F315966

General Info

Members Datasets Scaffolds Average Seq Length
207 132 207 317

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10004625|Ga0070658_100046255
Length 340
Sequence MAMIEIKHLRKEYKDKPEPAVKDLTLELEQGDIFGFIGPNGAGKTTTIKMLATLLIPTAGSAMVNGIDVVKHPEQIRSIVGYMPDFFGVYDDIKVWEYLDFFAAAYRIPKDRRPQIIDDVLALTDLTVKKDSYVEALSRGMKQRLCLAKTLVHDPKVMLLDEPASGLDPRARIEIRELLKELQAMGKTIIVSSHILPEMEEFCNKVGIIERGEMIVAGDVNTIARTVRGHQNISIAVVNEIERAEAILIGMTDLVRDVKLTNGLRQLNETSAEDLRQQTLQRENYSSKGSVLQVSYIGEPDEEYHILTALVEAGIKVRAFYTPETDLEDVFLRVTKGQVA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.7
Rhizosphere 89.86
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10004625 3300005327 Bacteria 11187
2 Ga0070658_10119303 3300005327 Bacteria 2191
3 Ga0070683_100083830 3300005329 Bacteria 2986
4 Ga0070680_100261931 3300005336 Bacteria 1463
5 Ga0070661_100315103 3300005344 Bacteria 1221
6 Ga0070674_100023738 3300005356 Bacteria 3974
7 Ga0070659_100069810 3300005366 Bacteria 2790
8 Ga0070659_100197975 3300005366 Bacteria 1653
9 Ga0070667_100087408 3300005367 Bacteria 2675
10 Ga0070714_100280366 3300005435 Bacteria 1548
11 Ga0070713_100384540 3300005436 Bacteria 1308
12 Ga0070705_100005298 3300005440 Bacteria 6273
13 Ga0070705_100033309 3300005440 Bacteria 2871
14 Ga0070694_100149049 3300005444 Bacteria 1707
15 Ga0070694_100235664 3300005444 Bacteria 1379
16 Ga0070708_100036555 3300005445 Bacteria 4284
17 Ga0070678_100073404 3300005456 Bacteria 2568
18 Ga0070662_100497266 3300005457 Bacteria 1017
19 Ga0070681_10128048 3300005458 Bacteria 2472
20 Ga0068867_100492571 3300005459 Bacteria 1052
21 Ga0070706_100000469 3300005467 Bacteria 47854
22 Ga0070706_100031341 3300005467 Bacteria 4903
23 Ga0070707_100000163 3300005468 Bacteria 63764
24 Ga0070707_100010325 3300005468 Bacteria 8692
25 Ga0070707_100010913 3300005468 Bacteria 8460
26 Ga0070707_100033441 3300005468 Bacteria 4903
27 Ga0070698_100037595 3300005471 Bacteria 4990
28 Ga0070698_100086185 3300005471 Bacteria 3127
29 Ga0070699_100000999 3300005518 Bacteria 26314
30 Ga0070699_100010316 3300005518 Bacteria 8077
31 Ga0070684_100005834 3300005535 Bacteria 9474
32 Ga0070697_100006742 3300005536 Bacteria 8906
33 Ga0070686_100024560 3300005544 Bacteria 3614
34 Ga0070686_100089836 3300005544 Bacteria 2053
35 Ga0070686_100164965 3300005544 Bacteria 1563
36 Ga0070695_100047384 3300005545 Bacteria 2745
37 Ga0070695_100076997 3300005545 Bacteria 2197
38 Ga0070695_100199645 3300005545 Bacteria 1428
39 Ga0070696_100007691 3300005546 Bacteria 7199
40 Ga0070696_100009032 3300005546 Bacteria 6674
41 Ga0070665_100000325 3300005548 Bacteria 73433
42 Ga0070665_100147446 3300005548 Bacteria 2356
43 Ga0070704_100009695 3300005549 Bacteria 5836
44 Ga0070704_100011163 3300005549 Bacteria 5493
45 Ga0070664_100111614 3300005564 Bacteria 2387
46 Ga0068864_100153691 3300005618 Bacteria 2087
47 Ga0068861_100159985 3300005719 Bacteria 1857
48 Ga0068863_100064564 3300005841 Bacteria 3462
49 Ga0068863_100154759 3300005841 Bacteria 2195
50 Ga0068863_100431066 3300005841 Bacteria 1292
51 Ga0068858_100283888 3300005842 Bacteria 1576
52 Ga0068860_100013712 3300005843 Bacteria 7948
53 Ga0068860_100071727 3300005843 Bacteria 3290
54 Ga0081539_10007911 3300005985 Bacteria 9477
55 Ga0075434_100374869 3300006871 Bacteria 1444
56 Ga0075434_100646586 3300006871 Bacteria 1076
57 Ga0099795_10083484 3300007788 Bacteria 1226
58 Ga0105240_10000859 3300009093 Bacteria 54758
59 Ga0105245_10063644 3300009098 Unclassified 3331
60 Ga0105245_10125881 3300009098 Bacteria 2399
61 Ga0105242_10034763 3300009176 Bacteria 4041
62 Ga0105237_10000015 3300009545 Bacteria 266079
63 Ga0105249_10011950 3300009553 Bacteria 7637
64 Ga0105239_10092116 3300010375 Bacteria 3345
65 Ga0105239_10205314 3300010375 Bacteria 2208
66 Ga0157375_10059038 3300013308 Bacteria 3798
67 Ga0163163_10020675 3300014325 Bacteria 6203
68 Ga0163163_10021692 3300014325 Bacteria 6065
69 Ga0157380_10095748 3300014326 Bacteria 2460
70 Ga0157380_10462483 3300014326 Bacteria 1222
71 Ga0157379_10076989 3300014968 Bacteria 2987
72 Ga0157379_10090955 3300014968 Bacteria 2738
73 Ga0157379_10106533 3300014968 Bacteria 2516
74 Ga0157376_10374263 3300014969 Bacteria 1370
75 Ga0207653_10048739 3300025885 Bacteria 1405
76 Ga0207688_10034285 3300025901 Bacteria 2810
77 Ga0207705_10011278 3300025909 Bacteria 6475
78 Ga0207705_10014329 3300025909 Bacteria 5705
79 Ga0207705_10168417 3300025909 Bacteria 1649
80 Ga0207684_10002339 3300025910 Bacteria 19206
81 Ga0207684_10037040 3300025910 Bacteria 4140
82 Ga0207684_10082084 3300025910 Bacteria 2744
83 Ga0207684_10082177 3300025910 Bacteria 2743
84 Ga0207707_10323481 3300025912 Bacteria 1331
85 Ga0207695_10001410 3300025913 Bacteria 40494
86 Ga0207671_10000007 3300025914 Bacteria 825758
87 Ga0207660_10051607 3300025917 Bacteria 2925
88 Ga0207662_10022121 3300025918 Bacteria 3641
89 Ga0207662_10237621 3300025918 Bacteria 1192
90 Ga0207657_10293510 3300025919 Bacteria 1289
91 Ga0207646_10007469 3300025922 Bacteria 11102
92 Ga0207646_10013833 3300025922 Bacteria 7694
93 Ga0207646_10014054 3300025922 Bacteria 7616
94 Ga0207659_10164532 3300025926 Unclassified 1745
95 Ga0207659_10210404 3300025926 Bacteria 1558
96 Ga0207687_10175502 3300025927 Bacteria 1656
97 Ga0207664_10288886 3300025929 Bacteria 1441
98 Ga0207644_10120147 3300025931 Bacteria 1999
99 Ga0207690_10090752 3300025932 Bacteria 2158
100 Ga0207686_10036660 3300025934 Bacteria 2953
101 Ga0207669_10013639 3300025937 Bacteria 4045
102 Ga0207689_10110985 3300025942 Bacteria 2254
103 Ga0207661_10047336 3300025944 Bacteria 3413
104 Ga0207667_10264212 3300025949 Bacteria 1760
105 Ga0207667_10342272 3300025949 Bacteria 1526
106 Ga0207708_10063795 3300026075 Bacteria 2814
107 Ga0207641_10047045 3300026088 Bacteria 3637
108 Ga0207676_10453667 3300026095 Bacteria 1209
109 Ga0207675_100174706 3300026118 Bacteria 2055
110 Ga0207683_10034720 3300026121 Bacteria 4384
111 Ga0268266_10003463 3300028379 Bacteria 15747
112 Ga0268266_10112195 3300028379 Bacteria 2417
113 Ga0268264_10065093 3300028381 Bacteria 3070
114 Ga0307515_10000237 3300028794 Bacteria 136173
115 Ga0307405_10037808 3300031731 Bacteria 2904
116 Ga0307413_10172416 3300031824 Bacteria 1533
117 Ga0307412_10122287 3300031911 Bacteria 1876
118 Ga0307409_100036096 3300031995 Bacteria 3629
119 Ga0307409_100092821 3300031995 Bacteria 2478
120 Ga0307409_100348219 3300031995 Bacteria 1397
121 Ga0307416_100065572 3300032002 Bacteria 2985
122 Ga0307416_100713969 3300032002 Bacteria 1092
123 Ga0307411_10050569 3300032005 Bacteria 2707
124 Ga0307415_100015753 3300032126 Bacteria 4487
125 Ga0395905_0000631 3300037471 Bacteria 47142
126 Ga0395905_0176287 3300037471 Bacteria 2007
127 Ga0436364_0985190 3300037853 Bacteria 106787
128 Ga0436364_1044904 3300037853 Bacteria 2213
129 Ga0439464_0020995 3300042439 Bacteria 1791
130 Ga0451577_0037204 3300042876 Bacteria 4381
131 Ga0453683_0023595 3300044673 Bacteria 3919
132 Ga0466965_0086175 3300044683 Bacteria 1593
133 Ga0453684_0173106 3300044712 Bacteria 2542
134 Ga0451576_0078828 3300045051 Bacteria 3427
135 Ga0495630_0012130 3300046517 Bacteria 6248
136 Ga0495676_0259658 3300047321 Bacteria 1182
137 Ga0496102_0034274 3300048905 Bacteria 4565
138 Ga0496103_0031852 3300048906 Bacteria 3216
139 Ga0496103_0088687 3300048906 Bacteria 1950
140 Ga0496104_0004307 3300048907 Bacteria 12376
141 Ga0496104_0272319 3300048907 Bacteria 1606
142 Ga0496105_0066395 3300048908 Bacteria 2978
143 Ga0496105_0113867 3300048908 Bacteria 2231
144 Ga0496106_0504088 3300048909 Bacteria 972
145 Ga0496107_0083150 3300048910 Bacteria 2334
146 Ga0496107_0097947 3300048910 Bacteria 2148
147 Ga0496108_0013663 3300048911 Bacteria 6628
148 Ga0496109_0010734 3300048912 Bacteria 7839
149 Ga0496109_0049533 3300048912 Bacteria 3824
150 Ga0496109_0408038 3300048912 Bacteria 1284
151 Ga0496109_0561343 3300048912 Bacteria 1077
152 Ga0496111_0092663 3300048914 Bacteria 2215
153 Ga0496111_0357480 3300048914 Bacteria 1081
154 Ga0496113_0007582 3300048916 Bacteria 6998
155 Ga0501031_0083275 3300049568 Bacteria 2085
156 Ga0501034_0012311 3300049571 Bacteria 8837
157 Ga0501036_0054988 3300049572 Bacteria 3372
158 Ga0501036_0160884 3300049572 Bacteria 1893
159 Ga0501038_0143076 3300049574 Bacteria 1955
160 Ga0501039_0028857 3300049575 Bacteria 4273
161 Ga0501039_0041234 3300049575 Bacteria 3564
162 Ga0501040_0054795 3300049576 Bacteria 2734
163 Ga0501040_0142106 3300049576 Bacteria 1691
164 Ga0501042_0057414 3300049578 Bacteria 2777
165 Ga0501042_0068051 3300049578 Bacteria 2546
166 Ga0501042_0165837 3300049578 Bacteria 1594
167 Ga0501043_0226413 3300049579 Bacteria 1445
168 Ga0501046_0034147 3300049580 Bacteria 4107
169 Ga0501046_0048975 3300049580 Bacteria 3344
170 Ga0501047_0000333 3300049581 Bacteria 54084
171 Ga0501048_0003450 3300049582 Bacteria 12018
172 Ga0501048_0055835 3300049582 Bacteria 2803
173 Ga0501048_0334347 3300049582 Bacteria 1079
174 Ga0501067_0015310 3300049583 Bacteria 4244
175 Ga0501067_0108702 3300049583 Bacteria 1542
176 Ga0501068_0037482 3300049584 Bacteria 2902
177 Ga0501068_0126621 3300049584 Bacteria 1595
178 Ga0501069_0065298 3300049585 Bacteria 2035
179 Ga0501071_0022566 3300049587 Bacteria 4388
180 Ga0501071_0068883 3300049587 Bacteria 2575
181 Ga0501071_0122366 3300049587 Bacteria 1929
182 Ga0501071_0139754 3300049587 Bacteria 1803
183 Ga0501072_0050062 3300049588 Bacteria 3289
184 Ga0501074_0067581 3300049590 Bacteria 2570
185 Ga0501074_0126355 3300049590 Bacteria 1829
186 Ga0501075_0003439 3300049591 Bacteria 10592
187 Ga0501075_0101730 3300049591 Bacteria 2182
188 Ga0501076_0002695 3300049592 Bacteria 12273
189 Ga0501076_0091322 3300049592 Bacteria 2449
190 Ga0501076_0243418 3300049592 Bacteria 1472
191 Ga0501079_0015506 3300049741 Bacteria 5816
192 Ga0501079_0023715 3300049741 Bacteria 4708
193 Ga0501079_0203078 3300049741 Bacteria 1548
194 Ga0501080_0057004 3300049742 Bacteria 3638
195 Ga0501045_0011204 3300049824 Bacteria 6289
196 Ga0501045_0012400 3300049824 Bacteria 6003
197 Ga0501045_0091190 3300049824 Bacteria 2252
198 nmdc:mga05p37_616863_c1 3300050507 Bacteria 1221
199 nmdc:mga0qj67_326349_c1 3300050509 Bacteria 1242
200 nmdc:mga0n895_224137_c1 3300050512 Bacteria 1908
201 nmdc:mga0n895_565138_c1 3300050512 Bacteria 1142
202 nmdc:mga0a205_64925_c1 3300050515 Bacteria 3526
203 Ga0501084_0008761 3300054114 Bacteria 8367
204 Ga0501082_0154983 3300060353 Bacteria 1990
205 Ga0501082_0157294 3300060353 Bacteria 1974
206 Ga0530510_0031298 3300061734 Bacteria 3825
207 Ga0530510_0121658 3300061734 Bacteria 1916

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048909 Ga0496106_0504088 Ga0496106_0504088_19_846 243
2 3300048912 Ga0496109_0561343 Ga0496109_0561343_32_910 251
3 3300005336 Ga0070680_100261931 Ga0070680_1002619311 287
4 3300005457 Ga0070662_100497266 Ga0070662_1004972661 287
5 3300005544 Ga0070686_100164965 Ga0070686_1001649652 287
6 3300009098 Ga0105245_10125881 Ga0105245_101258812 287
7 3300010375 Ga0105239_10205314 Ga0105239_102053142 287
8 3300025918 Ga0207662_10022121 Ga0207662_100221212 287
9 3300005436 Ga0070713_100384540 Ga0070713_1003845402 288
10 3300005618 Ga0068864_100153691 Ga0068864_1001536912 288
11 3300005841 Ga0068863_100154759 Ga0068863_1001547592 288
12 3300014968 Ga0157379_10106533 Ga0157379_101065332 288
13 3300042876 Ga0451577_0037204 Ga0451577_0037204_2772_3758 293
14 3300044712 Ga0453684_0173106 Ga0453684_0173106_576_1562 293
15 3300045051 Ga0451576_0078828 Ga0451576_0078828_1365_2351 293
16 3300048910 Ga0496107_0097947 Ga0496107_0097947_14_919 293
17 3300005435 Ga0070714_100280366 Ga0070714_1002803662 300
18 3300005548 Ga0070665_100147446 Ga0070665_1001474462 300
19 3300014325 Ga0163163_10020675 Ga0163163_100206754 300
20 3300014326 Ga0157380_10462483 Ga0157380_104624832 300
21 3300025926 Ga0207659_10164532 Ga0207659_101645321 300
22 3300025929 Ga0207664_10288886 Ga0207664_102888862 300
23 3300028379 Ga0268266_10112195 Ga0268266_101121952 300
24 3300031995 Ga0307409_100092821 Ga0307409_1000928212 300
25 3300032002 Ga0307416_100065572 Ga0307416_1000655722 300
26 3300032005 Ga0307411_10050569 Ga0307411_100505692 300
27 3300049578 Ga0501042_0165837 Ga0501042_0165837_262_1239 300
28 3300049587 Ga0501071_0122366 Ga0501071_0122366_84_1061 300
29 3300049741 Ga0501079_0203078 Ga0501079_0203078_192_1169 300
30 3300050509 nmdc:mga0qj67_326349_c1 nmdc:mga0qj67_326349_c1_232_1173 300
31 3300005366 Ga0070659_100069810 Ga0070659_1000698103 302
32 3300025909 Ga0207705_10014329 Ga0207705_100143293 302
33 3300025931 Ga0207644_10120147 Ga0207644_101201472 302
34 3300025932 Ga0207690_10090752 Ga0207690_100907522 302
35 3300005471 Ga0070698_100037595 Ga0070698_1000375953 303
36 3300005548 Ga0070665_100000325 Ga0070665_10000032546 303
37 3300005841 Ga0068863_100064564 Ga0068863_1000645642 303
38 3300005843 Ga0068860_100013712 Ga0068860_1000137126 303
39 3300025918 Ga0207662_10237621 Ga0207662_102376212 303
40 3300026088 Ga0207641_10047045 Ga0207641_100470452 303
41 3300028379 Ga0268266_10003463 Ga0268266_100034635 303
42 3300028381 Ga0268264_10065093 Ga0268264_100650933 303
43 3300031995 Ga0307409_100036096 Ga0307409_1000360962 303
44 3300048911 Ga0496108_0013663 Ga0496108_0013663_1481_2440 303
45 3300048912 Ga0496109_0010734 Ga0496109_0010734_3134_4093 303
46 3300048916 Ga0496113_0007582 Ga0496113_0007582_2870_3829 303
47 3300005468 Ga0070707_100000163 Ga0070707_1000001637 304
48 3300005518 Ga0070699_100000999 Ga0070699_1000009997 304
49 3300025910 Ga0207684_10082177 Ga0207684_100821772 304
50 3300025922 Ga0207646_10007469 Ga0207646_100074697 304
51 3300005367 Ga0070667_100087408 Ga0070667_1000874082 306
52 3300005471 Ga0070698_100086185 Ga0070698_1000861852 307
53 3300046517 Ga0495630_0012130 Ga0495630_0012130_3783_4718 307
54 3300037853 Ga0436364_1044904 Ga0436364_1044904_814_1740 308
55 3300044673 Ga0453683_0023595 Ga0453683_0023595_203_1129 308
56 3300050512 nmdc:mga0n895_565138_c1 nmdc:mga0n895_565138_c1_86_1015 308
57 3300005327 Ga0070658_10119303 Ga0070658_101193032 309
58 3300005329 Ga0070683_100083830 Ga0070683_1000838302 309
59 3300005544 Ga0070686_100024560 Ga0070686_1000245603 309
60 3300005546 Ga0070696_100007691 Ga0070696_1000076913 309
61 3300005841 Ga0068863_100431066 Ga0068863_1004310662 309
62 3300009093 Ga0105240_10000859 Ga0105240_1000085929 309
63 3300009545 Ga0105237_10000015 Ga0105237_10000015106 309
64 3300010375 Ga0105239_10092116 Ga0105239_100921162 309
65 3300025909 Ga0207705_10168417 Ga0207705_101684172 309
66 3300025913 Ga0207695_10001410 Ga0207695_1000141029 309
67 3300025914 Ga0207671_10000007 Ga0207671_10000007673 309
68 3300025944 Ga0207661_10047336 Ga0207661_100473362 309
69 3300026118 Ga0207675_100174706 Ga0207675_1001747062 309
70 3300028794 Ga0307515_10000237 Ga0307515_1000023769 309
71 3300037471 Ga0395905_0000631 Ga0395905_0000631_6138_7067 309
72 3300044683 Ga0466965_0086175 Ga0466965_0086175_134_1063 309
73 3300048906 Ga0496103_0088687 Ga0496103_0088687_676_1632 309
74 3300049571 Ga0501034_0012311 Ga0501034_0012311_4722_5654 309
75 3300049580 Ga0501046_0034147 Ga0501046_0034147_21_953 309
76 3300049581 Ga0501047_0000333 Ga0501047_0000333_26285_27217 309
77 3300049742 Ga0501080_0057004 Ga0501080_0057004_762_1694 309
78 3300005444 Ga0070694_100235664 Ga0070694_1002356642 310
79 3300005445 Ga0070708_100036555 Ga0070708_1000365552 310
80 3300005467 Ga0070706_100000469 Ga0070706_10000046927 310
81 3300005468 Ga0070707_100010325 Ga0070707_1000103254 310
82 3300005549 Ga0070704_100009695 Ga0070704_1000096953 310
83 3300005843 Ga0068860_100071727 Ga0068860_1000717272 310
84 3300005985 Ga0081539_10007911 Ga0081539_100079114 310
85 3300009553 Ga0105249_10011950 Ga0105249_100119503 310
86 3300014325 Ga0163163_10021692 Ga0163163_100216923 310
87 3300014968 Ga0157379_10076989 Ga0157379_100769892 310
88 3300025910 Ga0207684_10002339 Ga0207684_100023397 310
89 3300025919 Ga0207657_10293510 Ga0207657_102935102 310
90 3300025922 Ga0207646_10014054 Ga0207646_100140544 310
91 3300031824 Ga0307413_10172416 Ga0307413_101724162 310
92 3300037471 Ga0395905_0176287 Ga0395905_0176287_572_1516 310
93 3300037853 Ga0436364_0985190 Ga0436364_0985190_61590_62531 310
94 3300042439 Ga0439464_0020995 Ga0439464_0020995_146_1105 310
95 3300047321 Ga0495676_0259658 Ga0495676_0259658_43_1005 310
96 3300050512 nmdc:mga0n895_224137_c1 nmdc:mga0n895_224137_c1_215_1156 310
97 3300005344 Ga0070661_100315103 Ga0070661_1003151032 311
98 3300005356 Ga0070674_100023738 Ga0070674_1000237382 311
99 3300005366 Ga0070659_100197975 Ga0070659_1001979752 311
100 3300005440 Ga0070705_100005298 Ga0070705_1000052982 311
101 3300005440 Ga0070705_100033309 Ga0070705_1000333092 311
102 3300005444 Ga0070694_100149049 Ga0070694_1001490492 311
103 3300005456 Ga0070678_100073404 Ga0070678_1000734043 311
104 3300005458 Ga0070681_10128048 Ga0070681_101280483 311
105 3300005459 Ga0068867_100492571 Ga0068867_1004925711 311
106 3300005467 Ga0070706_100031341 Ga0070706_1000313413 311
107 3300005468 Ga0070707_100010913 Ga0070707_1000109133 311
108 3300005468 Ga0070707_100033441 Ga0070707_1000334413 311
109 3300005518 Ga0070699_100010316 Ga0070699_1000103163 311
110 3300005535 Ga0070684_100005834 Ga0070684_1000058344 311
111 3300005536 Ga0070697_100006742 Ga0070697_1000067427 311
112 3300005544 Ga0070686_100089836 Ga0070686_1000898362 311
113 3300005545 Ga0070695_100047384 Ga0070695_1000473842 311
114 3300005545 Ga0070695_100076997 Ga0070695_1000769972 311
115 3300005545 Ga0070695_100199645 Ga0070695_1001996451 311
116 3300005546 Ga0070696_100009032 Ga0070696_1000090323 311
117 3300005549 Ga0070704_100011163 Ga0070704_1000111632 311
118 3300005564 Ga0070664_100111614 Ga0070664_1001116141 311
119 3300005719 Ga0068861_100159985 Ga0068861_1001599852 311
120 3300005842 Ga0068858_100283888 Ga0068858_1002838882 311
121 3300006871 Ga0075434_100374869 Ga0075434_1003748692 311
122 3300006871 Ga0075434_100646586 Ga0075434_1006465862 311
123 3300007788 Ga0099795_10083484 Ga0099795_100834842 311
124 3300009176 Ga0105242_10034763 Ga0105242_100347634 311
125 3300013308 Ga0157375_10059038 Ga0157375_100590382 311
126 3300014326 Ga0157380_10095748 Ga0157380_100957482 311
127 3300014968 Ga0157379_10090955 Ga0157379_100909552 311
128 3300014969 Ga0157376_10374263 Ga0157376_103742632 311
129 3300025885 Ga0207653_10048739 Ga0207653_100487392 311
130 3300025901 Ga0207688_10034285 Ga0207688_100342852 311
131 3300025910 Ga0207684_10037040 Ga0207684_100370403 311
132 3300025910 Ga0207684_10082084 Ga0207684_100820842 311
133 3300025912 Ga0207707_10323481 Ga0207707_103234812 311
134 3300025917 Ga0207660_10051607 Ga0207660_100516073 311
135 3300025922 Ga0207646_10013833 Ga0207646_100138334 311
136 3300025926 Ga0207659_10210404 Ga0207659_102104042 311
137 3300025927 Ga0207687_10175502 Ga0207687_101755022 311
138 3300025934 Ga0207686_10036660 Ga0207686_100366602 311
139 3300025937 Ga0207669_10013639 Ga0207669_100136392 311
140 3300025942 Ga0207689_10110985 Ga0207689_101109852 311
141 3300026075 Ga0207708_10063795 Ga0207708_100637952 311
142 3300026095 Ga0207676_10453667 Ga0207676_104536672 311
143 3300026121 Ga0207683_10034720 Ga0207683_100347202 311
144 3300031731 Ga0307405_10037808 Ga0307405_100378082 311
145 3300031911 Ga0307412_10122287 Ga0307412_101222872 311
146 3300031995 Ga0307409_100348219 Ga0307409_1003482192 311
147 3300032002 Ga0307416_100713969 Ga0307416_1007139692 311
148 3300032126 Ga0307415_100015753 Ga0307415_1000157532 311
149 3300048905 Ga0496102_0034274 Ga0496102_0034274_1963_2928 311
150 3300048906 Ga0496103_0031852 Ga0496103_0031852_1561_2523 311
151 3300048907 Ga0496104_0004307 Ga0496104_0004307_3802_4764 311
152 3300048907 Ga0496104_0272319 Ga0496104_0272319_49_1020 311
153 3300048908 Ga0496105_0066395 Ga0496105_0066395_531_1493 311
154 3300048908 Ga0496105_0113867 Ga0496105_0113867_274_1245 311
155 3300048910 Ga0496107_0083150 Ga0496107_0083150_824_1789 311
156 3300048912 Ga0496109_0049533 Ga0496109_0049533_2218_3180 311
157 3300048912 Ga0496109_0408038 Ga0496109_0408038_311_1270 311
158 3300048914 Ga0496111_0092663 Ga0496111_0092663_188_1150 311
159 3300048914 Ga0496111_0357480 Ga0496111_0357480_32_991 311
160 3300049568 Ga0501031_0083275 Ga0501031_0083275_182_1159 311
161 3300049572 Ga0501036_0054988 Ga0501036_0054988_1811_2788 311
162 3300049572 Ga0501036_0160884 Ga0501036_0160884_694_1671 311
163 3300049574 Ga0501038_0143076 Ga0501038_0143076_606_1568 311
164 3300049575 Ga0501039_0028857 Ga0501039_0028857_1536_2513 311
165 3300049575 Ga0501039_0041234 Ga0501039_0041234_1298_2260 311
166 3300049576 Ga0501040_0054795 Ga0501040_0054795_1339_2316 311
167 3300049576 Ga0501040_0142106 Ga0501040_0142106_501_1463 311
168 3300049578 Ga0501042_0057414 Ga0501042_0057414_1398_2360 311
169 3300049578 Ga0501042_0068051 Ga0501042_0068051_928_1905 311
170 3300049579 Ga0501043_0226413 Ga0501043_0226413_52_1014 311
171 3300049580 Ga0501046_0048975 Ga0501046_0048975_984_1946 311
172 3300049582 Ga0501048_0003450 Ga0501048_0003450_4840_5817 311
173 3300049582 Ga0501048_0055835 Ga0501048_0055835_1125_2102 311
174 3300049582 Ga0501048_0334347 Ga0501048_0334347_52_1014 311
175 3300049583 Ga0501067_0015310 Ga0501067_0015310_2008_2967 311
176 3300049583 Ga0501067_0108702 Ga0501067_0108702_483_1460 311
177 3300049584 Ga0501068_0037482 Ga0501068_0037482_689_1651 311
178 3300049584 Ga0501068_0126621 Ga0501068_0126621_303_1307 311
179 3300049585 Ga0501069_0065298 Ga0501069_0065298_141_1100 311
180 3300049587 Ga0501071_0022566 Ga0501071_0022566_2375_3352 311
181 3300049587 Ga0501071_0068883 Ga0501071_0068883_620_1582 311
182 3300049587 Ga0501071_0139754 Ga0501071_0139754_195_1172 311
183 3300049588 Ga0501072_0050062 Ga0501072_0050062_898_1875 311
184 3300049590 Ga0501074_0067581 Ga0501074_0067581_919_1896 311
185 3300049590 Ga0501074_0126355 Ga0501074_0126355_61_1023 311
186 3300049591 Ga0501075_0003439 Ga0501075_0003439_7066_8043 311
187 3300049591 Ga0501075_0101730 Ga0501075_0101730_531_1493 311
188 3300049592 Ga0501076_0002695 Ga0501076_0002695_7214_8191 311
189 3300049592 Ga0501076_0091322 Ga0501076_0091322_324_1286 311
190 3300049592 Ga0501076_0243418 Ga0501076_0243418_399_1376 311
191 3300049741 Ga0501079_0015506 Ga0501079_0015506_3099_4076 311
192 3300049741 Ga0501079_0023715 Ga0501079_0023715_1249_2226 311
193 3300049824 Ga0501045_0011204 Ga0501045_0011204_3048_4025 311
194 3300049824 Ga0501045_0012400 Ga0501045_0012400_2690_3667 311
195 3300049824 Ga0501045_0091190 Ga0501045_0091190_347_1309 311
196 3300050507 nmdc:mga05p37_616863_c1 nmdc:mga05p37_616863_c1_178_1140 311
197 3300050515 nmdc:mga0a205_64925_c1 nmdc:mga0a205_64925_c1_68_1030 311
198 3300054114 Ga0501084_0008761 Ga0501084_0008761_5160_6137 311
199 3300060353 Ga0501082_0154983 Ga0501082_0154983_942_1919 311
200 3300060353 Ga0501082_0157294 Ga0501082_0157294_357_1319 311
201 3300061734 Ga0530510_0031298 Ga0530510_0031298_2302_3279 311
202 3300061734 Ga0530510_0121658 Ga0530510_0121658_708_1685 311
203 3300009098 Ga0105245_10063644 Ga0105245_100636442 338
204 3300025949 Ga0207667_10342272 Ga0207667_103422721 338
205 3300005327 Ga0070658_10004625 Ga0070658_100046255 340
206 3300025909 Ga0207705_10011278 Ga0207705_100112785 340
207 3300025949 Ga0207667_10264212 Ga0207667_102642122 340

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

21

165

0.91

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

87

200

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9581 3 226
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9563 1 219
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9443 1 236
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9364 1 219
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9324 3 223
ID Description Score Start End Superfamily
af_Q8T5Z7_540_794_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.974 2 225 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9679 4 226 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9624 2 226 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9607 3 219 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9601 1 225 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X6ISA8-F1-model_v4 deleted 0.9808 59 163
AF-A0A535BYD7-F1-model_v4 ATP-binding cassette domain-containing protein 0.9741 2 223 GO:0005524
GO:0016887
AF-A0A351XM45-F1-model_v4 ABC transporter ATP-binding protein 0.9707 96 219 GO:0005524
GO:0016887
AF-A0A2V3VNW7-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9689 1 226 GO:0005524
GO:0005886
GO:0016887
AF-X1SKC9-F1-model_v4 ABC transporter domain-containing protein 0.9683 45 226 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
84.26 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map