F315768

General Info

Members Datasets Scaffolds Average Seq Length
206 142 205 139

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0696544|Ga0501084_0696544_176_592
Length 138
Sequence MNWVTRANCHVDRTACAWLIRRYIDPDATFVFVTDTADLPTDATAFDVPGQPFSHRDGASTFEVMARHYGITDSAVARIGRIVHEADIEDEQFDAPEAPGLDSVIRGLGALLPDDASLIEYALPIYDGLLATFGSSER

Samples

Sample ID Description Type Environment
1 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
63 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
65 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
66 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
67 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
70 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
82 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
83 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
84 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
85 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
86 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
104 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 6.8
Rhizosphere 91.75
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10374538 3300005328 Bacteria 984
2 Ga0068868_100719663 3300005338 Unclassified 894
3 Ga0070714_100459098 3300005435 Bacteria 1211
4 Ga0070713_100183876 3300005436 Bacteria 1880
5 Ga0070711_100892644 3300005439 Unclassified 758
6 Ga0070705_100313105 3300005440 Bacteria 1130
7 Ga0070694_100365650 3300005444 Bacteria 1121
8 Ga0070708_100023666 3300005445 Bacteria 5226
9 Ga0070708_100072160 3300005445 Unclassified 3110
10 Ga0070708_100248123 3300005445 Bacteria 1672
11 Ga0070708_100280518 3300005445 Bacteria 1568
12 Ga0070708_100538992 3300005445 Unclassified 1101
13 Ga0070706_100078167 3300005467 Bacteria 3063
14 Ga0070706_100159613 3300005467 Bacteria 2105
15 Ga0070706_100285953 3300005467 Bacteria 1539
16 Ga0070707_100571319 3300005468 Bacteria 1093
17 Ga0070698_100013543 3300005471 Bacteria 8634
18 Ga0070698_100065331 3300005471 Bacteria 3664
19 Ga0070698_100236635 3300005471 Unclassified 1759
20 Ga0070699_100005379 3300005518 Bacteria 11231
21 Ga0070697_100080944 3300005536 Bacteria 2676
22 Ga0070697_100681594 3300005536 Bacteria 906
23 Ga0070696_101182706 3300005546 Unclassified 645
24 Ga0068854_100772369 3300005578 Bacteria 835
25 Ga0068856_100070326 3300005614 Bacteria 3462
26 Ga0068858_100623602 3300005842 Bacteria 1047
27 Ga0081455_10082989 3300005937 Bacteria 2620
28 Ga0081539_10015994 3300005985 Bacteria 5402
29 Ga0070717_10020573 3300006028 Bacteria 5192
30 Ga0070717_10791290 3300006028 Bacteria 863
31 Ga0097621_101085601 3300006237 Bacteria 751
32 Ga0075370_10268134 3300006353 Bacteria 1013
33 Ga0075428_100507421 3300006844 Bacteria 1290
34 Ga0075428_100515931 3300006844 Bacteria 1278
35 Ga0075428_101866423 3300006844 Bacteria 625
36 Ga0075430_100042951 3300006846 Bacteria 3822
37 Ga0075430_100086454 3300006846 Bacteria 2624
38 Ga0075430_100260880 3300006846 Bacteria 1435
39 Ga0075431_100002670 3300006847 Bacteria 17285
40 Ga0075431_100003981 3300006847 Bacteria 14403
41 Ga0075431_100193488 3300006847 Unclassified 2083
42 Ga0075431_100329322 3300006847 Bacteria 1538
43 Ga0075433_10024621 3300006852 Bacteria 5083
44 Ga0075433_10286456 3300006852 Bacteria 1459
45 Ga0075434_100012544 3300006871 Bacteria 8038
46 Ga0075429_100004553 3300006880 Bacteria 11917
47 Ga0075429_100005828 3300006880 Bacteria 10631
48 Ga0075429_101555728 3300006880 Unclassified 575
49 Ga0068865_101761376 3300006881 Bacteria 559
50 Ga0075436_100027754 3300006914 Bacteria 3897
51 Ga0075435_100003474 3300007076 Bacteria 10689
52 Ga0075435_101189180 3300007076 Bacteria 667
53 Ga0105245_10064624 3300009098 Bacteria 3307
54 Ga0105245_10358666 3300009098 Bacteria 1446
55 Ga0114129_10009347 3300009147 Bacteria 13979
56 Ga0114129_10057272 3300009147 Bacteria 5455
57 Ga0114129_10819873 3300009147 Bacteria 1185
58 Ga0105242_11504087 3300009176 Bacteria 704
59 Ga0105248_10355370 3300009177 Bacteria 1650
60 Ga0105238_10092556 3300009551 Bacteria 3011
61 Ga0105238_10565760 3300009551 Bacteria 1142
62 Ga0105249_10521077 3300009553 Bacteria 1236
63 Ga0105246_10114758 3300011119 Unclassified 1985
64 Ga0207645_10796288 3300025907 Bacteria 643
65 Ga0207684_10021683 3300025910 Bacteria 5484
66 Ga0207684_10035840 3300025910 Bacteria 4212
67 Ga0207684_10053254 3300025910 Bacteria 3435
68 Ga0207693_10407341 3300025915 Bacteria 1063
69 Ga0207646_10203704 3300025922 Bacteria 1787
70 Ga0207646_10333504 3300025922 Unclassified 1370
71 Ga0207694_10202715 3300025924 Bacteria 1614
72 Ga0207687_10035243 3300025927 Unclassified 3403
73 Ga0207687_10948166 3300025927 Bacteria 737
74 Ga0207700_10329316 3300025928 Bacteria 1325
75 Ga0207700_11086356 3300025928 Bacteria 715
76 Ga0207689_10101352 3300025942 Bacteria 2365
77 Ga0207712_10483416 3300025961 Bacteria 1056
78 Ga0207703_10500404 3300026035 Bacteria 1141
79 Ga0207675_102720580 3300026118 Bacteria 503
80 Ga0268264_10555992 3300028381 Bacteria 1126
81 Ga0307408_100810104 3300031548 Bacteria 851
82 Ga0307405_10279565 3300031731 Bacteria 1256
83 Ga0307413_10040942 3300031824 Bacteria 2709
84 Ga0307413_10072517 3300031824 Bacteria 2174
85 Ga0307410_10074762 3300031852 Bacteria 2361
86 Ga0307410_10157605 3300031852 Bacteria 1697
87 Ga0307407_10284537 3300031903 Bacteria 1147
88 Ga0307409_100057468 3300031995 Bacteria 3015
89 Ga0307409_100094465 3300031995 Bacteria 2460
90 Ga0307416_100046199 3300032002 Bacteria 3435
91 Ga0307416_100434125 3300032002 Bacteria 1361
92 Ga0307416_100456020 3300032002 Bacteria 1332
93 Ga0307414_10126150 3300032004 Bacteria 1978
94 Ga0307414_11014566 3300032004 Bacteria 764
95 Ga0307411_10032874 3300032005 Bacteria 3211
96 Ga0307411_10076506 3300032005 Bacteria 2288
97 Ga0307415_100505209 3300032126 Bacteria 1058
98 Ga0307415_100622703 3300032126 Bacteria 964
99 Ga0307415_100817124 3300032126 Bacteria 852
100 Ga0373934_0036802 3300035086 Bacteria 1928
101 Ga0373923_0018034 3300035111 Bacteria 2710
102 Ga0373954_0278717 3300035118 Bacteria 824
103 Ga0373946_0157616 3300035171 Bacteria 1063
104 Ga0373955_0308211 3300035172 Bacteria 955
105 Ga0373935_0020692 3300035692 Bacteria 4022
106 Ga0373935_0220503 3300035692 Unclassified 1317
107 Ga0373927_0451563 3300035695 Unclassified 849
108 Ga0373933_0042771 3300035724 Bacteria 2678
109 Ga0373947_0059833 3300035725 Unclassified 2311
110 Ga0373937_0062531 3300036401 Bacteria 3422
111 Ga0373925_0193752 3300037068 Bacteria 1614
112 Ga0373925_0705670 3300037068 Bacteria 832
113 Ga0395899_0297254 3300037312 Bacteria 1094
114 Ga0395900_0609561 3300037418 Bacteria 1031
115 Ga0395898_0011060 3300037466 Bacteria 9398
116 Ga0395905_0018716 3300037471 Bacteria 6570
117 Ga0395905_0880251 3300037471 Bacteria 799
118 Ga0395901_0155791 3300038443 Bacteria 2399
119 Ga0439435_0233220 3300042436 Unclassified 615
120 Ga0495592_0257759 3300046454 Bacteria 1150
121 Ga0495651_0064809 3300046462 Bacteria 2792
122 Ga0495653_0022853 3300046463 Bacteria 5057
123 Ga0495582_0560128 3300046473 Unclassified 661
124 Ga0495639_0111433 3300046475 Bacteria 1299
125 Ga0495664_0243302 3300046477 Bacteria 1088
126 Ga0495608_0837887 3300046511 Bacteria 541
127 Ga0495618_0021390 3300046514 Bacteria 3988
128 Ga0495630_0192894 3300046517 Bacteria 1554
129 Ga0495666_0572854 3300046526 Bacteria 503
130 Ga0495652_0144265 3300046529 Bacteria 1868
131 Ga0495665_0074455 3300046531 Unclassified 1788
132 Ga0495587_0252385 3300046536 Bacteria 992
133 Ga0495609_0148756 3300046538 Bacteria 997
134 Ga0495645_0068347 3300046543 Bacteria 2565
135 Ga0495667_0036747 3300046559 Bacteria 3267
136 Ga0495634_0393059 3300046642 Bacteria 825
137 Ga0495635_0171285 3300046663 Bacteria 1476
138 Ga0495599_0025009 3300046678 Bacteria 3736
139 Ga0495658_0060592 3300046683 Bacteria 2171
140 Ga0495658_0514931 3300046683 Unclassified 766
141 Ga0495613_0018750 3300046689 Bacteria 5159
142 Ga0495613_0093496 3300046689 Bacteria 2177
143 Ga0495613_0322380 3300046689 Bacteria 1066
144 Ga0495624_0493742 3300046690 Bacteria 732
145 Ga0495604_0217447 3300047317 Bacteria 1317
146 Ga0495674_0023224 3300047319 Bacteria 5717
147 Ga0495674_0303653 3300047319 Bacteria 1303
148 Ga0495680_0035150 3300047322 Bacteria 4039
149 Ga0495677_0422213 3300047445 Bacteria 528
150 Ga0495684_0013644 3300047471 Bacteria 6257
151 Ga0495684_0177237 3300047471 Bacteria 1582
152 Ga0496103_0835366 3300048906 Bacteria 580
153 Ga0496104_0191583 3300048907 Bacteria 1956
154 Ga0496105_0283118 3300048908 Bacteria 1336
155 Ga0496106_0255688 3300048909 Bacteria 1401
156 Ga0496107_0630869 3300048910 Bacteria 791
157 Ga0496108_0195361 3300048911 Bacteria 1755
158 Ga0496108_0638207 3300048911 Bacteria 926
159 Ga0496109_0005143 3300048912 Bacteria 10918
160 Ga0496109_0066794 3300048912 Bacteria 3294
161 Ga0496110_0062613 3300048913 Bacteria 3286
162 Ga0496111_0044674 3300048914 Bacteria 3185
163 Ga0496112_0548704 3300048915 Bacteria 1090
164 Ga0496113_0861819 3300048916 Bacteria 718
165 Ga0496114_0883069 3300048917 Unclassified 775
166 Ga0501031_0652893 3300049568 Bacteria 676
167 Ga0501038_0175918 3300049574 Bacteria 1730
168 Ga0501040_0053937 3300049576 Bacteria 2755
169 Ga0501041_0071303 3300049577 Bacteria 2133
170 Ga0501043_0116099 3300049579 Bacteria 2101
171 Ga0501068_0467407 3300049584 Unclassified 817
172 Ga0501071_0141065 3300049587 Bacteria 1794
173 Ga0501072_0036220 3300049588 Bacteria 3868
174 Ga0501072_0414550 3300049588 Bacteria 1068
175 Ga0501075_0163488 3300049591 Bacteria 1698
176 Ga0501076_0020957 3300049592 Bacteria 5007
177 Ga0501080_0355045 3300049742 Bacteria 1323
178 Ga0501035_0587878 3300049822 Bacteria 909
179 Ga0501045_0026848 3300049824 Bacteria 4144
180 nmdc:mga07m45_593449_c1 3300050496 Bacteria 640
181 nmdc:mga05p37_646349_c1 3300050507 Bacteria 1185
182 nmdc:mga05p37_723718_c1 3300050507 Unclassified 1102
183 nmdc:mga09592_1309233_c1 3300050508 Unclassified 595
184 nmdc:mga09592_9300_c1 3300050508 Bacteria 7989
185 nmdc:mga0qj67_1606_c1 3300050509 Bacteria 15909
186 nmdc:mga0qj67_60477_c1 3300050509 Bacteria 3006
187 nmdc:mga06r32_1730350_c1 3300050510 Bacteria 562
188 nmdc:mga06r32_2979_c1 3300050510 Bacteria 15181
189 nmdc:mga06r32_318795_c1 3300050510 Bacteria 1540
190 nmdc:mga06r32_55824_c1 3300050510 Bacteria 3790
191 nmdc:mga06r32_615945_c1 3300050510 Unclassified 1056
192 nmdc:mga06r32_627607_c1 3300050510 Bacteria 1044
193 nmdc:mga0n895_1002341_c1 3300050512 Bacteria 816
194 nmdc:mga0n895_141763_c1 3300050512 Bacteria 2432
195 nmdc:mga0n895_28639_c1 3300050512 Bacteria 5301
196 nmdc:mga0rr50_1322851_c1 3300050513 Bacteria 611
197 nmdc:mga0rr50_7016_c1 3300050513 Bacteria 6914
198 nmdc:mga08x19_24038_c1 3300050514 Bacteria 3783
199 nmdc:mga0a205_11958_c1 3300050515 Bacteria 8016
200 nmdc:mga0a205_367204_c1 3300050515 Bacteria 1305
201 Ga0501084_0136958 3300054114 Bacteria 2061
202 Ga0501084_0292757 3300054114 Bacteria 1375
203 Ga0501084_0696544 3300054114 Bacteria 857
204 Ga0501082_0083448 3300060353 Bacteria 2757
205 Ga0530510_0053120 3300061734 Bacteria 2928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0652893 Ga0501031_0652893_59_421 120
2 3300009176 Ga0105242_11504087 Ga0105242_115040871 124
3 3300011119 Ga0105246_10114758 Ga0105246_101147582 124
4 3300050513 nmdc:mga0rr50_1322851_c1 nmdc:mga0rr50_1322851_c1_218_592 124
5 3300009147 Ga0114129_10819873 Ga0114129_108198732 125
6 3300046538 Ga0495609_0148756 Ga0495609_0148756_246_623 125
7 3300047445 Ga0495677_0422213 Ga0495677_0422213_128_505 125
8 3300049588 Ga0501072_0414550 Ga0501072_0414550_163_540 125
9 3300050507 nmdc:mga05p37_646349_c1 nmdc:mga05p37_646349_c1_616_993 125
10 3300050512 nmdc:mga0n895_1002341_c1 nmdc:mga0n895_1002341_c1_312_689 125
11 3300050515 nmdc:mga0a205_367204_c1 nmdc:mga0a205_367204_c1_393_770 125
12 3300028381 Ga0268264_10555992 Ga0268264_105559922 128
13 3300006881 Ga0068865_101761376 Ga0068865_1017613761 131
14 3300009098 Ga0105245_10064624 Ga0105245_100646242 131
15 3300005445 Ga0070708_100023666 Ga0070708_1000236664 133
16 3300005445 Ga0070708_100248123 Ga0070708_1002481232 133
17 3300006847 Ga0075431_100003981 Ga0075431_10000398113 133
18 3300009177 Ga0105248_10355370 Ga0105248_103553702 133
19 3300009551 Ga0105238_10092556 Ga0105238_100925562 133
20 3300035086 Ga0373934_0036802 Ga0373934_0036802_417_818 133
21 3300035111 Ga0373923_0018034 Ga0373923_0018034_757_1158 133
22 3300035118 Ga0373954_0278717 Ga0373954_0278717_280_681 133
23 3300035172 Ga0373955_0308211 Ga0373955_0308211_432_833 133
24 3300035724 Ga0373933_0042771 Ga0373933_0042771_746_1147 133
25 3300036401 Ga0373937_0062531 Ga0373937_0062531_2276_2677 133
26 3300037068 Ga0373925_0705670 Ga0373925_0705670_318_719 133
27 3300046454 Ga0495592_0257759 Ga0495592_0257759_410_811 133
28 3300046462 Ga0495651_0064809 Ga0495651_0064809_677_1078 133
29 3300046463 Ga0495653_0022853 Ga0495653_0022853_737_1138 133
30 3300046477 Ga0495664_0243302 Ga0495664_0243302_257_658 133
31 3300046514 Ga0495618_0021390 Ga0495618_0021390_1762_2163 133
32 3300046529 Ga0495652_0144265 Ga0495652_0144265_35_436 133
33 3300046536 Ga0495587_0252385 Ga0495587_0252385_547_948 133
34 3300046543 Ga0495645_0068347 Ga0495645_0068347_1573_1974 133
35 3300046559 Ga0495667_0036747 Ga0495667_0036747_675_1076 133
36 3300046663 Ga0495635_0171285 Ga0495635_0171285_689_1090 133
37 3300046678 Ga0495599_0025009 Ga0495599_0025009_753_1154 133
38 3300046690 Ga0495624_0493742 Ga0495624_0493742_147_548 133
39 3300047317 Ga0495604_0217447 Ga0495604_0217447_156_557 133
40 3300047319 Ga0495674_0023224 Ga0495674_0023224_2915_3316 133
41 3300047319 Ga0495674_0303653 Ga0495674_0303653_791_1192 133
42 3300047322 Ga0495680_0035150 Ga0495680_0035150_763_1164 133
43 3300047471 Ga0495684_0013644 Ga0495684_0013644_2130_2531 133
44 3300048915 Ga0496112_0548704 Ga0496112_0548704_483_884 133
45 3300049574 Ga0501038_0175918 Ga0501038_0175918_556_957 133
46 3300049576 Ga0501040_0053937 Ga0501040_0053937_1836_2237 133
47 3300049577 Ga0501041_0071303 Ga0501041_0071303_524_925 133
48 3300049579 Ga0501043_0116099 Ga0501043_0116099_111_512 133
49 3300049584 Ga0501068_0467407 Ga0501068_0467407_150_551 133
50 3300049587 Ga0501071_0141065 Ga0501071_0141065_389_790 133
51 3300049588 Ga0501072_0036220 Ga0501072_0036220_2226_2627 133
52 3300049591 Ga0501075_0163488 Ga0501075_0163488_901_1302 133
53 3300049592 Ga0501076_0020957 Ga0501076_0020957_3408_3809 133
54 3300049742 Ga0501080_0355045 Ga0501080_0355045_152_553 133
55 3300049822 Ga0501035_0587878 Ga0501035_0587878_69_470 133
56 3300049824 Ga0501045_0026848 Ga0501045_0026848_3462_3863 133
57 3300050508 nmdc:mga09592_1309233_c1 nmdc:mga09592_1309233_c1_53_454 133
58 3300050510 nmdc:mga06r32_2979_c1 nmdc:mga06r32_2979_c1_334_735 133
59 3300050510 nmdc:mga06r32_318795_c1 nmdc:mga06r32_318795_c1_148_549 133
60 3300050510 nmdc:mga06r32_627607_c1 nmdc:mga06r32_627607_c1_240_641 133
61 3300050512 nmdc:mga0n895_141763_c1 nmdc:mga0n895_141763_c1_726_1127 133
62 3300054114 Ga0501084_0136958 Ga0501084_0136958_977_1378 133
63 3300060353 Ga0501082_0083448 Ga0501082_0083448_872_1273 133
64 3300061734 Ga0530510_0053120 Ga0530510_0053120_1900_2301 133
65 3300031548 Ga0307408_100810104 Ga0307408_1008101041 135
66 3300032002 Ga0307416_100456020 Ga0307416_1004560202 135
67 3300035692 Ga0373935_0220503 Ga0373935_0220503_689_1096 135
68 3300005435 Ga0070714_100459098 Ga0070714_1004590982 136
69 3300005578 Ga0068854_100772369 Ga0068854_1007723692 136
70 3300006028 Ga0070717_10020573 Ga0070717_100205733 136
71 3300025907 Ga0207645_10796288 Ga0207645_107962882 136
72 3300025915 Ga0207693_10407341 Ga0207693_104073412 136
73 3300025942 Ga0207689_10101352 Ga0207689_101013524 136
74 3300026118 Ga0207675_102720580 Ga0207675_1027205801 136
75 3300048906 Ga0496103_0835366 Ga0496103_0835366_111_521 136
76 3300048909 Ga0496106_0255688 Ga0496106_0255688_637_1047 136
77 3300048910 Ga0496107_0630869 Ga0496107_0630869_316_726 136
78 3300054114 Ga0501084_0696544 Ga0501084_0696544_176_592 136
79 3300054114 Ga0501084_0292757 Ga0501084_0292757_774_1193 137
80 iso_pu_bacteria 2902810491 2902816436 139
81 3300009551 Ga0105238_10565760 Ga0105238_105657602 140
82 3300005338 Ga0068868_100719663 Ga0068868_1007196632 141
83 3300025927 Ga0207687_10035243 Ga0207687_100352432 141
84 3300046475 Ga0495639_0111433 Ga0495639_0111433_563_988 141
85 3300005439 Ga0070711_100892644 Ga0070711_1008926442 142
86 3300006846 Ga0075430_100042951 Ga0075430_1000429513 142
87 3300031731 Ga0307405_10279565 Ga0307405_102795652 142
88 3300046526 Ga0495666_0572854 Ga0495666_0572854_29_463 142
89 3300046683 Ga0495658_0060592 Ga0495658_0060592_205_639 142
90 3300046689 Ga0495613_0093496 Ga0495613_0093496_404_838 142
91 3300050509 nmdc:mga0qj67_60477_c1 nmdc:mga0qj67_60477_c1_338_769 142
92 3300005328 Ga0070676_10374538 Ga0070676_103745382 143
93 3300005436 Ga0070713_100183876 Ga0070713_1001838762 143
94 3300005440 Ga0070705_100313105 Ga0070705_1003131053 143
95 3300005444 Ga0070694_100365650 Ga0070694_1003656502 143
96 3300005445 Ga0070708_100072160 Ga0070708_1000721603 143
97 3300005445 Ga0070708_100280518 Ga0070708_1002805183 143
98 3300005445 Ga0070708_100538992 Ga0070708_1005389922 143
99 3300005467 Ga0070706_100078167 Ga0070706_1000781672 143
100 3300005467 Ga0070706_100159613 Ga0070706_1001596134 143
101 3300005467 Ga0070706_100285953 Ga0070706_1002859533 143
102 3300005468 Ga0070707_100571319 Ga0070707_1005713192 143
103 3300005471 Ga0070698_100013543 Ga0070698_1000135439 143
104 3300005471 Ga0070698_100065331 Ga0070698_1000653313 143
105 3300005471 Ga0070698_100236635 Ga0070698_1002366352 143
106 3300005518 Ga0070699_100005379 Ga0070699_10000537918 143
107 3300005536 Ga0070697_100080944 Ga0070697_1000809442 143
108 3300005536 Ga0070697_100681594 Ga0070697_1006815942 143
109 3300005546 Ga0070696_101182706 Ga0070696_1011827062 143
110 3300005614 Ga0068856_100070326 Ga0068856_1000703261 143
111 3300005842 Ga0068858_100623602 Ga0068858_1006236022 143
112 3300005937 Ga0081455_10082989 Ga0081455_100829893 143
113 3300005985 Ga0081539_10015994 Ga0081539_100159942 143
114 3300006028 Ga0070717_10791290 Ga0070717_107912902 143
115 3300006237 Ga0097621_101085601 Ga0097621_1010856012 143
116 3300006353 Ga0075370_10268134 Ga0075370_102681342 143
117 3300006844 Ga0075428_100507421 Ga0075428_1005074212 143
118 3300006844 Ga0075428_100515931 Ga0075428_1005159312 143
119 3300006844 Ga0075428_101866423 Ga0075428_1018664231 143
120 3300006846 Ga0075430_100086454 Ga0075430_1000864543 143
121 3300006846 Ga0075430_100260880 Ga0075430_1002608801 143
122 3300006847 Ga0075431_100002670 Ga0075431_10000267016 143
123 3300006847 Ga0075431_100193488 Ga0075431_1001934882 143
124 3300006847 Ga0075431_100329322 Ga0075431_1003293222 143
125 3300006852 Ga0075433_10024621 Ga0075433_100246215 143
126 3300006852 Ga0075433_10286456 Ga0075433_102864562 143
127 3300006871 Ga0075434_100012544 Ga0075434_10001254411 143
128 3300006880 Ga0075429_100004553 Ga0075429_1000045532 143
129 3300006880 Ga0075429_100005828 Ga0075429_1000058283 143
130 3300006880 Ga0075429_101555728 Ga0075429_1015557282 143
131 3300006914 Ga0075436_100027754 Ga0075436_1000277542 143
132 3300007076 Ga0075435_100003474 Ga0075435_1000034745 143
133 3300007076 Ga0075435_101189180 Ga0075435_1011891802 143
134 3300009098 Ga0105245_10358666 Ga0105245_103586663 143
135 3300009147 Ga0114129_10009347 Ga0114129_1000934713 143
136 3300009147 Ga0114129_10057272 Ga0114129_100572725 143
137 3300009553 Ga0105249_10521077 Ga0105249_105210772 143
138 3300025910 Ga0207684_10021683 Ga0207684_100216835 143
139 3300025910 Ga0207684_10035840 Ga0207684_100358405 143
140 3300025910 Ga0207684_10053254 Ga0207684_100532543 143
141 3300025922 Ga0207646_10203704 Ga0207646_102037042 143
142 3300025922 Ga0207646_10333504 Ga0207646_103335042 143
143 3300025924 Ga0207694_10202715 Ga0207694_102027152 143
144 3300025927 Ga0207687_10948166 Ga0207687_109481662 143
145 3300025928 Ga0207700_10329316 Ga0207700_103293162 143
146 3300025928 Ga0207700_11086356 Ga0207700_110863562 143
147 3300025961 Ga0207712_10483416 Ga0207712_104834162 143
148 3300026035 Ga0207703_10500404 Ga0207703_105004042 143
149 3300031824 Ga0307413_10040942 Ga0307413_100409424 143
150 3300031824 Ga0307413_10072517 Ga0307413_100725173 143
151 3300031852 Ga0307410_10074762 Ga0307410_100747624 143
152 3300031852 Ga0307410_10157605 Ga0307410_101576052 143
153 3300031903 Ga0307407_10284537 Ga0307407_102845372 143
154 3300031995 Ga0307409_100057468 Ga0307409_1000574683 143
155 3300031995 Ga0307409_100094465 Ga0307409_1000944654 143
156 3300032002 Ga0307416_100046199 Ga0307416_1000461994 143
157 3300032002 Ga0307416_100434125 Ga0307416_1004341252 143
158 3300032004 Ga0307414_10126150 Ga0307414_101261502 143
159 3300032004 Ga0307414_11014566 Ga0307414_110145662 143
160 3300032005 Ga0307411_10032874 Ga0307411_100328742 143
161 3300032005 Ga0307411_10076506 Ga0307411_100765062 143
162 3300032126 Ga0307415_100505209 Ga0307415_1005052092 143
163 3300032126 Ga0307415_100622703 Ga0307415_1006227032 143
164 3300032126 Ga0307415_100817124 Ga0307415_1008171241 143
165 3300035171 Ga0373946_0157616 Ga0373946_0157616_541_972 143
166 3300035692 Ga0373935_0020692 Ga0373935_0020692_2650_3081 143
167 3300035695 Ga0373927_0451563 Ga0373927_0451563_167_598 143
168 3300035725 Ga0373947_0059833 Ga0373947_0059833_1053_1484 143
169 3300037068 Ga0373925_0193752 Ga0373925_0193752_1148_1579 143
170 3300037312 Ga0395899_0297254 Ga0395899_0297254_486_917 143
171 3300037418 Ga0395900_0609561 Ga0395900_0609561_366_797 143
172 3300037466 Ga0395898_0011060 Ga0395898_0011060_2624_3055 143
173 3300037471 Ga0395905_0018716 Ga0395905_0018716_524_955 143
174 3300037471 Ga0395905_0880251 Ga0395905_0880251_139_570 143
175 3300038443 Ga0395901_0155791 Ga0395901_0155791_10_441 143
176 3300042436 Ga0439435_0233220 Ga0439435_0233220_10_441 143
177 3300046473 Ga0495582_0560128 Ga0495582_0560128_219_650 143
178 3300046511 Ga0495608_0837887 Ga0495608_0837887_21_452 143
179 3300046517 Ga0495630_0192894 Ga0495630_0192894_608_1039 143
180 3300046531 Ga0495665_0074455 Ga0495665_0074455_1252_1683 143
181 3300046642 Ga0495634_0393059 Ga0495634_0393059_323_754 143
182 3300046683 Ga0495658_0514931 Ga0495658_0514931_186_617 143
183 3300046689 Ga0495613_0018750 Ga0495613_0018750_4384_4815 143
184 3300046689 Ga0495613_0322380 Ga0495613_0322380_475_906 143
185 3300047471 Ga0495684_0177237 Ga0495684_0177237_281_712 143
186 3300048907 Ga0496104_0191583 Ga0496104_0191583_1410_1841 143
187 3300048908 Ga0496105_0283118 Ga0496105_0283118_893_1324 143
188 3300048911 Ga0496108_0195361 Ga0496108_0195361_973_1404 143
189 3300048911 Ga0496108_0638207 Ga0496108_0638207_215_646 143
190 3300048912 Ga0496109_0005143 Ga0496109_0005143_9088_9519 143
191 3300048912 Ga0496109_0066794 Ga0496109_0066794_1916_2347 143
192 3300048913 Ga0496110_0062613 Ga0496110_0062613_2191_2622 143
193 3300048914 Ga0496111_0044674 Ga0496111_0044674_934_1365 143
194 3300048916 Ga0496113_0861819 Ga0496113_0861819_47_478 143
195 3300048917 Ga0496114_0883069 Ga0496114_0883069_259_690 143
196 3300050496 nmdc:mga07m45_593449_c1 nmdc:mga07m45_593449_c1_166_597 143
197 3300050507 nmdc:mga05p37_723718_c1 nmdc:mga05p37_723718_c1_84_515 143
198 3300050508 nmdc:mga09592_9300_c1 nmdc:mga09592_9300_c1_6247_6678 143
199 3300050509 nmdc:mga0qj67_1606_c1 nmdc:mga0qj67_1606_c1_15421_15852 143
200 3300050510 nmdc:mga06r32_1730350_c1 nmdc:mga06r32_1730350_c1_38_469 143
201 3300050510 nmdc:mga06r32_55824_c1 nmdc:mga06r32_55824_c1_1603_2034 143
202 3300050510 nmdc:mga06r32_615945_c1 nmdc:mga06r32_615945_c1_84_515 143
203 3300050512 nmdc:mga0n895_28639_c1 nmdc:mga0n895_28639_c1_168_599 143
204 3300050513 nmdc:mga0rr50_7016_c1 nmdc:mga0rr50_7016_c1_3448_3879 143
205 3300050514 nmdc:mga08x19_24038_c1 nmdc:mga08x19_24038_c1_1858_2289 143
206 3300050515 nmdc:mga0a205_11958_c1 nmdc:mga0a205_11958_c1_3373_3804 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09828

ChrB_C

ChrB, C-terminal domain

3

133

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cgc-assembly3.cif.gz_C silver-bound e. coli malate dehydrogenase (c113 and c251) 0.6046 1 30
7cgc-assembly2.cif.gz_B silver-bound e. coli malate dehydrogenase (c113 and c251) 0.6031 1 30
5z3w-assembly2.cif.gz_B malate dehydrogenase binds silver at c113 0.5988 1 30
2hma-assembly1.cif.gz_A-2 the crystal structure of trna (5-methylaminomethyl-2-thiouridylate)-methyltransferase trmu from streptococcus pneumoniae 0.5909 1 37
6ixn-assembly1.cif.gz_B crystal structure of isocitrate dehydrogenase from ostreococcus tauri in complex with nad+ and citrate 0.5862 2 29
ID Description Score Start End Superfamily
3tqwB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.5972 1 38 3.40.190.10
af_A0A1D8PJH8_2_97_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.5772 1 38 3.40.190.10
2d3iA03 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.5711 1 38 3.40.190.10
1iq7A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.57 1 38 3.40.190.10
af_A8DZ59_1_333_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.5563 2 54 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A522DYA4-F1-model_v4 Chromate resistance protein 0.9916 2 48
AF-A0A7Z0DTU7-F1-model_v4 ChrB C-terminal domain-containing protein 0.9903 1 99
AF-A0A522JMI9-F1-model_v4 Chromate resistance protein 0.9886 2 43
AF-A0A318L9D9-F1-model_v4 Chromate resistance protein 0.9866 1 108
AF-A0A836WII8-F1-model_v4 ChrB protein 0.9849 2 135

Feature Viewer

pLDDT pTM Quality
96.05 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map