ga0307508_10390382 3300031616 Bacteria 983
87 Ga0307507_10235153 3300033179 Bacteria 1208
88 Ga0307510_10018385 3300033180 Bacteria 8226
89 Ga0307510_10073058 3300033180 Bacteria 3402
90 Ga0307510_10075804 3300033180 Bacteria 3313
91 Ga0315911_1000002 3300033442 Bacteria 926833
92 Ga0373946_0069646 3300035171 Bacteria 1516
93 Ga0373955_0094542 3300035172 Bacteria 1708
94 Ga0373924_0062926 3300035410 Bacteria 1555
95 Ga0373935_0010856 3300035692 Bacteria 5471
96 Ga0373927_0004555 3300035695 Bacteria 9686
97 Ga0373933_0026678 3300035724 Bacteria 3319
98 Ga0373947_0030556 3300035725 Bacteria 3166
99 Ga0373947_0288856 3300035725 Bacteria 1092
100 Ga0373937_0080490 3300036401 Bacteria 3012
101 Ga0373925_0140533 3300037068 Bacteria 1889
102 Ga0373925_0148267 3300037068 Bacteria 1840
103 Ga0436365_1380188 3300039437 Bacteria 31102
104 Ga0436361_0896032 3300039447 Bacteria 1113
105 Ga0466967_0252279 3300045976 Bacteria 1686
106 Ga0495592_0030962 3300046454 Bacteria 4046
107 Ga0495603_0000920 3300046455 Bacteria 16895
108 Ga0495603_0103633 3300046455 Bacteria 1660
109 Ga0495603_0217823 3300046455 Bacteria 1102
110 Ga0495629_0025625 3300046459 Bacteria 4191
111 Ga0495629_0329523 3300046459 Bacteria 1043
112 Ga0495641_0014155 3300046461 Bacteria 4330
113 Ga0495653_0042514 3300046463 Bacteria 3539
114 Ga0495580_0036838 3300046472 Bacteria 3512
115 Ga0495580_0097538 3300046472 Bacteria 2044
116 Ga0495582_0003841 3300046473 Bacteria 8458
117 Ga0495639_0000708 3300046475 Bacteria 15275
118 Ga0495662_0001600 3300046476 Bacteria 11242
119 Ga0495664_0045706 3300046477 Bacteria 2597
120 Ga0495664_0281208 3300046477 Bacteria 1005
121 Ga0495584_0014762 3300046491 Bacteria 3979
122 Ga0495594_0006774 3300046499 Bacteria 5892
123 Ga0495607_0159773 3300046501 Bacteria 1146
124 Ga0495606_0002548 3300046507 Bacteria 20944
125 Ga0495618_0019704 3300046514 Bacteria 4151
126 Ga0495618_0241031 3300046514 Bacteria 1137
127 Ga0495628_0335442 3300046516 Bacteria 1114
128 Ga0495630_0014989 3300046517 Bacteria 5655
129 Ga0495630_0067438 3300046517 Bacteria 2690
130 Ga0495644_0069043 3300046523 Bacteria 1328
131 Ga0495666_0075039 3300046526 Bacteria 1603
132 Ga0495652_0145372 3300046529 Bacteria 1859
133 Ga0495665_0001526 3300046531 Bacteria 12349
134 Ga0495640_0180242 3300046533 Bacteria 1346
135 Ga0495587_0410102 3300046536 Bacteria 752
136 Ga0495598_0031371 3300046537 Bacteria 1495
137 Ga0495622_0156456 3300046557 Bacteria 1029
138 Ga0495667_0013826 3300046559 Bacteria 5451
139 Ga0495667_0122593 3300046559 Bacteria 1678
140 Ga0495634_0011613 3300046642 Bacteria 6406
141 Ga0495634_0080001 3300046642 Bacteria 2139
142 Ga0495611_0089620 3300046648 Bacteria 1421
143 Ga0495611_0165738 3300046648 Bacteria 1033
144 Ga0495635_0013347 3300046663 Bacteria 5751
145 Ga0495657_0078552 3300046675 Bacteria 2139
146 Ga0495657_0177889 3300046675 Bacteria 1307
147 Ga0495599_0208216 3300046678 Bacteria 1200
148 Ga0495646_0014862 3300046680 Bacteria 4945
149 Ga0495646_0085678 3300046680 Bacteria 1828
150 Ga0495647_0044928 3300046681 Bacteria 1695
151 Ga0495658_0039067 3300046683 Bacteria 2631
152 Ga0495613_0059258 3300046689 Bacteria 2807
153 Ga0495613_0510181 3300046689 Bacteria 809
154 Ga0495624_0011432 3300046690 Bacteria 6099
155 Ga0495581_0005556 3300047315 Bacteria 7305
156 Ga0495581_0280585 3300047315 Bacteria 974
157 Ga0495604_0040409 3300047317 Bacteria 3662
158 Ga0495604_0167436 3300047317 Bacteria 1549
159 Ga0495674_0012026 3300047319 Bacteria 8158
160 Ga0495674_0063037 3300047319 Bacteria 3225
161 Ga0495674_0195698 3300047319 Bacteria 1679
162 Ga0495676_0069009 3300047321 Bacteria 2729
163 Ga0495680_0022530 3300047322 Bacteria 5246
164 Ga0495675_0183867 3300047444 Bacteria 1278
165 Ga0495675_0198220 3300047444 Bacteria 1223
166 Ga0495684_0021220 3300047471 Bacteria 5005
167 Ga0495684_0455206 3300047471 Bacteria 888
168 Ga0495593_0009474 3300047673 Bacteria 5648
169 Ga0496101_0363498 3300048904 Bacteria 1138
170 Ga0496102_1074202 3300048905 Bacteria 725
171 Ga0496105_0295954 3300048908 Bacteria 1302
172 Ga0496107_0173054 3300048910 Bacteria 1602
173 Ga0496108_0255870 3300048911 Bacteria 1523
174 Ga0496108_0622255 3300048911 Bacteria 940
175 Ga0496109_0008751 3300048912 Bacteria 8619
176 Ga0496110_0038094 3300048913 Bacteria 4182
177 Ga0496110_0373994 3300048913 Bacteria 1298
178 Ga0496111_0271329 3300048914 Bacteria 1258
179 Ga0496111_0504684 3300048914 Bacteria 890
180 Ga0496112_0669075 3300048915 Bacteria 967
181 Ga0496113_0255174 3300048916 Bacteria 1400
182 Ga0496115_0240084 3300048918 Bacteria 1493
183 Ga0496115_0351021 3300048918 Bacteria 1203
184 Ga0496115_0523835 3300048918 Bacteria 950
185 Ga0496121_0252313 3300048924 Bacteria 1223
186 Ga0496121_0397679 3300048924 Bacteria 903
187 Ga0496123_0104738 3300048926 Bacteria 1635
188 Ga0496126_0046733 3300048929 Bacteria 3967
189 Ga0496126_0051191 3300048929 Bacteria 3760
190 Ga0496126_0244699 3300048929 Bacteria 1497
191 Ga0496126_0469333 3300048929 Bacteria 1010
192 Ga0495601_0014985 3300053077 Bacteria 4681
193 Ga0495601_0263117 3300053077 Bacteria 1126
194 Ga0495595_0089378 3300053084 Bacteria 1476
195 Ga0495619_0027646 3300053085 Bacteria 3655
196 Ga0495619_0042059 3300053085 Bacteria 2991
197 Ga0500595_000694 3300053119 Bacteria 20105
198 Ga0500607_053440 3300053121 Bacteria 2141
199 Ga0500559_0011634 3300053136 Bacteria 3757
200 Ga0500573_0030739 3300053140 Bacteria 3098
201 Ga0500637_0233174 3300053178 Bacteria 1035
202 Ga0500637_0278549 3300053178 Bacteria 922
203 Ga0500645_009731 3300053730 Bacteria 3219
204 2517893637 2517572143 Bacteria 9484767
205 2903758388 2903748898 Bacteria 9972761
206 2904700772
207 2908763669 2908756301 Bacteria 8864324
208 Ga0070713_100405985
209 JGI25406J46586_10000096
210 Ga0070680_100016307
211 Ga0070680_100136498
212 Ga0070714_100206996
213 Ga0070714_100336457
214 Ga0070713_100080999
215 Ga0070713_100390585
216 Ga0070710_10113952
217 Ga0070710_10170911
218 Ga0070711_100726148
219 Ga0070708_100222842
220 Ga0070663_100421491
221 Ga0070681_10000318
222 Ga0070681_10037709
223 Ga0070681_10086596
224 Ga0070681_10632617
225 Ga0070681_10772516
226 Ga0070707_100094009
227 Ga0070707_100635975
228 Ga0070698_100066815
229 Ga0070698_100394676
230 Ga0070699_100393628
231 Ga0070679_100001441
232 Ga0070679_100073080
233 Ga0070679_100268261
234 Ga0070679_100389426
235 Ga0070684_100065886
236 Ga0070697_100291289
237 Ga0070665_100018318
238 Ga0070665_100038621
239 Ga0068855_100429865
240 Ga0068861_100248220
241 Ga0068860_100046699
242 Ga0068862_100109687
243 Ga0081540_1002012
244 Ga0081540_1002740
245 Ga0081539_10000051
246 Ga0070717_10013256
247 Ga0070717_10074456
248 Ga0070716_100784444
249 Ga0070712_100081306
250 Ga0099794_10004726
251 Ga0099794_10014116
252 Ga0105247_10139483
253 Ga0105242_11409359
254 Ga0105237_10529278
255 Ga0157374_10689423
256 Ga0163163_10132440
257 Ga0213876_10000511
258 Ga0207692_10041146
259 Ga0207692_10144797
260 Ga0207699_10068232
261 Ga0207699_10093080
262 Ga0207707_10000655
263 Ga0207707_10019755
264 Ga0207707_10173932
265 Ga0207693_10023727
266 Ga0207663_10074841
267 Ga0207663_10298601
268 Ga0207660_10006165
269 Ga0207660_10434711
270 Ga0207652_10001447
271 Ga0207652_10323290
272 Ga0207652_10328453
273 Ga0207652_10723349
274 Ga0207646_10194403
275 Ga0207646_10464009
276 Ga0207700_10125525
277 Ga0207700_10421870
278 Ga0207700_10455454
279 Ga0207665_10215344
280 Ga0207661_10083403
281 Ga0207668_10131934
282 Ga0207658_10242032
283 Ga0207703_10158401
284 Ga0207678_10319637
285 Ga0207683_10177657
286 Ga0268266_10014353
287 Ga0268266_10297755
288 Ga0268264_10000043
289 Ga0307517_10101292
290 Ga0307513_10647211
291 Ga0307509_10004442
292 Ga0307508_10100089
293 Ga0307508_10390382
294 Ga0307507_10235153
295 Ga0307510_10018385
296 Ga0307510_10073058
297 Ga0307510_10075804
298 Ga0315911_1000002
299 Ga0373946_0069646
300 Ga0373955_0094542
301 Ga0373924_0062926
302 Ga0373935_0010856
303 Ga0373927_0004555
304 Ga0373933_0026678
305 Ga0373947_0030556
306 Ga0373947_0288856
307 Ga0373937_0080490
308 Ga0373925_0140533
309 Ga0373925_0148267
310 Ga0436365_1380188
311 Ga0436361_0896032
312 Ga0466967_0252279
313 Ga0495592_0030962
314 Ga0495603_0000920
315 Ga0495603_0103633
316 Ga0495603_0217823
317 Ga0495629_0025625
318 Ga0495629_0329523
319 Ga0495641_0014155
320 Ga0495653_0042514
321 Ga0495580_0036838
322 Ga0495580_0097538
323 Ga0495582_0003841
324 Ga0495639_0000708
325 Ga0495662_0001600
326 Ga0495664_0045706
327 Ga0495664_0281208
328 Ga0495584_0014762
329 Ga0495594_0006774
330 Ga0495607_0159773
331 Ga0495606_0002548
332 Ga0495618_0019704
333 Ga0495618_0241031
334 Ga0495628_0335442
335 Ga0495630_0014989
336 Ga0495630_0067438
337 Ga0495644_0069043
338 Ga0495666_0075039
339 Ga0495652_0145372
340 Ga0495665_0001526
341 Ga0495640_0180242
342 Ga0495587_0410102
343 Ga0495598_0031371
344 Ga0495622_0156456
345 Ga0495667_0013826
346 Ga0495667_0122593
347 Ga0495634_0011613
348 Ga0495634_0080001
349 Ga0495611_0089620
350 Ga0495611_0165738
351 Ga0495635_0013347
352 Ga0495657_0078552
353 Ga0495657_0177889
354 Ga0495599_0208216
355 Ga0495646_0014862
356 Ga0495646_0085678
357 Ga0495647_0044928
358 Ga0495658_0039067
359 Ga0495613_0059258
360 Ga0495613_0510181
361 Ga0495624_0011432
362 Ga0495581_0005556
363 Ga0495581_0280585
364 Ga0495604_0040409
365 Ga0495604_0167436
366 Ga0495674_0012026
367 Ga0495674_0063037
368 Ga0495674_0195698
369 Ga0495676_0069009
370 Ga0495680_0022530
371 Ga0495675_0183867
372 Ga0495675_0198220
373 Ga0495684_0021220
374 Ga0495684_0455206
375 Ga0495593_0009474
376 Ga0496101_0363498
377 Ga0496102_1074202
378 Ga0496105_0295954
379 Ga0496107_0173054
380 Ga0496108_0255870
381 Ga0496108_0622255
382 Ga0496109_0008751
383 Ga0496110_0038094
384 Ga0496110_0373994
385 Ga0496111_0271329
386 Ga0496111_0504684
387 Ga0496112_0669075
388 Ga0496113_0255174
389 Ga0496115_0240084
390 Ga0496115_0351021
391 Ga0496115_0523835
392 Ga0496121_0252313
393 Ga0496121_0397679
394 Ga0496123_0104738
395 Ga0496126_0046733
396 Ga0496126_0051191
397 Ga0496126_0244699
398 Ga0496126_0469333
399 Ga0495601_0014985
400 Ga0495601_0263117
401 Ga0495595_0089378
402 Ga0495619_0027646
403 Ga0495619_0042059
404 Ga0500595_000694
405 Ga0500607_053440
406 Ga0500559_0011634
407 Ga0500573_0030739
408 Ga0500637_0233174
409 Ga0500637_0278549
410 Ga0500645_009731
411 2517893637
412 2903758388
413 2904700772
414 2908763669

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02586

SRAP

SOS response associated peptidase (SRAP)

50

259

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2aeg-assembly3.cif.gz_C x-ray crystal structure of protein atu5096 from agrobacterium tumefaciens. northeast structural genomics consortium target atr63. 0.3923 2 211
2bdv-assembly1.cif.gz_A x-ray crystal structure of phage-related protein bb2244 from bordetella bronchiseptica. northeast structural genomics consortium target bor24. 0.3817 2 206
2aeg-assembly3.cif.gz_C x-ray crystal structure of protein atu5096 from agrobacterium tumefaciens. northeast structural genomics consortium target atr63. 0.3749 2 211
2bdv-assembly1.cif.gz_A x-ray crystal structure of phage-related protein bb2244 from bordetella bronchiseptica. northeast structural genomics consortium target bor24. 0.359 2 206
3pgz-assembly1.cif.gz_B crystal structure of a single strand binding protein (ssb) from bartonella henselae 0.3272 90 184
ID Description Score Start End Superfamily
af_A0A1D8PDM8_5_130_3.90.1030.20 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;DNA polymerase delta, p66 (Cdc27) subunit, wHTH domain 0.4682 11 56 3.90.1030.20
af_B0V2R7_109_214_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.42 25 65 2.60.40.10
af_I1JZ01_69_218_3.40.20.10 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.3649 33 102 3.40.20.10
af_I1KYZ5_1_237_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.3597 1 206 3.90.1680.10
af_I1KYZ5_1_237_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.3429 1 206 3.90.1680.10
ID Description Score Start End GO Terms
AF-A0A2T0P663-F1-model_v4 deleted 0.5822 93 220
AF-A0A2T0P663-F1-model_v4 deleted 0.5784 93 220
AF-A0A1W4V949-F1-model_v4 deleted 0.5743 100 209
AF-A0A433AYW5-F1-model_v4 Abasic site processing protein 0.5408 92 220 GO:0003697
GO:0106300
AF-A0A2U3PU04-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.5398 75 216 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300

Map